Query         gi|254780781|ref|YP_003065194.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 285
No_of_seqs    249 out of 1055
Neff          4.7 
Searched_HMMs 39220
Date          Sun May 29 20:17:43 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780781.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK11830 dapD 2,3,4,5-tetrahyd 100.0       0       0  781.7  23.0  264   12-282     1-265 (265)
  2 TIGR00965 dapD 2,3,4,5-tetrahy 100.0       0       0  787.7  17.5  270    7-283     1-274 (275)
  3 COG2171 DapD Tetrahydrodipicol 100.0       0       0  526.7  13.4  266    5-284     1-271 (271)
  4 TIGR03532 DapD_Ac 2,3,4,5-tetr 100.0       0       0  340.4  12.6  154   99-284    77-231 (231)
  5 cd03350 LbH_THP_succinylT 2,3, 100.0 1.4E-44       0  293.5  11.4  138  108-245     1-139 (139)
  6 cd04649 LbH_THP_succinylT_puta 100.0 1.7E-33 4.4E-38  225.7   8.9  116  108-227     1-117 (147)
  7 TIGR01173 glmU UDP-N-acetylglu  99.9 8.9E-25 2.3E-29  172.3   8.7  122  105-234   326-448 (461)
  8 TIGR03570 NeuD_NnaD sugar O-ac  99.9 1.1E-23 2.9E-28  165.5   9.2  118  104-235    79-201 (201)
  9 cd03360 LbH_AT_putative Putati  99.9 8.4E-23 2.2E-27  160.2   7.9  117  102-231    74-195 (197)
 10 PRK09451 glmU bifunctional N-a  99.9 8.8E-22 2.2E-26  153.9  10.0  122  103-232   318-440 (456)
 11 TIGR01853 lipid_A_lpxD UDP-3-O  99.9 4.9E-22 1.3E-26  155.5   7.2  173  105-283   116-334 (336)
 12 COG1207 GlmU N-acetylglucosami  99.8 1.2E-20   3E-25  147.1  10.1  134  101-244   319-453 (460)
 13 cd03352 LbH_LpxD UDP-3-O-acyl-  99.8 2.2E-20 5.5E-25  145.4   9.3  123  107-235     6-198 (205)
 14 cd03351 LbH_UDP-GlcNAc_AT UDP-  99.8 3.7E-20 9.4E-25  144.0   9.2  111  139-282   104-214 (254)
 15 PRK05289 UDP-N-acetylglucosami  99.8 6.8E-20 1.7E-24  142.4   9.5  148  110-282     4-217 (261)
 16 PRK12461 UDP-N-acetylglucosami  99.8   3E-19 7.7E-24  138.4  10.9  112  139-283   104-215 (256)
 17 TIGR03536 DapD_gpp 2,3,4,5-tet  99.8 1.1E-19 2.7E-24  141.2   7.9  177   87-285   162-341 (341)
 18 TIGR03308 phn_thr-fam phosphon  99.8 6.5E-19 1.7E-23  136.4  10.9  116  107-239     7-151 (204)
 19 TIGR03535 DapD_actino 2,3,4,5-  99.8   5E-19 1.3E-23  137.1   8.5  176   87-283   137-318 (319)
 20 PRK00892 lpxD UDP-3-O-[3-hydro  99.8 1.4E-18 3.6E-23  134.3  10.1  144  105-248   113-295 (343)
 21 cd04645 LbH_gamma_CA_like Gamm  99.8   9E-19 2.3E-23  135.5   8.8  126  108-272     5-138 (153)
 22 COG1044 LpxD UDP-3-O-[3-hydrox  99.8 1.1E-18 2.9E-23  134.9   8.9  119  105-223   114-266 (338)
 23 cd04650 LbH_FBP Ferripyochelin  99.8 2.5E-18 6.3E-23  132.8   9.9  129  110-277     8-144 (154)
 24 cd04745 LbH_paaY_like paaY-lik  99.8 2.5E-18 6.2E-23  132.9   9.9  127  108-273     6-140 (155)
 25 TIGR01172 cysE serine O-acetyl  99.8 1.2E-18   3E-23  134.8   7.9   93  137-236    67-163 (163)
 26 PRK09527 lacA galactoside O-ac  99.8 4.6E-18 1.2E-22  131.2  10.5  120  122-273    57-191 (203)
 27 cd03357 LbH_MAT_GAT Maltose O-  99.7 7.7E-18   2E-22  129.8   8.7  108  123-236    45-167 (169)
 28 cd03358 LbH_WxcM_N_like WcxM-l  99.7 6.8E-18 1.7E-22  130.1   8.0   94  137-236    16-116 (119)
 29 PRK10502 putative colanic acid  99.7 1.2E-17 2.9E-22  128.8   9.0  114  113-236    51-174 (179)
 30 PRK09677 putative lipopolysacc  99.7 4.9E-17 1.2E-21  124.9  10.2  103  138-272    66-189 (192)
 31 cd03353 LbH_GlmU_C N-acetyl-gl  99.7 5.2E-17 1.3E-21  124.8   9.5  118  106-241    71-189 (193)
 32 cd03349 LbH_XAT Xenobiotic acy  99.7 5.2E-17 1.3E-21  124.7   9.2   65  178-274    70-135 (145)
 33 PRK10092 maltose O-acetyltrans  99.7 1.7E-16 4.2E-21  121.6   9.0   78  139-216    75-164 (183)
 34 cd03354 LbH_SAT Serine acetylt  99.7 1.4E-16 3.7E-21  122.0   7.8   90  137-231     8-99  (101)
 35 COG1045 CysE Serine acetyltran  99.7 2.6E-16 6.7E-21  120.4   7.9   99  137-242    73-174 (194)
 36 TIGR01852 lipid_A_lpxA acyl-[a  99.7   6E-16 1.5E-20  118.2   9.2  144  112-283     2-215 (257)
 37 PRK10191 putative colanic acid  99.7 3.8E-16 9.6E-21  119.5   8.1   93  137-236    47-141 (146)
 38 cd00208 LbetaH Left-handed par  99.7 3.1E-16 7.9E-21  120.0   7.3   78  138-215     1-78  (78)
 39 PRK11132 cysE serine acetyltra  99.6 3.9E-16 9.9E-21  119.4   7.5   97  137-239   147-245 (273)
 40 PRK13627 carnitine operon prot  99.6 2.7E-15 6.8E-20  114.3  11.2  124   86-239     4-133 (196)
 41 KOG4750 consensus               99.6   1E-15 2.6E-20  116.9   6.7  121  105-240   117-244 (269)
 42 PRK00892 lpxD UDP-3-O-[3-hydro  99.6 3.4E-15 8.6E-20  113.7   8.1   69  140-216   226-294 (343)
 43 cd05825 LbH_wcaF_like wcaF-lik  99.6 5.1E-15 1.3E-19  112.5   7.8   93  139-237    11-106 (107)
 44 TIGR01853 lipid_A_lpxD UDP-3-O  99.6 7.5E-15 1.9E-19  111.5   8.5  132   73-215    66-221 (336)
 45 cd05636 LbH_G1P_TT_C_like Puta  99.6 9.8E-15 2.5E-19  110.8   8.0   74  140-214    73-162 (163)
 46 cd04647 LbH_MAT_like Maltose O  99.6 1.2E-14   3E-19  110.3   8.1  103  117-236     4-107 (109)
 47 cd00710 LbH_gamma_CA Gamma car  99.6 1.7E-14 4.2E-19  109.4   8.5  100  108-216     8-116 (167)
 48 cd04645 LbH_gamma_CA_like Gamm  99.6   8E-14 2.1E-18  105.2  11.5  134  117-276     2-139 (153)
 49 cd03359 LbH_Dynactin_5 Dynacti  99.5 1.1E-13 2.9E-18  104.3  10.7  135  108-283     7-159 (161)
 50 cd04646 LbH_Dynactin_6 Dynacti  99.5 4.3E-14 1.1E-18  106.9   8.5  108  111-240     8-129 (164)
 51 cd05636 LbH_G1P_TT_C_like Puta  99.5   7E-14 1.8E-18  105.6   9.0  113  110-222     7-152 (163)
 52 cd03352 LbH_LpxD UDP-3-O-acyl-  99.5   3E-13 7.7E-18  101.7  10.1  130  110-239     3-193 (205)
 53 COG0663 PaaY Carbonic anhydras  99.5   2E-13 5.1E-18  102.8   8.9  106  109-240    18-135 (176)
 54 PRK09451 glmU bifunctional N-a  99.4 9.3E-13 2.4E-17   98.7   9.2  135  109-244   272-442 (456)
 55 cd03350 LbH_THP_succinylT 2,3,  99.4 6.8E-13 1.7E-17   99.5   8.2  100  132-239     8-118 (139)
 56 TIGR03570 NeuD_NnaD sugar O-ac  99.4 6.8E-13 1.7E-17   99.5   8.1  101  132-240    94-197 (201)
 57 COG1044 LpxD UDP-3-O-[3-hydrox  99.4 9.1E-13 2.3E-17   98.8   8.1  131   72-217    70-220 (338)
 58 cd03360 LbH_AT_putative Putati  99.4 5.1E-13 1.3E-17  100.3   6.5  100  133-240    92-194 (197)
 59 COG0110 WbbJ Acetyltransferase  99.4 2.2E-12 5.5E-17   96.5   8.2   74  151-239    89-167 (190)
 60 COG1043 LpxA Acyl-[acyl carrie  99.3   1E-11 2.6E-16   92.4   9.8  112  111-222     6-147 (260)
 61 TIGR01173 glmU UDP-N-acetylglu  99.3 4.9E-12 1.2E-16   94.3   7.6  209   25-244   197-448 (461)
 62 TIGR03532 DapD_Ac 2,3,4,5-tetr  99.3 1.2E-11   3E-16   91.9   8.4  141  112-283    77-226 (231)
 63 cd04650 LbH_FBP Ferripyochelin  99.3 1.6E-11 4.1E-16   91.1   8.6  110  117-243     3-115 (154)
 64 cd03358 LbH_WxcM_N_like WcxM-l  99.3 1.2E-11   3E-16   91.9   6.9   93  140-240     1-111 (119)
 65 cd04745 LbH_paaY_like paaY-lik  99.3 2.6E-11 6.5E-16   89.9   8.4  109  117-242     3-114 (155)
 66 cd03353 LbH_GlmU_C N-acetyl-gl  99.2 2.1E-11 5.3E-16   90.4   7.2  129  107-249    20-181 (193)
 67 cd04646 LbH_Dynactin_6 Dynacti  99.2 1.3E-10 3.4E-15   85.5  10.9  114  117-243     2-120 (164)
 68 cd00710 LbH_gamma_CA Gamma car  99.2 5.9E-11 1.5E-15   87.7   8.7  119  116-244     4-130 (167)
 69 PRK10502 putative colanic acid  99.2 7.6E-11 1.9E-15   87.0   9.2   98  136-239    51-168 (179)
 70 PRK13627 carnitine operon prot  99.2 1.2E-10 2.9E-15   85.9   9.1  140  116-277    12-154 (196)
 71 KOG1461 consensus               99.2 9.7E-11 2.5E-15   86.3   7.4   97  106-217   313-414 (673)
 72 COG1207 GlmU N-acetylglucosami  99.1   6E-10 1.5E-14   81.5   8.7  135  108-246   292-447 (460)
 73 COG0663 PaaY Carbonic anhydras  99.0 2.7E-09 6.8E-14   77.5  10.5  138  116-275    13-153 (176)
 74 COG2171 DapD Tetrahydrodipicol  99.0 3.9E-09   1E-13   76.5  11.2  178   42-237    14-223 (271)
 75 cd03359 LbH_Dynactin_5 Dynacti  99.0 1.7E-09 4.4E-14   78.7   9.4  115  118-244     5-127 (161)
 76 PRK12461 UDP-N-acetylglucosami  99.0 8.1E-10 2.1E-14   80.7   6.0  141  110-250     2-176 (256)
 77 PRK05289 UDP-N-acetylglucosami  99.0 1.5E-09 3.9E-14   79.0   7.0  131  115-250     3-179 (261)
 78 cd03351 LbH_UDP-GlcNAc_AT UDP-  99.0 1.5E-09 3.8E-14   79.1   6.0  140  111-250     2-176 (254)
 79 cd03357 LbH_MAT_GAT Maltose O-  98.9 9.8E-09 2.5E-13   74.1   8.5   97  138-240    43-162 (169)
 80 TIGR02353 NRPS_term_dom non-ri  98.9 2.3E-09 5.8E-14   78.0   5.1   92  125-216   608-704 (719)
 81 KOG1461 consensus               98.9 4.6E-09 1.2E-13   76.1   6.1  165   32-220   247-423 (673)
 82 PRK02862 glgC glucose-1-phosph  98.8 1.8E-08 4.6E-13   72.5   8.0   34  188-222   367-400 (429)
 83 PRK10092 maltose O-acetyltrans  98.8 2.5E-08 6.5E-13   71.6   8.3   82  153-240    71-173 (183)
 84 PRK05293 glgC glucose-1-phosph  98.8 2.8E-08 7.2E-13   71.3   8.1   98  108-216   276-376 (381)
 85 PRK03282 consensus              98.8 6.4E-08 1.6E-12   69.1   9.2   88  137-241   313-400 (406)
 86 COG1045 CysE Serine acetyltran  98.8 7.2E-09 1.8E-13   74.9   4.1   89  106-202    59-158 (194)
 87 cd03354 LbH_SAT Serine acetylt  98.7   2E-08 5.1E-13   72.2   5.9   84  115-208     3-97  (101)
 88 cd05825 LbH_wcaF_like wcaF-lik  98.7 5.2E-08 1.3E-12   69.6   7.9   60  181-240    23-100 (107)
 89 PRK03701 consensus              98.7 4.9E-08 1.2E-12   69.8   7.5   94  137-247   331-424 (431)
 90 TIGR02287 PaaY phenylacetic ac  98.7 2.6E-08 6.7E-13   71.5   5.8   99  118-240    30-132 (193)
 91 cd05787 LbH_eIF2B_epsilon eIF-  98.7 4.6E-08 1.2E-12   69.9   6.9   77  140-221     2-78  (79)
 92 PRK05293 glgC glucose-1-phosph  98.7 4.6E-08 1.2E-12   69.9   6.7   87  114-219   276-362 (381)
 93 cd04647 LbH_MAT_like Maltose O  98.7 7.6E-08 1.9E-12   68.6   7.8   93  140-239     4-101 (109)
 94 PRK04928 consensus              98.7 7.1E-08 1.8E-12   68.8   7.5   90  137-243   311-400 (405)
 95 cd00208 LbetaH Left-handed par  98.7   3E-08 7.7E-13   71.1   5.6   52  137-196    18-77  (78)
 96 PRK00844 glgC glucose-1-phosph  98.7 5.7E-08 1.5E-12   69.4   6.8   70  137-218   315-384 (409)
 97 PRK10191 putative colanic acid  98.6 5.9E-08 1.5E-12   69.3   5.8   88  108-208    41-135 (146)
 98 cd05824 LbH_M1P_guanylylT_C Ma  98.6 7.8E-08   2E-12   68.5   5.9   78  111-209     2-79  (80)
 99 PRK09677 putative lipopolysacc  98.6 1.9E-07 4.9E-12   66.1   7.9   91  137-248    49-166 (192)
100 TIGR01852 lipid_A_lpxA acyl-[a  98.6 1.6E-07 4.1E-12   66.7   7.1   55  144-199   108-173 (257)
101 TIGR01172 cysE serine O-acetyl  98.6 4.9E-08 1.3E-12   69.8   4.5  102   85-200    38-151 (163)
102 PRK00725 glgC glucose-1-phosph  98.6 1.9E-07 4.8E-12   66.2   7.0   91  137-244   331-421 (431)
103 PRK02862 glgC glucose-1-phosph  98.6 2.1E-07 5.4E-12   65.9   6.6   34  182-216   367-400 (429)
104 cd04651 LbH_G1P_AT_C Glucose-1  98.5 2.6E-07 6.6E-12   65.4   7.0   97  122-241     3-99  (104)
105 PRK09527 lacA galactoside O-ac  98.5 2.6E-07 6.7E-12   65.3   6.7   79  117-209    78-175 (203)
106 cd05787 LbH_eIF2B_epsilon eIF-  98.5 3.7E-07 9.5E-12   64.4   6.5   77  117-209     2-78  (79)
107 cd03356 LbH_G1P_AT_C_like Left  98.5 4.3E-07 1.1E-11   64.0   6.7   30  140-170     2-31  (79)
108 cd04652 LbH_eIF2B_gamma_C eIF-  98.5 4.1E-07   1E-11   64.2   6.5   64  140-214     2-65  (81)
109 cd04649 LbH_THP_succinylT_puta  98.5 4.6E-07 1.2E-11   63.9   6.3   88  104-202    15-110 (147)
110 COG1208 GCD1 Nucleoside-diphos  98.4 9.3E-07 2.4E-11   62.0   7.6   63  138-210   262-324 (358)
111 cd03356 LbH_G1P_AT_C_like Left  98.4 7.6E-07 1.9E-11   62.5   6.8   77  117-209     2-78  (79)
112 TIGR02353 NRPS_term_dom non-ri  98.4   3E-07 7.7E-12   65.0   4.6  100  136-239   117-221 (719)
113 cd05824 LbH_M1P_guanylylT_C Ma  98.4 6.9E-07 1.8E-11   62.8   6.3   74  137-220     5-78  (80)
114 PRK11830 dapD 2,3,4,5-tetrahyd  98.4 1.2E-06 3.1E-11   61.2   7.4  161    7-200    19-206 (265)
115 PRK03282 consensus              98.4 1.2E-06 3.1E-11   61.2   7.1   65  121-196   314-378 (406)
116 COG0110 WbbJ Acetyltransferase  98.4 3.4E-06 8.6E-11   58.6   9.3   60  199-272   124-183 (190)
117 TIGR03308 phn_thr-fam phosphon  98.3 4.3E-06 1.1E-10   57.9   8.8  133  111-273     5-169 (204)
118 COG1208 GCD1 Nucleoside-diphos  98.3 1.6E-06 4.2E-11   60.5   6.5   65  138-219   280-344 (358)
119 cd04652 LbH_eIF2B_gamma_C eIF-  98.3 1.9E-06 4.8E-11   60.1   6.7   77  118-211     3-79  (81)
120 COG1043 LpxA Acyl-[acyl carrie  98.3 2.9E-06 7.3E-11   59.0   7.5  110  109-246    82-191 (260)
121 cd03349 LbH_XAT Xenobiotic acy  98.3 3.9E-06 9.9E-11   58.2   8.2   65  198-283    72-139 (145)
122 PRK01884 consensus              98.3 2.4E-06 6.2E-11   59.4   6.4   94  137-247   329-423 (435)
123 KOG3121 consensus               98.2 2.6E-06 6.5E-11   59.3   6.1  101  139-248    41-153 (184)
124 PRK04928 consensus              98.2 3.9E-06 9.8E-11   58.2   6.8   67  121-198   312-378 (405)
125 PRK00844 glgC glucose-1-phosph  98.2   6E-06 1.5E-10   57.0   7.8   78  160-242   314-403 (409)
126 PRK11132 cysE serine acetyltra  98.2 2.2E-06 5.7E-11   59.7   5.1   83  107-200   140-230 (273)
127 cd05635 LbH_unknown Uncharacte  98.1 9.6E-06 2.4E-10   55.8   6.4   79  122-212    13-92  (101)
128 TIGR02287 PaaY phenylacetic ac  98.0 8.3E-06 2.1E-10   56.1   5.0  122  116-270    10-145 (193)
129 COG0448 GlgC ADP-glucose pyrop  98.0 6.5E-05 1.7E-09   50.7   8.8  164   33-244   221-385 (393)
130 cd04651 LbH_G1P_AT_C Glucose-1  97.9   3E-05 7.6E-10   52.7   6.5   56  112-170     5-60  (104)
131 COG0448 GlgC ADP-glucose pyrop  97.9 6.1E-05 1.6E-09   50.8   8.0   69  112-198   294-362 (393)
132 cd05635 LbH_unknown Uncharacte  97.9 2.7E-05 6.9E-10   53.0   5.8   22  108-129    17-38  (101)
133 TIGR02091 glgC glucose-1-phosp  97.8   6E-05 1.5E-09   50.9   6.0  160   34-209   242-420 (421)
134 PRK03701 consensus              97.8 6.3E-05 1.6E-09   50.8   6.0   68  120-198   331-398 (431)
135 PRK01884 consensus              97.8 6.2E-05 1.6E-09   50.8   5.9   66  120-196   329-394 (435)
136 KOG4042 consensus               97.7 7.9E-05   2E-09   50.2   5.8  103  107-218     7-132 (190)
137 PRK00725 glgC glucose-1-phosph  97.6 0.00015 3.8E-09   48.5   5.5   67  120-197   331-397 (431)
138 KOG1462 consensus               97.6 0.00012 3.1E-09   49.0   4.7   64  150-222   329-402 (433)
139 KOG4750 consensus               97.5 0.00013 3.4E-09   48.8   4.7   93  163-270   150-257 (269)
140 TIGR03536 DapD_gpp 2,3,4,5-tet  97.5 0.00018 4.5E-09   48.0   4.8  152   59-223   101-272 (341)
141 KOG1322 consensus               97.5 0.00032 8.3E-09   46.4   6.1   27   43-69    173-199 (371)
142 TIGR02091 glgC glucose-1-phosp  97.4 0.00024 6.1E-09   47.2   4.9   27  188-215   394-420 (421)
143 KOG1460 consensus               97.4 0.00033 8.5E-09   46.3   5.2   68  143-214   288-355 (407)
144 TIGR03535 DapD_actino 2,3,4,5-  97.3 0.00035   9E-09   46.2   4.7  151   59-223    77-247 (319)
145 KOG1462 consensus               97.3 0.00066 1.7E-08   44.5   6.1   68  138-215   329-401 (433)
146 KOG3121 consensus               97.3 0.00029 7.4E-09   46.7   3.6   59  139-218    86-144 (184)
147 TIGR02092 glgD glucose-1-phosp  96.6   0.012 3.1E-07   36.8   7.2  144   31-216   224-369 (383)
148 KOG1460 consensus               96.4   0.013 3.4E-07   36.5   6.4   21  109-129   289-309 (407)
149 KOG1322 consensus               96.2  0.0034 8.7E-08   40.2   2.7   85  137-222   258-345 (371)
150 TIGR00965 dapD 2,3,4,5-tetrahy  96.0   0.014 3.6E-07   36.4   4.9   92  104-199   117-218 (275)
151 KOG4042 consensus               95.8   0.018 4.6E-07   35.7   4.9  114  119-239     7-140 (190)
152 TIGR01208 rmlA_long glucose-1-  95.8   0.015 3.9E-07   36.2   4.5   29   14-45    181-211 (361)
153 TIGR02092 glgD glucose-1-phosp  95.0   0.038 9.6E-07   33.8   4.3  144   29-206   226-381 (383)
154 COG4801 Predicted acyltransfer  94.7   0.088 2.3E-06   31.5   5.5   45  182-226   167-221 (277)
155 TIGR01208 rmlA_long glucose-1-  94.0    0.13 3.3E-06   30.5   5.1   27  138-164   261-287 (361)
156 COG4801 Predicted acyltransfer  92.7    0.36 9.3E-06   27.7   5.7   45  180-230   152-196 (277)
157 pfam07959 Fucokinase L-fucokin  91.3    0.21 5.4E-06   29.2   3.2   34  182-216   285-318 (414)
158 PHA02090 hypothetical protein   59.1     6.5 0.00016   20.1   2.0   27   42-73     35-61  (79)
159 COG2930 Uncharacterized conser  53.4     8.2 0.00021   19.4   1.8   23  124-146    53-79  (227)
160 PTZ00079 NADP-specific glutama  52.4      20  0.0005   17.1   5.7   80    5-93     22-122 (469)
161 TIGR01980 sufB FeS assembly pr  48.4      23 0.00058   16.7   4.6   99   25-137    97-211 (469)
162 TIGR01779 TonB-B12 TonB-depend  44.8      21 0.00054   16.9   2.7   17  159-175   140-156 (644)
163 KOG0479 consensus               41.4       9 0.00023   19.2   0.4   12   60-71    306-317 (818)
164 TIGR00185 rRNA_methyl_2 RNA me  38.6      16 0.00042   17.6   1.4   34   69-106    35-68  (161)
165 TIGR00600 rad2 DNA excision re  36.5      15 0.00038   17.8   0.9   45   27-74    426-473 (1127)
166 TIGR01394 TypA_BipA GTP-bindin  36.4      20 0.00052   17.0   1.6   40  187-226   519-560 (609)
167 pfam04185 Phosphoesterase Phos  32.2      23 0.00059   16.7   1.3   12  231-242   240-251 (357)
168 KOG4410 consensus               28.9      29 0.00075   16.1   1.4   42  185-227   158-208 (396)
169 PRK13494 chemoreceptor glutami  28.8      33 0.00084   15.7   1.6   14  102-115     7-20  (163)
170 TIGR00038 efp translation elon  28.7      42  0.0011   15.1   2.2   21  118-138   156-177 (194)
171 TIGR01717 AMP-nucleosdse AMP n  26.6      30 0.00076   16.0   1.1   87   84-174   202-330 (486)
172 COG3514 Uncharacterized protei  24.8      31 0.00079   15.9   0.9   12  273-284    77-88  (93)
173 pfam05428 CRF-BP Corticotropin  24.4      56  0.0014   14.3   3.7   16  155-170   238-253 (311)
174 cd00862 ProRS_anticodon_zinc P  24.1      57  0.0015   14.3   2.4   80   28-108    26-122 (202)
175 KOG3216 consensus               23.2      27 0.00069   16.3   0.3   17   57-73    123-139 (163)
176 PRK04542 elongation factor P;   22.9      58  0.0015   14.2   2.0   22  199-220   154-175 (189)
177 cd05794 S1_EF-P_repeat_2 S1_EF  22.3      40   0.001   15.2   1.1   24  117-140    20-44  (56)
178 PRK13493 chemoreceptor glutami  21.8      51  0.0013   14.6   1.5   21   84-115    17-37  (214)
179 cd03108 AdSS Adenylosuccinate   21.3      46  0.0012   14.9   1.2   24  108-131    49-74  (363)
180 cd01900 YchF YchF subfamily.    21.1      66  0.0017   13.9   4.1   61    4-71    129-195 (274)

