HHsearch alignment for GI: 254780781 and conserved domain: cd05825

>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E. coli wcaF gene and similar proteins. WcaF is part of the gene cluster responsible for the biosynthesis of the extracellular polysaccharide colanic acid. The wcaF protein is predicted to contain a left-handed parallel beta-helix (LbH) domain encoded by imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. Many are trimeric in their active forms.
Probab=99.58  E-value=5.1e-15  Score=112.53  Aligned_cols=93  Identities=28%  Similarity=0.401  Sum_probs=61.3

Q ss_pred             CCCCCCCCCCC--CEECCEEEECCCCEEECCCEE-CCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEEC
Q ss_conf             33677201566--123220473068688123211-210057765644872584782185784688845885663004652
Q gi|254780781|r  139 YIGEGSMIDTW--STVGSCAQIGKNVHISGGVGI-GGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIG  215 (285)
Q Consensus       139 ~Ig~gt~I~~~--a~IG~~a~IG~~vhI~~g~~I-GGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit  215 (285)
T Consensus        11 ~Ig~~~~I~~~~~i~IG~~~~i~~~v~I~~~~h~~~~~~~~~~~~~v~Ig~~v~IG~~~~I~~gv~Ig~~svVgagSvV~   90 (107)
T cd05825          11 WIGEGVWIYNLAPVTIGSDACISQGAYLCTGSHDYRSPAFPLITAPIVIGDGAWVAAEAFVGPGVTIGEGAVVGARSVVV   90 (107)
T ss_pred             EECCCCEEEECCCEEECCCCEECCCCEECCCCCCCCCCCCCEECCCEEECCCCEECCCCEEECCCEECCCCEEECCCEEC
T ss_conf             89999899538857999973995995970788887676653163997993885874987896991918997994898890


Q ss_pred             CCCEEEECCCCCEEEEECCCCC
Q ss_conf             7833687158814644549987
Q gi|254780781|r  216 KSTKIIDRNTGEITYGEVPSYS  237 (285)
Q Consensus       216 ~st~i~d~~~~~~~~g~vP~~~  237 (285)
T Consensus        91 k-----dvp~~~i~~G-~PAk~  106 (107)
T cd05825          91 R-----DLPAWTVYAG-NPAVP  106 (107)
T ss_pred             C-----CCCCCCEEEE-ECCEE
T ss_conf             3-----8599979981-47589