No 1  
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional
Probab=100.00  E-value=0  Score=781.70  Aligned_cols=264  Identities=59%  Similarity=1.057  Sum_probs=256.6

Q ss_pred             HHHHHHHHHHCCCCC-CHHHHHHHHHHHHHHHCCCEEEEEECCCCCEEEEHHHHHHHHHEEECCCCEEEECCCCCCCHHH
Q ss_conf             999975053168244-1789999999999730793799887599968860788623222064267447624776420110
Q gi|254780781|r   12 IDSFFEESNSKNESI-PQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWD   90 (285)
Q Consensus        12 Ie~awe~r~~l~~~~-~~~~~~aI~~~I~~LD~G~iRVAEk~~nG~W~VNeWvKKAILL~Fri~~~~~i~~g~~~~~~~D   90 (285)
                      ||+|||+|+++++++ ++++|+||+++|++||+|+||||||.+ |+|+||||+|||||||||+++|++++.|+ +++|||
T Consensus         1 IE~AWE~r~~is~~s~~~evr~aI~e~I~lLD~G~iRVAEk~d-g~W~VNqWvKKAILLsFrl~~~~~~~~Gp-~~~~~D   78 (265)
T PRK11830          1 IEEAWENRAELTPATADAEVREAVEEVIDLLDSGELRVAEKID-GEWVVNQWVKKAILLSFRLNDNQVIEGGP-ESRFYD   78 (265)
T ss_pred             CHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECC-CEEEEEHHHHHHHHHEEECCCCEEECCCC-CCCCEE
T ss_conf             9567531764897558788999999999873388679878529-98887399988665237525766862688-750044


Q ss_pred             CCCCCCCCCCHHHHHHCCCCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEE
Q ss_conf             17753236520234424751025431035640066514620103023533677201566123220473068688123211
Q gi|254780781|r   91 KIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGI  170 (285)
Q Consensus        91 Kvp~Kf~~~~~~~f~~~g~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~I  170 (285)
                      |+|+||++|++++|+++|||+||+|++|+||||+||+||||||||+|||||+|||||+||+||||||||+|||||+|++|
T Consensus        79 KVplKf~~w~~~~f~~~gvRvVP~a~vR~Gayi~~~vVlMPs~VNiGAyv~~gtmiDtwatvGScAqiGknvhls~g~gi  158 (265)
T PRK11830         79 KVPSKFAGWDEARFKEAGVRVVPGAVVRRGAYIAKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGI  158 (265)
T ss_pred             CCCCCCCCCCHHHHHHCCEEECCCCEEEECEEECCCCEEEEEEEEEEEEECCCCEEECCCCEECHHEECCCEEECCCCEE
T ss_conf             04542379998999767908878853760305459958864177760398489548047624115323783368787414


Q ss_pred             CCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCC
Q ss_conf             21005776564487258478218578468884588566300465278336871588146445499878960564455677
Q gi|254780781|r  171 GGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK  250 (285)
Q Consensus       171 GGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~  250 (285)
                      ||||||+|+.||||||||||||+|.|++|++|++||||+||++|++||||||+.+|+++||+|||||||||||+|++.  
T Consensus       159 gGvleP~~a~p~iied~~fiGa~~~v~eGv~v~~~avl~~gv~l~~st~I~D~~~~ev~~g~vP~~svvv~Gs~p~~~--  236 (265)
T PRK11830        159 GGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEEGAVIGMGVFLGQSTKIYDRETGEVHYGRVPAGSVVVPGSLPSKD--  236 (265)
T ss_pred             EEEECCCCCCCEEEECCCEECCCCEEEEEEEEECCCEECCEEEECCCCEEEECCCCCEEECCCCCCCEEECCCCCCCC--
T ss_conf             265247667987983682873574796139994586972104760671678724782874347999889557403788--


Q ss_pred             CCCCCCCCCCCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             66577644672798961202466888998751
Q gi|254780781|r  251 GDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR  282 (285)
Q Consensus       251 ~~~~~~~~~cavi~~~~d~~t~~k~~ln~~lR  282 (285)
                         +.+|||||+|+|++||+||+||+|||+||
T Consensus       237 ---g~~~l~ca~ivk~~d~~t~~kt~l~~~lr  265 (265)
T PRK11830        237 ---GKYSLYCAVIVKKVDAKTRSKTSINELLR  265 (265)
T ss_pred             ---CCCCCCCEEEEEECCCCHHHHHHHHHHHC
T ss_conf             ---98176451999974551355666778649


No 2  
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; InterPro: IPR005664   Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway. Additionally, several important metabolic intermediates are produced by these reactions, such as diaminopimelic acid, an essential component of bacterial cell wall biosynthesis, and dipicolinic acid, which is involved in sporulation in Gram-positive bacteria. Members of the animal kingdom do not posses this pathway and must therefore acquire these essential amino acids through their diet. Research into improving the metabolic flux through this pathway has the potential to increase the yield of the essential amino acids in important crops, thus improving their nutritional value. Additionally, since the enzymes are not present in animals, inhibitors of them are promising targets for the development of novel antibiotics and herbicides. For more information see .   The lysine/diaminopimelic acid branch of the aspartate pathway produces the essential amino acid lysine via the intermediate meso-diaminopimelic acid (meso-DAP), which is also a vital cell wall component in Gram-negative bacteria . The production of dihydropicolinate from aspartate-semialdehyde controls flux into the lysine/diaminopimelic acid pathway. Three variants of this pathway exist, differing in how tetrahydropicolinate (formed by reduction of dihydropicolinate) is metabolised to meso-DAP. One variant, the most commonly found one in archaea and bacteria, uses primarily succinyl intermediates, while a second variant, found only in Bacillus, utilises primarily acetyl intermediates. In the third variant, found in some Gram-positive bacteria, a dehydrogenase converts tetrahydropicolinate directly to meso-DAP. In all variants meso-DAP is subsequently converted to lysine by a decarboxylase, or, in Gram-negative bacteria, assimilated into the cell wall. Evidence exists that a fourth, currently unknown, variant of this pathway may function in plants .    2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase (also known as tetrahydrodipicolinate N-succinyltransferase or DapD) is part of the succinyl route of of lysine/DAP biosynthesis. The DapD protein is a homotrimer is a trimeric enzyme with each monomer composed of three domain: an N-terminal helical domain, a distinctive left-handed parallel beta-helix (LBH) domain, and a predominantly beta C-terminal domain , . The LBH structure is encoded by an imperfect tandem-repeated hexapeptide sequence. Each trimer contains three independent active sites, always occuring at the boundary of two subunits, and formed by residues from one N-terminal domain, one C-terminal domain and two adjacent LBH domains.; GO: 0016757 transferase activity transferring glycosyl groups, 0009089 lysine biosynthetic process via diaminopimelate.
Probab=100.00  E-value=0  Score=787.74  Aligned_cols=270  Identities=57%  Similarity=1.009  Sum_probs=261.1

Q ss_pred             HHHHHHHHHHHHHHHCCCC--CCHHHHHHHHHHHHHHHCCCEEEEEECCCCCEEEEHHHHHHHHHEEECCCCEEEECCCC
Q ss_conf             9999999997505316824--41789999999999730793799887599968860788623222064267447624776
Q gi|254780781|r    7 TLEEIIDSFFEESNSKNES--IPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNG   84 (285)
Q Consensus         7 ~L~~~Ie~awe~r~~l~~~--~~~~~~~aI~~~I~~LD~G~iRVAEk~~nG~W~VNeWvKKAILL~Fri~~~~~i~~g~~   84 (285)
                      .|+++||+|||+|+++.++  .+.++|++++++|.+||+|.||||||...|+|+||||+|||||||||++++++++.+  
T Consensus         1 ~l~~~IE~Af~~~~~I~~d~~~~~~~k~~~~~~I~~L~~G~lRVaEk~g~~~W~v~~W~KKAvLL~F~~~~~~~~~~~--   78 (275)
T TIGR00965         1 SLQNIIETAFEIRAEITPDSSKLIKLKEAVNESIASLDSGILRVAEKLGGGQWKVNEWVKKAVLLSFRITDNQVLNDA--   78 (275)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCCCEEHHHHHHEEEEEEEEECHHHHHHCC--
T ss_conf             923578898875642375433416899999999986328827876650698221355651012233441102311067--


Q ss_pred             CCCHHHCCCCCC-CCCCHHHHHHCCCCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCE
Q ss_conf             420110177532-3652023442475102543103564006651462010302353367720156612322047306868
Q gi|254780781|r   85 YSTWWDKIPAKF-DDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVH  163 (285)
Q Consensus        85 ~~~~~DKvp~Kf-~~~~~~~f~~~g~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vh  163 (285)
                      +..||||||.|| ++|+++.|+++++|.||+|++|.|+||++|+|||||||||||||+||||||||||||||||||||||
T Consensus        79 ~~~yfDKV~~KFpAD~d~~~Fk~~g~R~VPgA~vR~G~fiAkNvVlMPSyvNIGAYvDEGtMvDTWATvGSCAQIGKNvH  158 (275)
T TIGR00965        79 VNKYFDKVPTKFPADYDENEFKEAGFRKVPGAIVRRGTFIAKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVH  158 (275)
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHCCCCCCCHHHEECCCEEEEEEEECCCEEECCCEEECCCEECCHHHHCCHHHHCCCEE
T ss_conf             53201257887888765678864666548743600573577523775552101367516860100122300322066257


Q ss_pred             EECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCC
Q ss_conf             81232112100577656448725847821857846888458856630046527833687158814644549987896056
Q gi|254780781|r  164 ISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS  243 (285)
Q Consensus       164 I~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~  243 (285)
                      ||+|++|||||||+||.|+||||||||||+|+|.|||+|++||||.||++|++||||+||+|||++|||||||||||||+
T Consensus       159 lSGG~GIGGVLEPLQA~P~IIEDNCFiGARSEi~EGVIVEEGSVISMGVfIG~STkI~~R~TGEI~~GRvPA~SVVVsG~  238 (275)
T TIGR00965       159 LSGGVGIGGVLEPLQAKPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIVDRDTGEIIYGRVPAGSVVVSGI  238 (275)
T ss_pred             EECCCCCCCCCCCCCCCCEEEECCCEECCCEEEEEEEEECCCCEEEEEEEECCCCEEEECCCCEEEECCCCCEEEEECCC
T ss_conf             51783316524633578758824760046113562079716858884068556016885366717655135602797177


Q ss_pred             CCC-CCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHC
Q ss_conf             445-5677665776446727989612024668889987511
Q gi|254780781|r  244 YPS-INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD  283 (285)
Q Consensus       244 ~~~-~~~~~~~~~~~~~cavi~~~~d~~t~~k~~ln~~lR~  283 (285)
                      +|+ +.++     ++||||||+|++|.+||.|+++|||||.
T Consensus       239 lPsp~~G~-----~sLYC~VIVK~VD~~TRgKvsiN~LLR~  274 (275)
T TIGR00965       239 LPSPKDGK-----YSLYCAVIVKKVDAKTRGKVSINELLRT  274 (275)
T ss_pred             CCCCCCCC-----CCCEEEEEEECCCCCCCCCCCHHHHHCC
T ss_conf             88755679-----6414899987116766752015655204


No 3  
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism]
Probab=100.00  E-value=0  Score=526.67  Aligned_cols=266  Identities=46%  Similarity=0.747  Sum_probs=251.8

Q ss_pred             HHHHHHHHHHHHHHHHHCCC--CCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCEEEEHHHHHHHHHEEECCCCEEEECC
Q ss_conf             89999999999750531682--4417899999999997307937998875999688607886232220642674476247
Q gi|254780781|r    5 VSTLEEIIDSFFEESNSKNE--SIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDG   82 (285)
Q Consensus         5 m~~L~~~Ie~awe~r~~l~~--~~~~~~~~aI~~~I~~LD~G~iRVAEk~~nG~W~VNeWvKKAILL~Fri~~~~~i~~g   82 (285)
                      |.+++++||.+||.+...+.  ....+.+.++++++..|+.+..|++|+...+.|.+|||+||++|++|+..+++.++.+
T Consensus         1 ~~~~~~iIe~~~~~~~~v~~~~~~~~~~~~~~~~~~~~L~~~s~r~~~~~~~~~~~~~~~l~~~v~~~~~~~~~~~l~~~   80 (271)
T COG2171           1 MQSAQEIIELAFEERKAVRTVIYVLDDLPEAVADAYLRLHLLSHRVAEPHIDNLWGTFEWLKKAVLLGFGPCDLELLEAG   80 (271)
T ss_pred             CCCHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCCEEEECCCCCCCHHHHHHHCEEEEECCCCCCHHHHHHC
T ss_conf             93277889877626553036775077741226889987530453531555344112442321169954677505777524


Q ss_pred             -CCCCCHHHCCCCCC-CCCCHHHHHHCCCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEEC
Q ss_conf             -76420110177532-36520234424751025431035640066514620-1030235336772015661232204730
Q gi|254780781|r   83 -NGYSTWWDKIPAKF-DDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIG  159 (285)
Q Consensus        83 -~~~~~~~DKvp~Kf-~~~~~~~f~~~g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG  159 (285)
                       .....||||+|.|| +.|....|..+|+|++|+|+||.||||++|+++|| +|||+|||+++|||||+|+++|+||+||
T Consensus        81 ~~~~~~~~~~v~~~~~~~~~~d~~~~~g~RI~p~a~VR~ga~i~~gtvvM~~sfVNigA~~~~gtMVd~~as~G~~a~VG  160 (271)
T COG2171          81 RLRIRGYYDKVDSVDKAPRMLDYFVPEGVRIVPGAIVRLGAYIAKGTVVMPESFVNIGAGTGEGTMVDGRASVGSCAQVG  160 (271)
T ss_pred             CCCCCCCEEECCCCCCCCCHHHHCCCCCEEECCCCEEEECCEECCCCEECCCCEEEECCCCCCCEEEEEEEEEECCEEEC
T ss_conf             33435641321111455313455055763636764776052877993875556687776027525896156551317979


Q ss_pred             CCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEE
Q ss_conf             68688123211210057765644872584782185784688845885663004652783368715881464454998789
Q gi|254780781|r  160 KNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVV  239 (285)
Q Consensus       160 ~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vv  239 (285)
                      +||||++|++|+|||||+|+.|++|||||||||||++++|+++|+||+|+||++||+||||+++++|     ++ ++|||
T Consensus       161 kn~higgGa~I~GVLep~~a~Pv~IgdncliGAns~~veGV~vGdg~VV~aGv~I~~~tki~~~~~g-----~~-~~svv  234 (271)
T COG2171         161 KNSHIGGGASIGGVLEPLQANPVIIGDNCLIGANSEVVEGVIVGDGCVVAAGVFITQDTKIYDRVAG-----RV-AGSVV  234 (271)
T ss_pred             CCCCCCCCCEEEEEECCCCCCCEEECCCCEECCCCCEEEEEEECCCCEEECCEEEECCCCEEEEECC-----CC-CCCEE
T ss_conf             9845278636767734888788698776186245334861696789688545089379514774346-----33-44147


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHCC
Q ss_conf             605644556776657764467279896120246688899875115
Q gi|254780781|r  240 VPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDY  284 (285)
Q Consensus       240 vpg~~~~~~~~~~~~~~~~~cavi~~~~d~~t~~k~~ln~~lR~~  284 (285)
                      ++|++|        ++|++||+.|+|++|++|++||+|||+||++
T Consensus       235 ~~~~lp--------g~~~~~~~~ivk~vd~kt~~kt~ine~Lr~~  271 (271)
T COG2171         235 VAGTLP--------GGLSLYCASIVKQVDAKTKGKTEINELLRTL  271 (271)
T ss_pred             EECCCC--------CCCCEEEEEEEEEHHHHHHCHHHHHHHHHCC
T ss_conf             613369--------9743345345300123440200677886409


No 4  
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase. Alternate name: tetrahydrodipicolinate N-acetyltransferase. Note that IUBMB lists this alternate name as the accepted name. Unfortunately, the related succinyl transferase acting on the same substrate (EC:2.3.1.117, TIGR00695) uses the opposite standard. We have decided to give these two enzymes names which more clearly indicated that they act on the same substrate.
Probab=100.00  E-value=0  Score=340.44  Aligned_cols=154  Identities=43%  Similarity=0.694  Sum_probs=142.6

Q ss_pred             CCHHHHHHCCCCCCCCCEECCCCCCCCCCEE-ECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCC
Q ss_conf             5202344247510254310356400665146-201030235336772015661232204730686881232112100577
Q gi|254780781|r   99 WKTKDFEKHNFRIIPGTIVRHSAYIGPKAVL-MPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPI  177 (285)
Q Consensus        99 ~~~~~f~~~g~rv~P~a~vr~ga~Ig~g~vi-mp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~  177 (285)
                      .+..++++-+.|+.|+|++|..++||+|+|+ ||+|||+||+||+|||||+||++||||+||+|||||+|+.|+|||||+
T Consensus        77 ipl~d~~~~~aRIepgaiir~~v~IG~~aVImmga~INiGA~IGegtmId~~Avvg~~a~IGk~~HisaGa~laGVleP~  156 (231)
T TIGR03532        77 IPLLDLKNINARIEPGAIIRDQVIIGDNAVIMMGAVINIGAEIGEGTMIDMNAVLGGRATVGKNVHIGAGAVLAGVIEPP  156 (231)
T ss_pred             CCCCCCCCCCCEECCCCEEECCEEECCCEEEECCCEEECCCEECCCCEECCCCEECCCCEECCCCEECCCCEEECCCCCC
T ss_conf             63022014783577885884252987983991388870485987894580585644546887970588986430022576


Q ss_pred             CCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             65644872584782185784688845885663004652783368715881464454998789605644556776657764
Q gi|254780781|r  178 QTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPH  257 (285)
Q Consensus       178 ~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~  257 (285)
                      ++.||+||||||||+||+|++|++||++|+|+||+++++               +||+++||.  ..             
T Consensus       157 ~a~PViIeDnV~IGAnAvIl~GV~IG~gsVIgAGsVVtk---------------dVP~~sVVa--G~-------------  206 (231)
T TIGR03532       157 SAKPVVIEDNVLIGANAVILEGVRVGKGAVVAAGAIVTE---------------DVPPNTVVA--GV-------------  206 (231)
T ss_pred             CCCCEEECCCEEECCCCEECCCCEECCCCEECCCCEECC---------------CCCCCCEEE--EC-------------
T ss_conf             679979878859879979919989999999984988956---------------579997998--54-------------


Q ss_pred             CCCCEEEEECCHHHHHHHHHHHHHHCC
Q ss_conf             467279896120246688899875115
Q gi|254780781|r  258 LYCAVIIKKVDEKTRSKTSINTLLRDY  284 (285)
Q Consensus       258 ~~cavi~~~~d~~t~~k~~ln~~lR~~  284 (285)
                        +|.++|++||||++||+|||+||..
T Consensus       207 --PAKIIK~vDekT~~Kt~~~~~lr~l  231 (231)
T TIGR03532       207 --PAKVIKQVDEKTKDKTELEDDLRKL  231 (231)
T ss_pred             --CEEEEEECCHHHHHHHHHHHHHHCC
T ss_conf             --8199985570144566799997519


No 5  
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA. It is the committed step in the succinylase pathway by which bacteria synthesize L-lysine and meso-diaminopimelate, a component of peptidoglycan. The enzyme is homotrimeric and each subunit contains an N-terminal region with alpha helices and hairpin loops, as well as a C-terminal region with a left-handed parallel alpha-helix (LbH) structural motif encoded by hexapeptide repeat motifs.
Probab=100.00  E-value=1.4e-44  Score=293.48  Aligned_cols=138  Identities=62%  Similarity=1.056  Sum_probs=135.5

Q ss_pred             CCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECC
Q ss_conf             751025431035640066514620-1030235336772015661232204730686881232112100577656448725
Q gi|254780781|r  108 NFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED  186 (285)
Q Consensus       108 g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD  186 (285)
                      |+|+.|+|+||++|+|++|+++|| +|||.|++||++|+|+++++|+|+|+||+||||++++.++|.++|.+..|++|||
T Consensus         1 g~rI~P~A~I~~ga~IG~g~vI~~~a~I~~g~~IG~~~~I~~~~~Ig~~~~IG~~v~I~~g~~i~g~~~p~~~~~v~IeD   80 (139)
T cd03350           1 GRRVPPGAIIRDGAFIGPGAVLMMPSYVNIGAYVDEGTMVDSWATVGSCAQIGKNVHLSAGAVIGGVLEPLQATPVIIED   80 (139)
T ss_pred             CEEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCCCCCCCCCEECC
T ss_conf             90749982988999999998998899984398989872786666026866999932898886784442576468868879


Q ss_pred             CCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCC
Q ss_conf             84782185784688845885663004652783368715881464454998789605644
Q gi|254780781|r  187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP  245 (285)
Q Consensus       187 ~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~  245 (285)
                      +||||+||.|.+|++||++|+||||+++|+++|+||+++||++||++||||||+||++|
T Consensus        81 ~~~IGa~a~V~~Gv~IG~~avIGAGsVVtkdvp~y~~~~g~~~~~~~p~~~~~~~~~~~  139 (139)
T cd03350          81 DVFIGANCEVVEGVIVGKGAVLAAGVVLTQSTPIYDRETGEIYYGRVPPGSVVVAGSLP  139 (139)
T ss_pred             CEEEEECCEEECCCEECCCCEECCCCEEECCCCCEEEECCCEEECCCCCCCEECCCCCC
T ss_conf             95993099894687999998999798891898846823780970116998787458889


No 6  
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH. THP succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA. It is the committed step in the succinylase pathway by which bacteria synthesize L-lysine and meso-diaminopimelate, a component of peptidoglycan. The enzyme is trimeric and displays the left-handed parallel alpha-helix (LbH) structural motif encoded by the hexapeptide repeat motif.
Probab=100.00  E-value=1.7e-33  Score=225.66  Aligned_cols=116  Identities=27%  Similarity=0.444  Sum_probs=112.1

Q ss_pred             CCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECC
Q ss_conf             751025431035640066514620-1030235336772015661232204730686881232112100577656448725
Q gi|254780781|r  108 NFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED  186 (285)
Q Consensus       108 g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD  186 (285)
                      |||++|.+.||.||||++|+++|| +|||++|+++..+||+  .+|++|++||+||||++|+.|+|+|||.++.|++|||
T Consensus         1 GvRi~~~~~VRlGAyl~~Gt~vM~egfVN~nAgt~g~~Mie--grissgv~VG~~~diggGasi~G~Ls~g~~~pi~Ig~   78 (147)
T cd04649           1 GVRIADADRVRLGAYLAEGTTVMHEGFVNFNAGTLGNCMVE--GRISSGVIVGKGSDVGGGASIMGTLSGGGNNVISIGK   78 (147)
T ss_pred             CEEECCCCEEEECCEECCCCEECCCCEEEECCCCCCCCEEE--EEEEECEEECCCCCCCCCCEEEEECCCCCCCCEEECC
T ss_conf             93744786687341887995986256798766306661687--6785156989983327861787871678823569887


Q ss_pred             CCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCC
Q ss_conf             84782185784688845885663004652783368715881
Q gi|254780781|r  187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGE  227 (285)
Q Consensus       187 ~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~  227 (285)
                      ||+|||||.+  |+.+|++|+|.||++|+++|||.+.+..+
T Consensus        79 ncliGAnsgi--Gi~lGd~cvv~aGlyi~~gTki~~~d~~~  117 (147)
T cd04649          79 RCLLGANSGI--GISLGDNCIVEAGLYVTAGTKVTLPDNEE  117 (147)
T ss_pred             CEEECCCCCC--CEEECCCCEEECCEEECCCCEEEECCCCC
T ss_conf             5076146545--84868986882445983997898626577


No 7  
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882    N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2.7.7.23 from EC) is a trimeric bifunctional enzyme that catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-GlcNAc.    The X-ray crystal structure of Escherichia coli GlmU in complex with UDP-GlcNAc and CoA has been determined to 2.1 A resolution and reveals a two-domain architecture that is responsible for these two reactions . The C-terminal domain is responsible for the CoA-dependent acetylation of Glc-1-PO(4) to GlcNAc-1-PO(4) and displays the longest left-handed parallel beta-helix observed to date. The acetyltransferase active site defined by the binding site for CoA makes use of residues from all three subunits and is positioned beneath an open cavity large enough to accommodate the Glc-1-PO(4) acetyl acceptor. The N-terminal domain catalyzes uridyl transfer from UTP to GlcNAc-1-PO(4) to form the final products UDP-GlcNAc and pyrophosphate. This domain is composed of a central seven-stranded beta-sheet surrounded by six alpha-helices in a Rossmann fold-like topology. ; GO: 0003977 UDP-N-acetylglucosamine diphosphorylase activity, 0009103 lipopolysaccharide biosynthetic process.
Probab=99.91  E-value=8.9e-25  Score=172.28  Aligned_cols=122  Identities=28%  Similarity=0.428  Sum_probs=108.4

Q ss_pred             HHCCCCCCCCCEECCCCCCCCCCEEECCEEEC-CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEE
Q ss_conf             42475102543103564006651462010302-35336772015661232204730686881232112100577656448
Q gi|254780781|r  105 EKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNM-GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI  183 (285)
Q Consensus       105 ~~~g~rv~P~a~vr~ga~Ig~g~vimp~~Vni-GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pvi  183 (285)
                      -..+..|.|.|++|++|.|+.++-+ ++||++ .|.||+||..+|-+.+|. |+||++|.|++|+-. .-+.+.+..+|+
T Consensus       326 ig~~~~vGPFArLRP~~~L~~~~hi-GNFVE~Kna~iG~gsKA~HLsYlGD-AeiG~~vNiGAGtIT-cNYDG~nK~~T~  402 (461)
T TIGR01173       326 IGEGCDVGPFARLRPGSVLGAGVHI-GNFVEVKNARIGEGSKAGHLSYLGD-AEIGSNVNIGAGTIT-CNYDGVNKHKTI  402 (461)
T ss_pred             ECCCCEECCCCCCCCCCHHHCCCEE-EEEEEEECCEECCCCCCCCCCEEEE-EEECCCCEECCEEEE-EECCCCCCCCCE
T ss_conf             6156402773001864321177816-0258652476188644231433320-250796003231689-932796220348


Q ss_pred             ECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECC
Q ss_conf             725847821857846888458856630046527833687158814644549
Q gi|254780781|r  184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVP  234 (285)
Q Consensus       184 IeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP  234 (285)
                      |||+|||||||.++.+|+||+||.||||++||+     ||+++.+..+|.|
T Consensus       403 IGd~VFiGSnt~LVAPV~iG~gA~iaAGstvt~-----DVp~g~La~~R~~  448 (461)
T TIGR01173       403 IGDGVFIGSNTQLVAPVKIGDGATIAAGSTVTK-----DVPEGALAIARAR  448 (461)
T ss_pred             ECCCCEECCCCEEECCEEECCCCEECCCCEEEC-----CCCCCCCEEECCC
T ss_conf             648878776760455439438118712414802-----3488852662455


No 8  
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family. These proteins contain repeats of the bacterial transferase hexapeptide (pfam00132), although often these do not register above the trusted cutoff.
Probab=99.90  E-value=1.1e-23  Score=165.54  Aligned_cols=118  Identities=36%  Similarity=0.625  Sum_probs=107.4

Q ss_pred             HHHCCCC----CCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCC
Q ss_conf             4424751----025431035640066514620-10302353367720156612322047306868812321121005776
Q gi|254780781|r  104 FEKHNFR----IIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQ  178 (285)
Q Consensus       104 f~~~g~r----v~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~  178 (285)
                      +++.+++    +.|.|.+.+.+.||+|+++|| ++++.++.||.+++|+++++|||+++||++|+|++++.++|      
T Consensus        79 l~~~~~~f~~lIhp~a~i~~~~~ig~G~~I~~~~~i~~~~~IG~~~~i~~~~~I~Hd~~ig~~~~i~~~~~i~G------  152 (201)
T TIGR03570        79 LKAKGYRFATLIHPSAIVSPSASIGEGTVIMAGAVINPDVRIGDNVIINTGAIVEHDCVIGDYVHIAPGVTLSG------  152 (201)
T ss_pred             HHHCCCEEEEEECCCCEECCCCEECCCCEEECCCEECCCCEEEEEEEECCCCCCCCCCEECCCCEECCCCEECC------
T ss_conf             98689967899999809889867879989962869876647802679804232144254778768999859989------


Q ss_pred             CCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCC
Q ss_conf             564487258478218578468884588566300465278336871588146445499
Q gi|254780781|r  179 TGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPS  235 (285)
Q Consensus       179 a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~  235 (285)
                        .|.|+|+||||+||.|.+++.||++++||||+++++     |++...++.| +||
T Consensus       153 --~v~Ig~~~~iG~~~~i~~~i~Ig~~~~Igags~V~~-----~v~~~~~~~G-~PA  201 (201)
T TIGR03570       153 --GVVIGEGVFIGAGATIIQGVTIGAGAIVGAGAVVTK-----DIPDGGVVVG-VPA  201 (201)
T ss_pred             --CCEECCCCEECCCCEECCCCEECCCCEECCCCEEEC-----CCCCCCEEEE-ECC
T ss_conf             --887977735989889889989999999997988904-----3799979997-587


No 9  
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain. The alignment contains 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. A few members are identified as NeuD, a sialic acid (Sia) O-acetyltransferase that is required for Sia synthesis and surface polysaccharide sialylation.
Probab=99.88  E-value=8.4e-23  Score=160.19  Aligned_cols=117  Identities=34%  Similarity=0.600  Sum_probs=104.6

Q ss_pred             HHHHHCCCC----CCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECC
Q ss_conf             234424751----025431035640066514620-103023533677201566123220473068688123211210057
Q gi|254780781|r  102 KDFEKHNFR----IIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP  176 (285)
Q Consensus       102 ~~f~~~g~r----v~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep  176 (285)
                      +.|++.+++    +.|.|.+.+.+.||+|+++|| ++++.++.||++++|+++++|+|+++||++|||++++.|+|    
T Consensus        74 ~~l~~~~~~~~niIhp~a~i~~~~~ig~G~~I~~~~~i~~~~~IG~~~~i~~~~~i~Hd~~ig~~~~i~~~~~i~g----  149 (197)
T cd03360          74 EKLLAAGYRFATLIHPSAVVSPSAVIGEGCVIMAGAVINPDARIGDNVIINTGAVIGHDCVIGDFVHIAPGVVLSG----  149 (197)
T ss_pred             HHHHHCCCEEEEEECCCCEECCCCEECCCCEEECCCEECCCCCCCCEEEECCCHHCCCCCCCCCCCEECCCEEECC----
T ss_conf             9998689967899999959877747999429931759865653043689877001053150131010667236778----


Q ss_pred             CCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEE
Q ss_conf             7656448725847821857846888458856630046527833687158814644
Q gi|254780781|r  177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYG  231 (285)
Q Consensus       177 ~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g  231 (285)
                          .|.|+|+||||+||+|.+++.||++++||||+++++     |++...+++|
T Consensus       150 ----~v~Ig~~~~iG~~~~i~~~i~Ig~~~~igags~v~~-----~i~~~~~~~G  195 (197)
T cd03360         150 ----GVTIGEGAFIGAGATIIQGVTIGAGAIIGAGAVVTK-----DVPDGSVVVG  195 (197)
T ss_pred             ----CEEEEEECCCCCCCEECCCCEECCCCEECCCCEEEE-----ECCCCEEEEE
T ss_conf             ----308912162989989879989999999997998912-----5699909993


No 10 
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional
Probab=99.87  E-value=8.8e-22  Score=153.94  Aligned_cols=122  Identities=26%  Similarity=0.370  Sum_probs=96.9

Q ss_pred             HHHHCCCCCCCCCEECCCCCCCCCCEEECCEEEC-CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCC
Q ss_conf             3442475102543103564006651462010302-353367720156612322047306868812321121005776564
Q gi|254780781|r  103 DFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNM-GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP  181 (285)
Q Consensus       103 ~f~~~g~rv~P~a~vr~ga~Ig~g~vimp~~Vni-GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~p  181 (285)
                      -.-..+.+|.|.|.+|+++.|++++-+ ++||++ .+.||+||.+++.+.||. +.||++|.|++|+... -+.+.+..+
T Consensus       318 s~Ig~~~~IGPfA~lRp~t~i~~~~~i-GnfvEiK~s~i~~g~k~~HlsYiGD-a~iG~~~NiGAGtit~-NyDG~~K~~  394 (456)
T PRK09451        318 ANLGAACTIGPFARLRPGAELLEGAHV-GNFVEMKKARLGKGSKAGHLTYLGD-AEIGDNVNIGAGTITC-NYDGANKFK  394 (456)
T ss_pred             CEECCCCEECCCCCCCCCCEECCCCEE-EEEEEEECCEECCCCEECCEEEECC-CEECCCCEECCCEEEE-ECCCCCCCC
T ss_conf             634367168886434887623678888-2289982459758977042336614-4765886888876997-224876656


Q ss_pred             EEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEE
Q ss_conf             487258478218578468884588566300465278336871588146445
Q gi|254780781|r  182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGE  232 (285)
Q Consensus       182 viIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~  232 (285)
                      ++|||+||||+|+.+++++.||++|.||||++||+     |++.+.+..+|
T Consensus       395 t~igd~~fiGsn~~lvapv~iG~~a~i~aGs~it~-----dVp~~~l~i~r  440 (456)
T PRK09451        395 TIIGDDVFVGSDTQLVAPVTVGKGATIGAGTTVTR-----DVAENELVISR  440 (456)
T ss_pred             CEECCCCEECCCCEEECCEEECCCCEECCCCEECC-----CCCCCCEEECC
T ss_conf             48789829987844835849889979998987885-----06999777704


No 11 
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2.3.1 from EC) catalyses an early step in lipid A biosynthesis : UDP-3-O-(3-hydroxytetradecanoyl)glucosamine + (R)-3-hydroxytetradecanoyl- [acyl carrier protein] = UDP-2,3-bis(3-hydroxytetradecanoyl)glucosamine + [acyl carrier protein]  Members of this family also contain a hexapeptide repeat (IPR001451 from INTERPRO). This entry represents the non-repeating region of LPXD proteins.; GO: 0016747 transferase activity transferring groups other than amino-acyl groups, 0009245 lipid A biosynthetic process.
Probab=99.86  E-value=4.9e-22  Score=155.51  Aligned_cols=173  Identities=29%  Similarity=0.346  Sum_probs=128.0

Q ss_pred             HHCCCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECC-----------
Q ss_conf             424751025431035640066514620-10302353367720156612322047306868812321121-----------
Q gi|254780781|r  105 EKHNFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGG-----------  172 (285)
Q Consensus       105 ~~~g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGG-----------  172 (285)
                      -+.+++|.|+++|-.++.||.||.|+| ++|--+..||++|.|-++++|.+.++||+||+|.+|+.||+           
T Consensus       116 ~~~~v~I~pnvvIG~~v~IG~~~~I~pg~~iG~~v~IG~~~~i~~~v~i~~~~~lG~nV~I~~GaVIG~DGFGya~~~~g  195 (336)
T TIGR01853       116 IGEGVTIGPNVVIGAGVEIGENVIIGPGVVIGDDVVIGDGSVIYPNVVIYERVQLGKNVIIHAGAVIGSDGFGYAHTANG  195 (336)
T ss_pred             CCCCCEECCEEEECCCCEECCCCEECCCCEECCCCEECCCCEEECCCEEEECCEECCEEEECCCCEECCCCCCEEECCCC
T ss_conf             07843687541788886877863635776876886879967780670897241564715876887886787320357889


Q ss_pred             -EECCCCCCCEEECCCCEEECCCEEECC----------------------EEECCCCEEEEEEEECCCCEEEE--CCCCC
Q ss_conf             -005776564487258478218578468----------------------88458856630046527833687--15881
Q gi|254780781|r  173 -VLEPIQTGPTIIEDNCFIGARSEIVEG----------------------CIIREGSVLGMGVFIGKSTKIID--RNTGE  227 (285)
Q Consensus       173 -vlep~~a~pviIeD~v~IGa~s~I~~G----------------------v~Ig~gavIgaG~vit~st~i~d--~~~~~  227 (285)
                       -+.-+|.+.|||||+|.||||++|.+|                      |+||++|+|.|++-|..||+|.+  .-.|.
T Consensus       196 ~~~KI~q~G~ViI~D~VEIGANTtIDRg~~~dT~i~~gtKIDNLVQIAHNc~IG~n~~ivaqvGiaGSt~iG~~V~~GGq  275 (336)
T TIGR01853       196 GHVKIPQIGRVIIEDDVEIGANTTIDRGAFDDTVIGEGTKIDNLVQIAHNCRIGENCIIVAQVGIAGSTKIGRNVILGGQ  275 (336)
T ss_pred             CEEEEEEECEEEEECEEEECCCCHHHCCCCCCCEEECCCEECCEEEEEEEEEECCCCEEEEEEECCEEEEECCEEEECCE
T ss_conf             71544130248960233874687021102147187238466231574133462664278964201134675580696260


Q ss_pred             ------EEEEE---CCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHC
Q ss_conf             ------46445---499878960564455677665776446727989612024668889987511
Q gi|254780781|r  228 ------ITYGE---VPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD  283 (285)
Q Consensus       228 ------~~~g~---vP~~~vvvpg~~~~~~~~~~~~~~~~~cavi~~~~d~~t~~k~~ln~~lR~  283 (285)
                            +.-|+   |-+.|.| +.++|...   .|.+- . -|+.--++..|..++..-+.-|+.
T Consensus       276 vGv~GHl~IgD~v~i~A~sgV-~~~~~~~~---~yggg-i-~Pa~~~~~w~k~~a~~~~l~~~~~  334 (336)
T TIGR01853       276 VGVAGHLEIGDNVTIGAKSGV-TKSVPPNG---RYGGG-I-IPAMPQKEWLKIAAKLKRLPELRK  334 (336)
T ss_pred             EEEECEEEECCCCEEEEECCC-CCCCCCCC---CCCEE-E-CCCCHHHHHHHHHHHHHHCHHHHC
T ss_conf             265110894383488451220-67779886---01001-1-141202478999999871425531


No 12 
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]
Probab=99.84  E-value=1.2e-20  Score=147.05  Aligned_cols=134  Identities=28%  Similarity=0.368  Sum_probs=112.8

Q ss_pred             HHHHHHCCCCCCCCCEECCCCCCCCCCEEECCEEEC-CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCC
Q ss_conf             023442475102543103564006651462010302-3533677201566123220473068688123211210057765
Q gi|254780781|r  101 TKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNM-GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQT  179 (285)
Q Consensus       101 ~~~f~~~g~rv~P~a~vr~ga~Ig~g~vimp~~Vni-GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a  179 (285)
                      |..--.+|..|.|.|.+|+|+.|+.++-+ ++||++ .|.||+||..++.+.+|. |.||++|.|++|+.. --+...+.
T Consensus       319 e~s~vg~~~~VGPfA~LRPg~~L~~~~hI-GNFVEvK~a~ig~gsKa~HLtYlGD-A~iG~~~NiGAGtIt-cNYDG~nK  395 (460)
T COG1207         319 EGSTVGEGATVGPFARLRPGAVLGADVHI-GNFVEVKKATIGKGSKAGHLTYLGD-AEIGENVNIGAGTIT-CNYDGKNK  395 (460)
T ss_pred             ECCEECCCCCCCCCCCCCCCCCCCCCCEE-EEEEEEECCCCCCCCCCCCEEEECC-CEECCCCEECCCEEE-ECCCCCCC
T ss_conf             05585479633783101796852679767-4259984356068863353234213-320687421442599-84788633


Q ss_pred             CCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCC
Q ss_conf             64487258478218578468884588566300465278336871588146445499878960564
Q gi|254780781|r  180 GPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY  244 (285)
Q Consensus       180 ~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~  244 (285)
                      ..++|||++|||+||.++.+|+||+|+.|+||++||+     |++.+.+..+|  ++.+..+|-.
T Consensus       396 ~~T~IGd~vFiGSns~LVAPV~IGd~a~iaAGStIT~-----DVp~~aLai~R--arQ~~~egw~  453 (460)
T COG1207         396 FKTIIGDNVFIGSNSQLVAPVTIGDGATIAAGSTITK-----DVPEGALAISR--ARQTNKEGWV  453 (460)
T ss_pred             CEEEECCCCEECCCCCEEEEEEECCCCEECCCCEECC-----CCCCCCEEEEE--CCEEECCCCC
T ss_conf             2006468857766871886489669848814636836-----57998446740--4414324421


No 13 
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc. This constitutes the third step in the lipid A biosynthetic pathway in Gram-negative bacteria. LpxD is a homotrimer, with each subunit consisting of a novel combination of an N-terminal uridine-binding domain, a core lipid-binding left-handed parallel beta helix (LbH) domain, and a C-terminal alpha-helical extension. The LbH domain contains 9 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).
Probab=99.83  E-value=2.2e-20  Score=145.43  Aligned_cols=123  Identities=30%  Similarity=0.420  Sum_probs=77.1

Q ss_pred             CCCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCE------------
Q ss_conf             4751025431035640066514620-103023533677201566123220473068688123211210------------
Q gi|254780781|r  107 HNFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGV------------  173 (285)
Q Consensus       107 ~g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGv------------  173 (285)
                      .++++.|.|++++++.|++++++.| +++.-++.||++|.|..+++|++.+.||++|.|++++.||.-            
T Consensus         6 ~~v~I~~~avI~~~v~Ig~n~~I~~~~~I~~~v~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~vIg~~~f~~~~~~~~~~   85 (205)
T cd03352           6 ENVSIGPNAVIGEGVVIGDGVVIGPGVVIGDGVVIGDDCVIHPNVTIYEGCIIGDRVIIHSGAVIGSDGFGFAPDGGGWV   85 (205)
T ss_pred             CCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEEECCCEECCCCEECCEEEECCCEEECCCCCCCCCCCCCCE
T ss_conf             99999998799999999999999898899999688988366003447278687544777153486213532314798404


Q ss_pred             --------------------------ECC-------------------------------CCCCCEEECCCCEEECCCEE
Q ss_conf             --------------------------057-------------------------------76564487258478218578
Q gi|254780781|r  174 --------------------------LEP-------------------------------IQTGPTIIEDNCFIGARSEI  196 (285)
Q Consensus       174 --------------------------lep-------------------------------~~a~pviIeD~v~IGa~s~I  196 (285)
                                                ++.                               .-++++.|+|+||||+++.|
T Consensus        86 ~~~~~g~v~Ig~~v~Ig~~~~I~~g~~~~T~IG~~~~i~~~v~igh~~~iG~~~~i~~~~~~~g~~~Igd~~~iG~~s~i  165 (205)
T cd03352          86 KIPQLGGVIIGDDVEIGANTTIDRGALGDTVIGDGTKIDNLVQIAHNVRIGENCLIAAQVGIAGSTTIGDNVIIGGQVGI  165 (205)
T ss_pred             ECCCCCCEEECCCEEECCCCEECCCCCCCCCCCCCCEECCCCCCCCCCCCCCCEEECCCCCCCCCEEECCCCEECCCCEE
T ss_conf             51421318984884988862763664267747877686454525564041587075032000265249743539896488


Q ss_pred             ECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCC
Q ss_conf             468884588566300465278336871588146445499
Q gi|254780781|r  197 VEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPS  235 (285)
Q Consensus       197 ~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~  235 (285)
                      .+|++||++|+||||+++|+     |++.+.++.| .||
T Consensus       166 ~~gv~IG~~a~VgagSvVtk-----dVp~~~iv~G-~PA  198 (205)
T cd03352         166 AGHLTIGDGVVIGAGSGVTS-----IVPPGEYVSG-TPA  198 (205)
T ss_pred             CCCCEECCCCEECCCCEECC-----CCCCCCEEEE-EEC
T ss_conf             29939999989986887964-----8699969997-628


No 14 
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc. It is the first enzyme in the lipid A biosynthetic pathway and is also referred to as LpxA. Lipid A is essential for the growth of Escherichia coli and related bacteria. It is also essential for maintaining the integrity of the outer membrane. UDP-GlcNAc acyltransferase is a homotrimer of left-handed parallel beta helix (LbH) subunits. Each subunit contains an N-terminal LbH region with 9 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), and a C-terminal alpha-helical region.
Probab=99.82  E-value=3.7e-20  Score=144.03  Aligned_cols=111  Identities=23%  Similarity=0.373  Sum_probs=74.8

Q ss_pred             CCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCC
Q ss_conf             33677201566123220473068688123211210057765644872584782185784688845885663004652783
Q gi|254780781|r  139 YIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKST  218 (285)
Q Consensus       139 ~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st  218 (285)
                      .||++++++.++.|+|+|+||++|.|+.++.++|        .|.|||+||||+++.|.++++||++|+||||+++++  
T Consensus       104 ~IG~~~~im~~~HIaHdc~IG~~~iian~~~laG--------hv~Igd~a~IGg~~~v~q~v~IG~~a~Igags~V~k--  173 (254)
T cd03351         104 RIGNNNLLMAYVHVAHDCVIGNNVILANNATLAG--------HVEIGDYAIIGGLSAVHQFCRIGRHAMVGGGSGVVQ--  173 (254)
T ss_pred             EECCCCEEEECCCCCCCCCCCCCEEEECCCCCCC--------CEEECCCCEECCCCEECCCCEECCCEEECCCCEEEC--
T ss_conf             9788857820254456773379759933445568--------569899848988367759819996619976745611--


Q ss_pred             EEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             3687158814644549987896056445567766577644672798961202466888998751
Q gi|254780781|r  219 KIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR  282 (285)
Q Consensus       219 ~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~cavi~~~~d~~t~~k~~ln~~lR  282 (285)
                                   +||||++|. |. |.+     ..++|   .+=++|+--+.+....|.+++|
T Consensus       174 -------------DVpp~~~v~-G~-PA~-----~~glN---~vGl~R~g~~~~~i~~i~~ayr  214 (254)
T cd03351         174 -------------DVPPYVIAA-GN-RAR-----LRGLN---LVGLKRRGFSREEIRALKRAYR  214 (254)
T ss_pred             -------------CCCCCCEEC-CC-CCE-----EEEEE---HHHHHHCCCCHHHHHHHHHHHH
T ss_conf             -------------369872651-79-657-----87214---8988677999999999999999


No 15 
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional
Probab=99.82  E-value=6.8e-20  Score=142.41  Aligned_cols=148  Identities=22%  Similarity=0.300  Sum_probs=79.5

Q ss_pred             CCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEE--------------
Q ss_conf             1025431035640066514620-1030235336772015661232204730686881232112100--------------
Q gi|254780781|r  110 RIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVL--------------  174 (285)
Q Consensus       110 rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvl--------------  174 (285)
                      +|.|.|+|.++|.|++++.+.| ++|.-++.||++|.|.++++|...++||++|.|.+++.||+--              
T Consensus         4 ~IHptAiI~~~A~IG~~v~Igp~~vIg~~v~IG~~~~I~~~v~I~~~t~IG~~~~I~~~avIG~~pqd~~~~g~~~~v~I   83 (261)
T PRK05289          4 KIHPTAIVEPGAEIGENVEIGPFCVIGPDVVIGDGTEIGSHVVIDGHTTIGKNNRIFPFASIGEEPQDLKYKGEPTRLVI   83 (261)
T ss_pred             CCCCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEEECCCEECCCCEECCCCCCCCCCCCCCCCCCCCEEEE
T ss_conf             40898898998999998999999999999999999999799689189888988345247533778766660698536998


Q ss_pred             -----------------CC----------------------------------CCCCCEEECCCCEEECCCEEECCEEEC
Q ss_conf             -----------------57----------------------------------765644872584782185784688845
Q gi|254780781|r  175 -----------------EP----------------------------------IQTGPTIIEDNCFIGARSEIVEGCIIR  203 (285)
Q Consensus       175 -----------------ep----------------------------------~~a~pviIeD~v~IGa~s~I~~Gv~Ig  203 (285)
                                       ..                                  .-++.|.|||+|+||+++.|.++++||
T Consensus        84 Gd~~~Ire~vtI~rgT~~~~g~T~IG~~~~im~~vhIaHd~~IG~~~iian~~~laG~v~Igd~v~iGg~~~v~q~v~IG  163 (261)
T PRK05289         84 GDNNTIREFVTINRGTVQGGGVTRIGDNNLLMAYVHVAHDCVVGNNVILANNATLAGHVEVGDYAIIGGLSGVHQFVRIG  163 (261)
T ss_pred             CCCCEECCCCEECCCCCCCCCCEEECCCCEEECCCCCCCCCCCCCCCEECCCEEECCCEEECCCEEECCCCEECCCCEEC
T ss_conf             99778985414436610588644988885440036434455127871654305664607988970997615664883989


Q ss_pred             CCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHH
Q ss_conf             8856630046527833687158814644549987896056445567766577644672798961202466888998751
Q gi|254780781|r  204 EGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR  282 (285)
Q Consensus       204 ~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~cavi~~~~d~~t~~k~~ln~~lR  282 (285)
                      ++|+||+|+++++               +||||++|. |.....      .++|   .+=+||+--+......|.+++|
T Consensus       164 ~~a~vgagS~V~k---------------DVpp~~~v~-G~PAr~------~glN---~vGL~R~g~s~~~i~~i~~ayr  217 (261)
T PRK05289        164 AHAMVGGMSAVVQ---------------DVPPYVLAE-GNPARL------RGLN---IVGLKRRGFSREEIHALRRAYK  217 (261)
T ss_pred             CCEEECCCCEECC---------------CCCCCCEEE-CCCCEE------EEEE---HHHHHHCCCCHHHHHHHHHHHH
T ss_conf             8719997636542---------------479986784-683568------8612---8888677999999999999999


No 16 
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional
Probab=99.81  E-value=3e-19  Score=138.44  Aligned_cols=112  Identities=22%  Similarity=0.372  Sum_probs=77.0

Q ss_pred             CCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCC
Q ss_conf             33677201566123220473068688123211210057765644872584782185784688845885663004652783
Q gi|254780781|r  139 YIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKST  218 (285)
Q Consensus       139 ~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st  218 (285)
                      .||++++++..+.|+|+|+||++|.+++++.++|        .|.|||+|+||+++.|.+.++||++|+||+++++++  
T Consensus       104 ~IG~~~~im~~vhIaHd~~IG~~~iian~~~laG--------~v~Igd~v~iGg~~~v~q~v~IG~~a~Ig~gS~V~k--  173 (256)
T PRK12461        104 RIGNDNLLMANSHIAHDCQIGNNVILVNGALLAG--------HVTVGDRAIISGNCLVHQFCRIGRLAMMAGGSRISK--  173 (256)
T ss_pred             EECCCCEEECCCCCCCCCCCCCCEEEECCEEECC--------CEEECCCCEECCCCEECCCCEECCCCEECCCCEEEE--
T ss_conf             9887858743643346431367706722202324--------259999729957347717979999969987857775--


Q ss_pred             EEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHC
Q ss_conf             36871588146445499878960564455677665776446727989612024668889987511
Q gi|254780781|r  219 KIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD  283 (285)
Q Consensus       219 ~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~cavi~~~~d~~t~~k~~ln~~lR~  283 (285)
                                   +||||++|. |. |.+     ..++|   .+=+||+--+.+....|.+++|-
T Consensus       174 -------------DVPp~~~v~-G~-pA~-----~~glN---~vGl~R~gf~~~~i~~i~~ay~~  215 (256)
T PRK12461        174 -------------DVPPYCMMA-GN-TTN-----VHGLN---AVGLRRNGFSSRAIRALKRAYKI  215 (256)
T ss_pred             -------------ECCCCEEEE-CC-CCE-----EEECH---HHHCCCCCCCHHHHHHHHHHHHH
T ss_conf             -------------379983882-68-776-----54010---44045289899999999999999


No 17 
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (DapD) is involved in the succinylated branch of the "lysine biosynthesis via diaminopimelate (DAP)" pathway (GenProp0125). This model represents a clade of DapD sequences most closely related to the actinobacterial DapD family represented by the TIGR03535 model. All of the genes evaluated for the seed of this model are found in genomes where the downstream desuccinylase is present, but known DapD genes are absent. Additionally, many of the genes identified by this model are found proximal to genes involved in this lysine biosynthesis pathway.
Probab=99.80  E-value=1.1e-19  Score=141.19  Aligned_cols=177  Identities=22%  Similarity=0.333  Sum_probs=136.7

Q ss_pred             CHHHCCCCCCCCCCHHHH-HHCCCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEE
Q ss_conf             011017753236520234-424751025431035640066514620-103023533677201566123220473068688
Q gi|254780781|r   87 TWWDKIPAKFDDWKTKDF-EKHNFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHI  164 (285)
Q Consensus        87 ~~~DKvp~Kf~~~~~~~f-~~~g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI  164 (285)
                      ...||.|--      -+| --+|+||...+.||-|||+++|+.+|. .|||.+|---.-+||..  +|.+.+.+|++..|
T Consensus       162 ~~vDkfPrm------~dyvvP~gvRIad~~rVRLGA~L~~GTtvmhegfvnfNAGTlG~~mvEG--RiS~GVvVg~gsDi  233 (341)
T TIGR03536       162 DCVDKFPKM------TDYVVPKGVRIADTARVRLGAYVGEGTTVMHEGFINFNAGTEGPSMVEG--RISAGVMVGKGSDL  233 (341)
T ss_pred             EEECCCCCH------HHEECCCCCEECCCCCEEEEEEECCCEEEECCCEEECCCCCCCCCEEEE--EEECCEEECCCCCC
T ss_conf             982457414------3145678837615663443007758817702214750477766424530--44034696678766


Q ss_pred             ECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCC-CEEEEECCCCCEEECCC
Q ss_conf             12321121005776564487258478218578468884588566300465278336871588-14644549987896056
Q gi|254780781|r  165 SGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTG-EITYGEVPSYSVVVPGS  243 (285)
Q Consensus       165 ~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~-~~~~g~vP~~~vvvpg~  243 (285)
                      ++|+.|.|+|...+..++.|+.+|.+||||.+  |+..|.+|+|.||.+||++|||.-.+.. +... .|-++  -..|.
T Consensus       234 GGgaSimGtLSGGg~~~isiG~~cLlGANsg~--GI~LGD~C~veaGlyvtagtkv~~~d~~~~~~~-~vka~--eLsg~  308 (341)
T TIGR03536       234 GGGCSTMGTLSGGGNIVISVGEGCLLGANAGI--GIPLGDRCTVEAGLYITAGTKVAVLDDKGELVE-TVKAR--DLAGQ  308 (341)
T ss_pred             CCCEEEEEEECCCCCEEEEECCCCCCCCCCCC--CCCCCCCCEEECCEEEECCCEEEEECCCCCCCE-EEEHH--HHCCC
T ss_conf             77502477635898236888732201444555--742489847812449927967988677888120-78879--85799


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHCCC
Q ss_conf             445567766577644672798961202466888998751159
Q gi|254780781|r  244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS  285 (285)
Q Consensus       244 ~~~~~~~~~~~~~~~~cavi~~~~d~~t~~k~~ln~~lR~~~  285 (285)
                      --..|.++     |+.-+|..+.+.    ....||+.|..+|
T Consensus       309 ~~llFrrn-----S~tG~ve~~~~~----~~i~LN~~LH~nn  341 (341)
T TIGR03536       309 SDLLFRRN-----SINGAIECLTNK----SAIALNEELHANN  341 (341)
T ss_pred             CCCEEEEC-----CCCCCEEEEECC----CEEECHHHHHCCC
T ss_conf             88079971-----887428999789----8061206662489


No 18 
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family. This family of proteins contains copies of the Bacterial transferase hexapeptide repeat family (pfam00132) and is only found in operons encoding the phosphonate C-P lyase system (GenProp0232). Many C-P lyase operons, however, lack a homolog of this protein.
Probab=99.80  E-value=6.5e-19  Score=136.38  Aligned_cols=116  Identities=21%  Similarity=0.285  Sum_probs=91.6

Q ss_pred             CCCCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECC----------
Q ss_conf             4751025431035640066514620103023533677201566123220473068688123211210057----------
Q gi|254780781|r  107 HNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP----------  176 (285)
Q Consensus       107 ~g~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep----------  176 (285)
                      ...+|.|.|.++ .+.+|.++-+-+..+--...||++|.|+.++.|.. ++||++|.|++++.|++--.|          
T Consensus         7 ~~p~Ihp~a~i~-~~~lG~~v~Ig~~~~i~ns~IGDySyI~~~~~I~n-~~IGkfcsIa~~v~I~~~nHp~~~~s~~~f~   84 (204)
T TIGR03308         7 PEPTLHPTAELT-ESKLGRYTEIGERTRLREVALGDYSYVMRDCDIIY-TTIGKFCSIAAMVRINATNHPMERPTLHHFT   84 (204)
T ss_pred             CCCEECCCCEEC-CCCCCCCEEECCCCEEECCEECCCCEECCCCEEEC-CEECCCCEECCCCEECCCCCCCCCCEECCEE
T ss_conf             997689998683-27837833999995883379999858889975988-8699984888987989877876672677775


Q ss_pred             -------------------CCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCC
Q ss_conf             -------------------7656448725847821857846888458856630046527833687158814644549987
Q gi|254780781|r  177 -------------------IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYS  237 (285)
Q Consensus       177 -------------------~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~  237 (285)
                                         ....+|+|||+||||+|+.|.+|++||+||+||||+++|+               +||+|+
T Consensus        85 y~~~~~~~~~~~~~~~~~~~~~~~~~Ig~dvwiG~~~~i~~gv~IG~gavigagsvVtk---------------dv~~~~  149 (204)
T TIGR03308        85 YRAAMYFDDASDDADFFAWRRAKRVTIGHDVWIGHGAVILPGVTIGNGAVIAAGAVVTK---------------DVAPYT  149 (204)
T ss_pred             EECCCCCCCCCCCHHHHCCCCCCCEEECCCCEECCCCEECCCCEECCCCEECCCCEECC---------------CCCCCE
T ss_conf             53753346666612232133478709899768879989919979999989977998995---------------179984


Q ss_pred             EE
Q ss_conf             89
Q gi|254780781|r  238 VV  239 (285)
Q Consensus       238 vv  239 (285)
                      +|
T Consensus       150 iv  151 (204)
T TIGR03308       150 IV  151 (204)
T ss_pred             EE
T ss_conf             99


No 19 
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. Alternate name: tetrahydrodipicolinate N-succinyltransferase.
Probab=99.78  E-value=5e-19  Score=137.08  Aligned_cols=176  Identities=24%  Similarity=0.331  Sum_probs=131.6

Q ss_pred             CHHHCCCCCCCCCCHHHH-HHCCCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEE
Q ss_conf             011017753236520234-424751025431035640066514620-103023533677201566123220473068688
Q gi|254780781|r   87 TWWDKIPAKFDDWKTKDF-EKHNFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHI  164 (285)
Q Consensus        87 ~~~DKvp~Kf~~~~~~~f-~~~g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI  164 (285)
                      ...||.|--      -+| --.|+||...+.||-|||+++|+.+|. .|||.+|---.-+||..  +|.+++.+|++..|
T Consensus       137 ~~vDKfPrm------~dyvvP~gVRIada~rVRLGAyl~~GTtVmheGfvnfNaGTlG~~mvEG--RiS~gvvvg~gsDi  208 (319)
T TIGR03535       137 YSVDKFPRM------VDYVVPTGVRIGDADRVRLGAHLAEGTTVMHEGFVNFNAGTLGASMVEG--RISAGVVVGDGSDI  208 (319)
T ss_pred             EEECCCCCH------HCEECCCCCEECCCCCEEEEEEECCCCEEEECCEEEECCCCCCCCEEEE--EEECCEEECCCCCC
T ss_conf             972447513------3045678847704552554007659807710013760476766534631--44034696678766


Q ss_pred             ECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEE----E
Q ss_conf             123211210057765644872584782185784688845885663004652783368715881464454998789----6
Q gi|254780781|r  165 SGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVV----V  240 (285)
Q Consensus       165 ~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vv----v  240 (285)
                      ++|+.|.|+|...+..++.|+.+|.+||||.+  |+..|.+|+|.||.+||++|||.-..... ..+  |...+|    .
T Consensus       209 GGgaS~mGtLSGGg~~~isiG~~cLlGANsGi--GI~LGD~C~VeaGlyitaGTkV~~~~~~~-~~~--~~~~~vkA~eL  283 (319)
T TIGR03535       209 GGGASIMGTLSGGGKEVISIGERCLLGANSGI--GISLGDDCVVEAGLYVTAGTKVTVDGPKD-AAG--PDGEVVKASEL  283 (319)
T ss_pred             CCCCEEEEEECCCCCEEEEECCCCEECCCCCC--CCCCCCCCEEECCEEECCCCEEEEECCCC-CCC--CCCCEEEHHHH
T ss_conf             77501145304898224788653200454555--74358971781122881797798505222-457--76638875874


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHC
Q ss_conf             0564455677665776446727989612024668889987511
Q gi|254780781|r  241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD  283 (285)
Q Consensus       241 pg~~~~~~~~~~~~~~~~~cavi~~~~d~~t~~k~~ln~~lR~  283 (285)
                      .|.--..|.++     |+.-+|..+.++.   ....||+.|..
T Consensus       284 sG~~~llfrrn-----S~tG~ve~~~~~~---~~i~LN~~LH~  318 (319)
T TIGR03535       284 SGASNILFRRN-----SVTGAVEAVPRKG---VGIELNEALHA  318 (319)
T ss_pred             CCCCCCEEEEC-----CCCCCEEEEECCC---CEEECHHHHHC
T ss_conf             79988179970-----7876589996589---74850066517


No 20 
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional
Probab=99.78  E-value=1.4e-18  Score=134.33  Aligned_cols=144  Identities=25%  Similarity=0.267  Sum_probs=108.7

Q ss_pred             HHCCCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCE----------
Q ss_conf             424751025431035640066514620-103023533677201566123220473068688123211210----------
Q gi|254780781|r  105 EKHNFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGV----------  173 (285)
Q Consensus       105 ~~~g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGv----------  173 (285)
                      -..++.+.|+++|.+++.||+|++++| ++|.-++.||++|.|..+++|.++++||+||.|.+|+.||+-          
T Consensus       113 Ig~~v~Igp~~vIg~~v~IG~~~~I~~~~~Ig~~v~IG~~~~I~~nv~I~~~~~IG~~~~I~~g~vIG~dGFGf~~~~~~  192 (343)
T PRK00892        113 IGKSVSIGPNAVIGAGVEIGDGVIIGAGAVIGAGVKIGDDCRLHANVTIYHRVQIGNRVLIHSGAVIGQDGFGFAPDRGG  192 (343)
T ss_pred             ECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEEECCCEECCCEEECCCCEECCCCEECCCCCCCCCCCCC
T ss_conf             79998899998999998999999992981995881888995881185662555888875646886223667541367994


Q ss_pred             -ECCCCCCCEEECCCCEEECCCEEECC----------------------EEECCCCEEEEEEEECCCCEEEECC--CCCE
Q ss_conf             -05776564487258478218578468----------------------8845885663004652783368715--8814
Q gi|254780781|r  174 -LEPIQTGPTIIEDNCFIGARSEIVEG----------------------CIIREGSVLGMGVFIGKSTKIIDRN--TGEI  228 (285)
Q Consensus       174 -lep~~a~pviIeD~v~IGa~s~I~~G----------------------v~Ig~gavIgaG~vit~st~i~d~~--~~~~  228 (285)
                       ..-+|.+.|+|||+|.||+||+|.+|                      |.||++++|.+++-|..|+.|.|..  .|..
T Consensus       193 ~~kip~~G~V~I~d~veIgan~tIdrg~~~~T~Ig~~~kidn~vhIaHn~~IG~~~iia~~~giaGs~~igd~v~igG~~  272 (343)
T PRK00892        193 WVKIPQLGRVIIGDDVEIGANTTIDRGALDDTVIGEGVKIDNLVQIAHNVRIGRHCAIAAQVGIAGSTKIGRYCMIGGQV  272 (343)
T ss_pred             EEECCCCCEEEECCCCEECCCCEECCCCCCCCEECCCCEEEEEEEECCCCEECCCCEEEECCEEEEEEEECCCEEECCCC
T ss_conf             04646432499889868888732723667797889896592111761674787883885211470057999914994413


Q ss_pred             EEE---ECCCCCEEECCCCCCCC
Q ss_conf             644---54998789605644556
Q gi|254780781|r  229 TYG---EVPSYSVVVPGSYPSIN  248 (285)
Q Consensus       229 ~~g---~vP~~~vvvpg~~~~~~  248 (285)
                      -..   .|-.++++-..|-..++
T Consensus       273 gi~~h~~Ig~~~~i~~~sgv~~d  295 (343)
T PRK00892        273 GIAGHLEIGDGVQITAMSGVMKS  295 (343)
T ss_pred             CCCCCCEECCCCEEEECCEECCC
T ss_conf             23488698999799006514364


No 21 
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E. coli paaY protein, and similar proteins. CAs are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionary distinct groups - alpha, beta and gamma carbonic anhydrases - which show no significant sequence identity or structural similarity. Gamma CAs are trimeric enzymes with left-handed parallel beta helix (LbH) structural domain.
Probab=99.78  E-value=9e-19  Score=135.51  Aligned_cols=126  Identities=27%  Similarity=0.434  Sum_probs=98.8

Q ss_pred             CCCCCCCCEECCCCCCCCCCEEEC-CEEEC---CCCCCCCCCCCCCCEE----CCEEEECCCCEEECCCEECCEECCCCC
Q ss_conf             751025431035640066514620-10302---3533677201566123----220473068688123211210057765
Q gi|254780781|r  108 NFRIIPGTIVRHSAYIGPKAVLMP-SFVNM---GAYIGEGSMIDTWSTV----GSCAQIGKNVHISGGVGIGGVLEPIQT  179 (285)
Q Consensus       108 g~rv~P~a~vr~ga~Ig~g~vimp-~~Vni---GA~Ig~gt~I~~~a~I----G~~a~IG~~vhI~~g~~IGGvlep~~a  179 (285)
                      ...+.|+|.+.....||+++.++| +++..   ...||++|.|+.+++|    ++.+.||++|+|++++.+.|       
T Consensus         5 ~a~I~p~A~I~G~V~IG~~~~I~~~~~I~~d~~~i~IG~~~~I~~~~~Ih~~~~~~~~IG~~v~Ig~~~~i~g-------   77 (153)
T cd04645           5 SAFIAPNATVIGDVTLGEGSSVWFGAVLRGDVNPIRIGERTNIQDGSVLHVDPGYPTIIGDNVTVGHGAVLHG-------   77 (153)
T ss_pred             CEEECCCCEEECCEEECCCCEECCCCEEECCCCCEEECCCCEECCCCCCCCCCCCCCEECCCCEECCCCEEEC-------
T ss_conf             8199999999772699899999658384246663599999898968543525999979899989999959924-------


Q ss_pred             CCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             64487258478218578468884588566300465278336871588146445499878960564455677665776446
Q gi|254780781|r  180 GPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLY  259 (285)
Q Consensus       180 ~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~  259 (285)
                        +.|||+||||+||.|.+|++||++|+||||+++++.+             +||+++++. |.                
T Consensus        78 --~~Ig~~~~IG~~a~I~~gv~IG~~~vIgagsvV~~~~-------------~vp~~~v~~-G~----------------  125 (153)
T cd04645          78 --CTIGDNCLIGMGAIILDGAVIGKGSIVAAGSLVPPGK-------------VIPPGSLVA-GS----------------  125 (153)
T ss_pred             --EEEEEEEEECCCCEECCCCEECCCCEECCCCEECCCC-------------EECCCCEEE-EC----------------
T ss_conf             --1873004770543985699988997994498974897-------------969985999-62----------------


Q ss_pred             CCEEEEECCHHHH
Q ss_conf             7279896120246
Q gi|254780781|r  260 CAVIIKKVDEKTR  272 (285)
Q Consensus       260 cavi~~~~d~~t~  272 (285)
                      +|-++|+++++..
T Consensus       126 PAr~ir~~~~~e~  138 (153)
T cd04645         126 PAKVVRELTDEEI  138 (153)
T ss_pred             CCEEECCCCHHHH
T ss_conf             8379715999999


No 22 
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl]
Probab=99.78  E-value=1.1e-18  Score=134.88  Aligned_cols=119  Identities=30%  Similarity=0.363  Sum_probs=101.7

Q ss_pred             HHCCCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECC-----------
Q ss_conf             424751025431035640066514620-10302353367720156612322047306868812321121-----------
Q gi|254780781|r  105 EKHNFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGG-----------  172 (285)
Q Consensus       105 ~~~g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGG-----------  172 (285)
                      -..++.+.|+++|..++.||+|++++| +||.-+++||++|.|..+++|.+.++||+||.|.+|+.||.           
T Consensus       114 i~~~~~ig~~vvI~~~v~IG~~~~I~~~avIg~~~~IG~~~~i~~~v~I~~~~~IG~~v~I~~GavIG~dgFg~a~~~~g  193 (338)
T COG1044         114 IGKNVSIGPNVVIGAGVVIGENVVIGAGAVIGENVKIGDGTVIHPNVTIYHNVVIGNNVIIHSGAVIGADGFGYAGTAIG  193 (338)
T ss_pred             CCCCCCCCCCEEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEEECCCEECCCEEECCCCEECCCCCCCCCCCCC
T ss_conf             37787328874988897878985898897888896888885884787895275787822888998875685212246688


Q ss_pred             EECCCCCCCEEECCCCEEECCCEEECC----------------------EEECCCCEEEEEEEECCCCEEEEC
Q ss_conf             005776564487258478218578468----------------------884588566300465278336871
Q gi|254780781|r  173 VLEPIQTGPTIIEDNCFIGARSEIVEG----------------------CIIREGSVLGMGVFIGKSTKIIDR  223 (285)
Q Consensus       173 vlep~~a~pviIeD~v~IGa~s~I~~G----------------------v~Ig~gavIgaG~vit~st~i~d~  223 (285)
                      -..-+|.+.|+|||+|.||+|+.|.+|                      |+||++|.|.+++-|..|++|.+.
T Consensus       194 ~~Ki~q~g~V~Igd~VeIGanT~Idrga~~dTvIg~~~kIdN~vqIaHnv~IG~~~~I~~~vgIaGs~~IG~~  266 (338)
T COG1044         194 WVKIPQIGRVIIGDDVEIGANTTIDRGALDDTVIGEGVKIDNLVQIGHNVRIGEHCIIAGQVGIAGSVKIGKY  266 (338)
T ss_pred             CEECCEECEEEECCCEEECCCCEECCCCCCCCEECCCCEECCEEEECCCCEECCCCEEECCCEEECCCEECCE
T ss_conf             5671260659979824873552425655567265378487643078155278888377026316135357780


No 23 
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition. It binds iron when it is complexed with pyochelin. It adopts the left-handed parallel beta-helix (LbH) structure, and contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. Acyltransferase activity has not been observed in this group.
Probab=99.77  E-value=2.5e-18  Score=132.84  Aligned_cols=129  Identities=22%  Similarity=0.381  Sum_probs=96.9

Q ss_pred             CCCCCCEECCCCCCCCCCEEEC-CEEEC---CCCCCCCCCCCCCCEE----CCEEEECCCCEEECCCEECCEECCCCCCC
Q ss_conf             1025431035640066514620-10302---3533677201566123----22047306868812321121005776564
Q gi|254780781|r  110 RIIPGTIVRHSAYIGPKAVLMP-SFVNM---GAYIGEGSMIDTWSTV----GSCAQIGKNVHISGGVGIGGVLEPIQTGP  181 (285)
Q Consensus       110 rv~P~a~vr~ga~Ig~g~vimp-~~Vni---GA~Ig~gt~I~~~a~I----G~~a~IG~~vhI~~g~~IGGvlep~~a~p  181 (285)
                      -+.|.|++.-...||+++.++| +.+.-   ...||++|.|..++++    ++.+.||++|+|+.++.+.|         
T Consensus         8 ~I~p~a~i~G~v~IG~~~~I~~~~~Ir~d~~~i~IG~~~~I~~n~~I~~~~~~~~~ig~~v~ig~~~~i~g---------   78 (154)
T cd04650           8 YVHPTSYVIGDVVIGELTSVWHYAVIRGDNDSIYIGKYSNVQENVSIHTDHGYPTEIGDYVTIGHNAVVHG---------   78 (154)
T ss_pred             EECCCCEEECEEEECCCCEECCCCEEECCCCCEEECCCEEECCCCEEEECCCCCCEECCCCEECCCEEEEC---------
T ss_conf             99999999760599999999875389558876599993398999889846999868799768899528823---------


Q ss_pred             EEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCC
Q ss_conf             48725847821857846888458856630046527833687158814644549987896056445567766577644672
Q gi|254780781|r  182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCA  261 (285)
Q Consensus       182 viIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~ca  261 (285)
                      +.|||+||||+||.|.+|++||++|+||||++++++.             +||+++++. |.                +|
T Consensus        79 ~~Ig~~v~IG~~a~I~~Gv~IG~~svIgaGsVV~~~~-------------~Vp~~~lv~-G~----------------PA  128 (154)
T cd04650          79 AKVGNYVIVGMGAILLNGAKIGDHVIIGAGAVVTPGK-------------EIPDYSLVL-GV----------------PA  128 (154)
T ss_pred             CEECCEEEECCCEEEECCCEECCCCEECCCCEECCCC-------------EECCCCEEE-EC----------------CE
T ss_conf             0220135988722996287989997998898887997-------------919984999-61----------------81


Q ss_pred             EEEEECCHHHHHHHHH
Q ss_conf             7989612024668889
Q gi|254780781|r  262 VIIKKVDEKTRSKTSI  277 (285)
Q Consensus       262 vi~~~~d~~t~~k~~l  277 (285)
                      -++|+++++.++....
T Consensus       129 r~ir~l~~~~~~~~~~  144 (154)
T cd04650         129 KVVRKLTEEEIEWIKK  144 (154)
T ss_pred             EEEEECCHHHHHHHHH
T ss_conf             8977299999999999


No 24 
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E. coli paaY gene, which is part of the paa gene cluster responsible for phenylacetic acid degradation. Proteins in this group are expected to adopt the left-handed parallel beta-helix (LbH) structure. They contain imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Similarity to gamma carbonic anhydrase and Ferripyochelin Binding Protein (FBP) may suggest metal binding capacity.
Probab=99.77  E-value=2.5e-18  Score=132.86  Aligned_cols=127  Identities=23%  Similarity=0.425  Sum_probs=97.8

Q ss_pred             CCCCCCCCEECCCCCCCCCCEEEC-CEEEC--C-CCCCCCCCCCCCCEE----CCEEEECCCCEEECCCEECCEECCCCC
Q ss_conf             751025431035640066514620-10302--3-533677201566123----220473068688123211210057765
Q gi|254780781|r  108 NFRIIPGTIVRHSAYIGPKAVLMP-SFVNM--G-AYIGEGSMIDTWSTV----GSCAQIGKNVHISGGVGIGGVLEPIQT  179 (285)
Q Consensus       108 g~rv~P~a~vr~ga~Ig~g~vimp-~~Vni--G-A~Ig~gt~I~~~a~I----G~~a~IG~~vhI~~g~~IGGvlep~~a  179 (285)
                      ..-|.|.|.+.-...||+++.++| +.++.  | ..||++|+|+.+++|    ++.+.||++++++.++.+.|       
T Consensus         6 ~a~I~p~A~I~G~V~IG~~~~I~~~~~Ir~d~g~i~IG~~~~I~~n~~Ih~~~~~~~~Ig~~~~ig~~~~~~g-------   78 (155)
T cd04745           6 SSFVHPTAVLIGDVIIGKNCYIGPHASLRGDFGRIVIRDGANVQDNCVIHGFPGQDTVLEENGHIGHGAILHG-------   78 (155)
T ss_pred             CEEECCCCEEEEEEEECCCCEECCCEEEECCCCCEEECCCCEECCCCEECCCCCCCCEECCCCEECCCCEECC-------
T ss_conf             8599999999844799899799846079638777899999797878440135999869899978998748715-------


Q ss_pred             CCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCC
Q ss_conf             64487258478218578468884588566300465278336871588146445499878960564455677665776446
Q gi|254780781|r  180 GPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLY  259 (285)
Q Consensus       180 ~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~  259 (285)
                        +.||||||||+||+|.+|++||++|+||||+++++++.             ||++++++ |+                
T Consensus        79 --~~Ig~~~~IG~~a~I~~G~~IG~~siIgagSvV~~~~~-------------VP~~~l~~-Gn----------------  126 (155)
T cd04745          79 --CTIGRNALVGMNAVVMDGAVIGEESIVGAMAFVKAGTV-------------IPPRSLIA-GS----------------  126 (155)
T ss_pred             --CEEEEEEEECCCCEEECCCEECCCCEEEECCEECCCCC-------------CCCCEEEE-EE----------------
T ss_conf             --17743249768759959779899979941878769968-------------37998999-72----------------


Q ss_pred             CCEEEEECCHHHHH
Q ss_conf             72798961202466
Q gi|254780781|r  260 CAVIIKKVDEKTRS  273 (285)
Q Consensus       260 cavi~~~~d~~t~~  273 (285)
                      +|-++|+++++..+
T Consensus       127 PAk~ir~l~~~e~~  140 (155)
T cd04745         127 PAKVIRELSDEEVA  140 (155)
T ss_pred             CCEEEECCCHHHHH
T ss_conf             86797439999999


No 25 
>TIGR01172 cysE serine O-acetyltransferase; InterPro: IPR005881    The biosynthesis of L-cysteine is the predominant way by which inorganic sulphur is incorporated into organic compounds. In this process, the most abundant utilizable source of sulphur, inorganic sulphate, is taken up and reduced to sulphide. Sulphide is used to produce L-cysteine, which serves for protein synthesis or the production of other sulphur-containing organic compounds. Two routes for cysteine biosynthesis in nature have been documented. Serine transacetylase (2.3.1.30 from EC) catalyzes steps in pathway I, the activation of L-serine by acetyl-coenzyme A, yielding O-acetyl-L-serine.; GO: 0009001 serine O-acetyltransferase activity, 0006535 cysteine biosynthetic process from serine, 0005737 cytoplasm.
Probab=99.77  E-value=1.2e-18  Score=134.77  Aligned_cols=93  Identities=35%  Similarity=0.555  Sum_probs=77.7

Q ss_pred             CCCCCCCCCCC--CCCEECCEEEECCCCEEECCCEECCE-ECCC-CCCCEEECCCCEEECCCEEECCEEECCCCEEEEEE
Q ss_conf             35336772015--66123220473068688123211210-0577-65644872584782185784688845885663004
Q gi|254780781|r  137 GAYIGEGSMID--TWSTVGSCAQIGKNVHISGGVGIGGV-LEPI-QTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGV  212 (285)
Q Consensus       137 GA~Ig~gt~I~--~~a~IG~~a~IG~~vhI~~g~~IGGv-lep~-~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~  212 (285)
                      ||.||.|-|||  ++..||+.|.||++|+|..||++||. .|.. ..+|+ |+|+|.|||||.|+-.+.||+||.||||+
T Consensus        67 gA~IG~g~fIDHg~GvVIGETa~iGddv~iyhGVTLGGtgk~~G~kRHPt-~~~gV~iGAGAKvLG~I~vG~~AkiGAns  145 (163)
T TIGR01172        67 GARIGRGVFIDHGTGVVIGETAEIGDDVTIYHGVTLGGTGKEKGVKRHPT-IGEGVVIGAGAKVLGNIEVGENAKIGANS  145 (163)
T ss_pred             CCCCCCEEEEECCCCEEEEEEEEECCCEEEEECEEECCCCCCCCCCCCCC-CCCCEEEEECCEEECCEEECCCCEECCCE
T ss_conf             43007730777560368500368738837863212067888878898882-56871784078240376677997772332


Q ss_pred             EECCCCEEEECCCCCEEEEECCCC
Q ss_conf             652783368715881464454998
Q gi|254780781|r  213 FIGKSTKIIDRNTGEITYGEVPSY  236 (285)
Q Consensus       213 vit~st~i~d~~~~~~~~g~vP~~  236 (285)
                      |+.+     |++.+....| ||++
T Consensus       146 VVl~-----dVP~~~TVVG-vPar  163 (163)
T TIGR01172       146 VVLK-----DVPAGATVVG-VPAR  163 (163)
T ss_pred             EECC-----CCCCCCEEEE-ECCC
T ss_conf             6735-----3789865874-3589


No 26 
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed
Probab=99.76  E-value=4.6e-18  Score=131.19  Aligned_cols=120  Identities=26%  Similarity=0.445  Sum_probs=90.9

Q ss_pred             CCCCCCEEECC-EEECCC--CCCCCCCCCCCCEECCE--EEECCCCEEECCCEECCEECC----------CCCCCEEECC
Q ss_conf             00665146201-030235--33677201566123220--473068688123211210057----------7656448725
Q gi|254780781|r  122 YIGPKAVLMPS-FVNMGA--YIGEGSMIDTWSTVGSC--AQIGKNVHISGGVGIGGVLEP----------IQTGPTIIED  186 (285)
Q Consensus       122 ~Ig~g~vimp~-~VniGA--~Ig~gt~I~~~a~IG~~--a~IG~~vhI~~g~~IGGvlep----------~~a~pviIeD  186 (285)
                      .+++++.+.|. +++.|-  +||++++++.++++-.+  ..||+||.|++++.|-..-.|          ..+.|+.|||
T Consensus        57 ~~g~~~~IepPF~cdYG~NI~iG~~~fiN~n~~ilD~~~I~IGd~v~iGPnV~i~t~~Hp~~~~~R~~~~~~~~pi~Ig~  136 (203)
T PRK09527         57 TVGENAWVEPPVYFSYGSNIHIGRNFYANFNLTIVDDYTVTIGDNVLIAPNVTLSVTGHPVHHELRKNGEMYSFPITIGN  136 (203)
T ss_pred             CCCCCCEEECCEEEECCCCEEECCCEEECCCCEEEECCCEEECCCEEECCCCEEECCCCCCCHHHHHCCCCCCCCEEECC
T ss_conf             25999789699787254796977987986883899576379989728869978936989889889733876688859998


Q ss_pred             CCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEE
Q ss_conf             84782185784688845885663004652783368715881464454998789605644556776657764467279896
Q gi|254780781|r  187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKK  266 (285)
Q Consensus       187 ~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~cavi~~~  266 (285)
                      |||||++++|.+||+||++++||||+++++               +||++++++ |.                +|-++|+
T Consensus       137 ~vwIG~~~~I~pGv~IG~~~vigAgsvVtk---------------dip~~~v~~-G~----------------Parvir~  184 (203)
T PRK09527        137 NVWIGSHVVINPGVTIGDNSVIGAGSVVTK---------------DIPPNVVAA-GV----------------PCRVIRE  184 (203)
T ss_pred             EEEECCCCEECCCCEECCCCEECCCCEECC---------------CCCCCCEEE-EE----------------CCEEEEE
T ss_conf             689899999909929999979914988853---------------069982999-62----------------8288986


Q ss_pred             CCHHHHH
Q ss_conf             1202466
Q gi|254780781|r  267 VDEKTRS  273 (285)
Q Consensus       267 ~d~~t~~  273 (285)
                      .+++.+.
T Consensus       185 i~~~d~~  191 (203)
T PRK09527        185 INDRDKQ  191 (203)
T ss_pred             CCHHHHH
T ss_conf             8988878


No 27 
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).
Probab=99.74  E-value=7.7e-18  Score=129.82  Aligned_cols=108  Identities=29%  Similarity=0.421  Sum_probs=77.8

Q ss_pred             CCCCCEEECC-EEECC--CCCCCCCCCCCCCEECCE--EEECCCCEEECCCEECCE---EC-------CCCCCCEEECCC
Q ss_conf             0665146201-03023--533677201566123220--473068688123211210---05-------776564487258
Q gi|254780781|r  123 IGPKAVLMPS-FVNMG--AYIGEGSMIDTWSTVGSC--AQIGKNVHISGGVGIGGV---LE-------PIQTGPTIIEDN  187 (285)
Q Consensus       123 Ig~g~vimp~-~VniG--A~Ig~gt~I~~~a~IG~~--a~IG~~vhI~~g~~IGGv---le-------p~~a~pviIeD~  187 (285)
                      +++++.++|. ++..|  -+||++++|+.++++-.+  ..||+||.|++++.|--.   ++       ...+.|+.||||
T Consensus        45 ~g~~~~I~~pf~~dyG~ni~iG~~~~in~n~~ild~~~I~IG~~v~igp~v~i~t~~H~~d~~~r~~~~~~~~PI~Igd~  124 (169)
T cd03357          45 VGENVYIEPPFHCDYGYNIHIGDNFYANFNCTILDVAPVTIGDNVLIGPNVQIYTAGHPLDPEERNRGLEYAKPITIGDN  124 (169)
T ss_pred             CCCCCEEECCEEEECCCCEEECCEEEECCCCEEEECCCEEECCCEEECCCCEEECCCCCCCHHHHHCCCCCCCCEEECCC
T ss_conf             89995897888983436779888448878848970688799998078798589768999997896346652455698974


Q ss_pred             CEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCC
Q ss_conf             4782185784688845885663004652783368715881464454998
Q gi|254780781|r  188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY  236 (285)
Q Consensus       188 v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~  236 (285)
                      ||||+|++|.+||+||+||+||||+++|+     |++...+..| .|++
T Consensus       125 vWIG~~~~IlpGVtIG~~~vIgAGsVVtk-----dip~~~v~~G-nPAr  167 (169)
T cd03357         125 VWIGGGVIILPGVTIGDNSVIGAGSVVTK-----DIPANVVAAG-NPAR  167 (169)
T ss_pred             CEECCCCEEECCCEECCCCEECCCCEECC-----CCCCCEEEEE-ECCE
T ss_conf             36289978909979999999988987974-----6599919997-5869


No 28 
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain. WcxM is thought to be bifunctional, catalyzing both the isomerization and transacetylation reactions of keto-hexoses. It contains an N-terminal LbH domain responsible for the transacetylation function and a C-terminal isomerase domain. The LbH domain contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), typical of enzymes with acyltransferase activity.
Probab=99.74  E-value=6.8e-18  Score=130.14  Aligned_cols=94  Identities=22%  Similarity=0.290  Sum_probs=68.0

Q ss_pred             CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCE-------ECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEE
Q ss_conf             3533677201566123220473068688123211210-------057765644872584782185784688845885663
Q gi|254780781|r  137 GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGV-------LEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLG  209 (285)
Q Consensus       137 GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGv-------lep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIg  209 (285)
                      ++.||+++.|..++.|++.++||++|.|++++.+...       ..+....+++|+|+||||++|.|.+|++||++|+||
T Consensus        16 ~~~IG~~~~I~~~~~I~~~~~Ig~~~~Ig~~~~~~~~~~~~~~~~~~~~~~~v~Ig~~v~IG~~~~I~~gv~IG~~~~Ig   95 (119)
T cd03358          16 DVKIGDNVKIQSNVSIYEGVTIEDDVFIGPNVVFTNDLYPRSKIYRKWELKGTTVKRGASIGANATILPGVTIGEYALVG   95 (119)
T ss_pred             CCEECCCEEECCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEECCCEEECCCCEEECCEEECCCCEEC
T ss_conf             99999996999986367899984377977886330444667643467632483987883848874778994989998997


Q ss_pred             EEEEECCCCEEEECCCCCEEEEECCCC
Q ss_conf             004652783368715881464454998
Q gi|254780781|r  210 MGVFIGKSTKIIDRNTGEITYGEVPSY  236 (285)
Q Consensus       210 aG~vit~st~i~d~~~~~~~~g~vP~~  236 (285)
                      ||+++++     |++...++.| .||+
T Consensus        96 agSvV~~-----dv~~~~i~~G-~PAk  116 (119)
T cd03358          96 AGAVVTK-----DVPPYALVVG-NPAR  116 (119)
T ss_pred             CCCEECC-----CCCCCCEEEE-ECCE
T ss_conf             7998903-----6599979997-4979


No 29 
>PRK10502 putative colanic acid biosynthesis acetyltransferase WcaF; Provisional
Probab=99.74  E-value=1.2e-17  Score=128.75  Aligned_cols=114  Identities=21%  Similarity=0.348  Sum_probs=78.9

Q ss_pred             CCCEECCCCCCCCCCE-EECCEEECC--CCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCE-E------CCCCCCCE
Q ss_conf             5431035640066514-620103023--533677201566123220473068688123211210-0------57765644
Q gi|254780781|r  113 PGTIVRHSAYIGPKAV-LMPSFVNMG--AYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGV-L------EPIQTGPT  182 (285)
Q Consensus       113 P~a~vr~ga~Ig~g~v-imp~~VniG--A~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGv-l------ep~~a~pv  182 (285)
                      -+|.+.++++|.+++- -+|-.+.+|  ++||+++.|+....    ..||+||.||+++.|... .      -|....|+
T Consensus        51 FGAkIG~~v~I~p~v~I~~PwnL~IGd~~~Ig~~v~i~~~~~----I~IG~~v~Isq~v~l~t~sHd~~~~~~~l~~~pI  126 (179)
T PRK10502         51 FGAKIGKGVVIRPSVRITYPWKLTIGDYAWIGDDVVLYTLGE----ITIGAHCVISQKSYLCTGSHDYSSPHFDLNAAPI  126 (179)
T ss_pred             HCCEECCCCEECCCCEEEECCCEEECCCCEECCCCEEEECCC----CEECCCEEECCCCEEECCCCCCCCCCCCCCCCCC
T ss_conf             488679998899965795043079889657889818984896----1798841277971896388997676667324885


Q ss_pred             EECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCC
Q ss_conf             872584782185784688845885663004652783368715881464454998
Q gi|254780781|r  183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY  236 (285)
Q Consensus       183 iIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~  236 (285)
                      +|||+||||++|.|.+|++||+||+||||+++++     |++.+.++.| .|++
T Consensus       127 ~Igd~~wIga~a~I~pGv~Ig~gavigA~SvV~k-----dv~~~~i~~G-~PA~  174 (179)
T PRK10502        127 VIGEGCWLATDVFVAPGVTIGDGAVVGARSSVFK-----SLPANTVCRG-NPAV  174 (179)
T ss_pred             EECCCEEECCCCEEECCCEECCCCEECCCCEEEE-----ECCCCCEEEE-CCCE
T ss_conf             8589969999969908899999979954998921-----7799969993-1847


No 30 
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional
Probab=99.72  E-value=4.9e-17  Score=124.91  Aligned_cols=103  Identities=23%  Similarity=0.498  Sum_probs=78.7

Q ss_pred             CCCCCCCCCCCCCEEC--CEEEECCCCEEECCCEECC----EE---------------CCCCCCCEEECCCCEEECCCEE
Q ss_conf             5336772015661232--2047306868812321121----00---------------5776564487258478218578
Q gi|254780781|r  138 AYIGEGSMIDTWSTVG--SCAQIGKNVHISGGVGIGG----VL---------------EPIQTGPTIIEDNCFIGARSEI  196 (285)
Q Consensus       138 A~Ig~gt~I~~~a~IG--~~a~IG~~vhI~~g~~IGG----vl---------------ep~~a~pviIeD~v~IGa~s~I  196 (285)
                      -.||+++.|+.++.|.  ....||+||.|++++.|..    ..               .+....||+|||+||||+++.|
T Consensus        66 l~IGdNv~Ig~~~~I~~~~~I~IG~nVlIa~~V~I~d~nH~~~~~~~~~~~~~~~~~~~~~~~~pv~Ig~~~wIg~~~~I  145 (192)
T PRK09677         66 LFFGDNVQVNDYVHIACIESITIGRDTLIASKVFITDHNHGSFKHSDDFSSPNLPPDMRTLESSAVVIGQRVWIGENVTI  145 (192)
T ss_pred             EEECCCCEECCCCEEEECCCEEECCCCEECCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCEECCCCEE
T ss_conf             89999848999858986776798998688798899678887655545434567682126677599898999899999999


Q ss_pred             ECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEECCHHHH
Q ss_conf             4688845885663004652783368715881464454998789605644556776657764467279896120246
Q gi|254780781|r  197 VEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTR  272 (285)
Q Consensus       197 ~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~cavi~~~~d~~t~  272 (285)
                      ++|++||++|+||||+++++               ++|+++++. |.                +|-++|+.|+++.
T Consensus       146 l~Gv~Ig~~~vvgA~SvV~~---------------dvp~~~i~~-G~----------------PAk~Ik~~~~~~~  189 (192)
T PRK09677        146 LPGVSIGNGCIVGANSVVTK---------------SIPENTVIA-GN----------------PAKIIKKYNHETK  189 (192)
T ss_pred             ECCCEECCCCEECCCCEECC---------------CCCCCEEEE-EE----------------CCEEEEECCCCCC
T ss_conf             19969999989916999985---------------859991999-70----------------8388971275223


No 31 
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase. It is a bifunctional bacterial enzyme that catalyzes two consecutive steps in the formation of UDP-N-acetylglucosamine (UDP-GlcNAc), an important precursor in bacterial cell wall formation. The two enzymatic activities, uridyltransferase and acetyltransferase, are carried out by two independent domains. The C-terminal LbH domain possesses the acetyltransferase activity. It catalyzes the CoA-dependent acetylation of GlcN-1-phosphate to GlcNAc-1-phosphate. The LbH domain contains 10 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X. The acetyltransferase active site is located at the interface between two subunits of the active LbH trimer.
Probab=99.71  E-value=5.2e-17  Score=124.76  Aligned_cols=118  Identities=29%  Similarity=0.466  Sum_probs=92.2

Q ss_pred             HCCCCCCCCCEECCCCCCCCCCEEECCEEEC-CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEE
Q ss_conf             2475102543103564006651462010302-353367720156612322047306868812321121005776564487
Q gi|254780781|r  106 KHNFRIIPGTIVRHSAYIGPKAVLMPSFVNM-GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII  184 (285)
Q Consensus       106 ~~g~rv~P~a~vr~ga~Ig~g~vimp~~Vni-GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviI  184 (285)
                      ..+..+.|.+.+|+++.|+.++.+ ++|+.+ .+.+++++++++.+.+| +++||++|.|++++.+.+ +......+++|
T Consensus        71 g~~~~IG~~~~i~~~~~I~~~~~i-G~~v~i~~~~ig~~~~i~h~~~ig-d~~Ig~~v~Ig~~~i~~n-~~g~~~~~t~I  147 (193)
T cd03353          71 GNGATVGPFAHLRPGTVLGEGVHI-GNFVEIKKSTIGEGSKANHLSYLG-DAEIGEGVNIGAGTITCN-YDGVNKHRTVI  147 (193)
T ss_pred             CCCCEECCCEEECCCCEECCEEEE-CCCEEEECCCCCCCCEECCEEECC-CCEECCCCEECCCEEEEC-CCCCCCCCCEE
T ss_conf             765266685076587688751674-253576444336884877244618-856777888866758873-43433562343


Q ss_pred             CCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEEC
Q ss_conf             258478218578468884588566300465278336871588146445499878960
Q gi|254780781|r  185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP  241 (285)
Q Consensus       185 eD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvp  241 (285)
                      ||+|+||++|.|.++++||++++|+||++++|               +||||++|+.
T Consensus       148 Gd~v~IG~~~~i~~~v~IG~~a~Igags~V~k---------------dVpp~~lvvg  189 (193)
T cd03353         148 GDNVFIGSNSQLVAPVTIGDGATIAAGSTITK---------------DVPPGALAIA  189 (193)
T ss_pred             CCCCEECCCCEEECCEEECCCCEECCCCEECC---------------CCCCCCEEEE
T ss_conf             35618988987989839999989986988884---------------2399978996


No 32 
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. Members of this class of enzymes include Enterococcus faecium streptogramin A acetyltransferase and Pseudomonas aeruginosa chloramphenicol acetyltransferase. They contain repeated copies of a six-residue hexapeptide repeat sequence motif (X-[STAV]-X-[LIV]-[GAED]-X) and adopt a left-handed parallel beta helix (LbH) structure. The active enzyme is a trimer with CoA and substrate binding sites at the interface of two separate LbH subunits. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients.
Probab=99.71  E-value=5.2e-17  Score=124.73  Aligned_cols=65  Identities=32%  Similarity=0.590  Sum_probs=52.5

Q ss_pred             CCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCC
Q ss_conf             65644872584782185784688845885663004652783368715881464454998789605644556776657764
Q gi|254780781|r  178 QTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPH  257 (285)
Q Consensus       178 ~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~  257 (285)
                      ...|++|||+||||+||+|++|++||+||+||||++||+               +||||++++  .-             
T Consensus        70 ~~~~i~Ig~~vwIG~n~~Il~GV~IG~gavIgAgSvVtk---------------dvp~~~i~~--G~-------------  119 (145)
T cd03349          70 SKGDVIIGNDVWIGHGATILPGVTIGDGAVIAAGAVVTK---------------DVPPYAIVG--GN-------------  119 (145)
T ss_pred             CCCCEEECCCEEECCCCEEECCCEECCCCEEECCCEECC---------------CCCCCCEEE--EE-------------
T ss_conf             169979889969999888958809678868928978970---------------469994998--33-------------


Q ss_pred             CCCCEEEEEC-CHHHHHH
Q ss_conf             4672798961-2024668
Q gi|254780781|r  258 LYCAVIIKKV-DEKTRSK  274 (285)
Q Consensus       258 ~~cavi~~~~-d~~t~~k  274 (285)
                        +|-++|+| ++.+.++
T Consensus       120 --PAk~ik~Rf~~~~~~~  135 (145)
T cd03349         120 --PAKVIRYRFDEETIER  135 (145)
T ss_pred             --CCEEEECCCCHHHHHH
T ss_conf             --8878815599999999


No 33 
>PRK10092 maltose O-acetyltransferase; Provisional
Probab=99.68  E-value=1.7e-16  Score=121.65  Aligned_cols=78  Identities=26%  Similarity=0.419  Sum_probs=60.8

Q ss_pred             CCCCCCCCCCCCEECCE--EEECCCCEEECCCEECCEECCC----------CCCCEEECCCCEEECCCEEECCEEECCCC
Q ss_conf             33677201566123220--4730686881232112100577----------65644872584782185784688845885
Q gi|254780781|r  139 YIGEGSMIDTWSTVGSC--AQIGKNVHISGGVGIGGVLEPI----------QTGPTIIEDNCFIGARSEIVEGCIIREGS  206 (285)
Q Consensus       139 ~Ig~gt~I~~~a~IG~~--a~IG~~vhI~~g~~IGGvlep~----------~a~pviIeD~v~IGa~s~I~~Gv~Ig~ga  206 (285)
                      +||++++|+.++++-.+  ..||+||.|++++.|--.-.|.          -+.|+.|||+||||++++|.+||+||+||
T Consensus        75 ~iG~~~~iN~~~~ilD~~~I~IG~~v~iGpnv~i~t~~Hp~d~~~R~~~~~~~~pi~Ig~~vwig~~~~i~pGv~IG~~~  154 (183)
T PRK10092         75 FLGNNFYANFDCVMLDVCPIHIGDNCMLAPGVHIYTATHPLDPVARNSGAELGKPVTIGNNVWIGGRAVINPGVTIGDNV  154 (183)
T ss_pred             EECCCEEEECCEEEEECCCEEECCCEEECCCCEEECCCCCCCHHHHHCCCEECCCEEECCCCEECCCCEEECCCEECCCC
T ss_conf             86787699278499947873999980584997898599988988952586316877989986888998990798999998


Q ss_pred             EEEEEEEECC
Q ss_conf             6630046527
Q gi|254780781|r  207 VLGMGVFIGK  216 (285)
Q Consensus       207 vIgaG~vit~  216 (285)
                      +||||+++++
T Consensus       155 vigagsvV~~  164 (183)
T PRK10092        155 VVASGAVVTK  164 (183)
T ss_pred             EECCCCEEEE
T ss_conf             9975988922


No 34 
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine. This reaction represents a key metabolic point of regulation for the cysteine biosynthetic pathway due to its feedback inhibition by cysteine. The enzyme is a 175 kDa homohexamer, composed of a dimer of homotrimers. Each subunit contains an N-terminal alpha helical region and a C-terminal left-handed beta-helix (LbH) subdomain with 5 turns, each containing a hexapeptide repeat motif characteristic of the acyltransferase superfamily of enzymes. The trimer interface mainly involves the C-terminal LbH subdomain while the dimer (of trimers) interface is mediated by the N-terminal alpha helical subdomain.
Probab=99.67  E-value=1.4e-16  Score=122.03  Aligned_cols=90  Identities=32%  Similarity=0.437  Sum_probs=66.5

Q ss_pred             CCCCCCCCCCCC--CCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEE
Q ss_conf             353367720156--612322047306868812321121005776564487258478218578468884588566300465
Q gi|254780781|r  137 GAYIGEGSMIDT--WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFI  214 (285)
Q Consensus       137 GA~Ig~gt~I~~--~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vi  214 (285)
                      +|+||++++|+.  ..+|++++.||++|+|..++.||.........+++|+|+||||+||.|.++++||++|+||||+++
T Consensus         8 ~~~IG~~~~I~~~~~v~Ig~~~~Ig~~~~I~~~~~ig~~~~~~~~~~~~Ig~~v~IG~~~~I~~gv~IG~~~vIgagsvV   87 (101)
T cd03354           8 GAKIGPGLFIDHGTGIVIGETAVIGDNCTIYQGVTLGGKGKGGGKRHPTIGDNVVIGAGAKILGNITIGDNVKIGANAVV   87 (101)
T ss_pred             CCEECCCEEECCCCCEEECCCCEECCCCEECCCCEECCCCCCCCCCCCCCCCCEEECCCCEEECCCEECCCCEECCCCEE
T ss_conf             99999492991998779999989999989988878866311468777614875863589889298799998799879889


Q ss_pred             CCCCEEEECCCCCEEEE
Q ss_conf             27833687158814644
Q gi|254780781|r  215 GKSTKIIDRNTGEITYG  231 (285)
Q Consensus       215 t~st~i~d~~~~~~~~g  231 (285)
                      ++     |++.+.++.|
T Consensus        88 ~~-----dv~~~si~~G   99 (101)
T cd03354          88 TK-----DVPANSTVVG   99 (101)
T ss_pred             CC-----CCCCCCEEEE
T ss_conf             96-----8599989980


No 35 
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism]
Probab=99.66  E-value=2.6e-16  Score=120.42  Aligned_cols=99  Identities=35%  Similarity=0.546  Sum_probs=77.2

Q ss_pred             CCCCCCCCCCCCC--CEECCEEEECCCCEEECCCEECCEE-CCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEE
Q ss_conf             3533677201566--1232204730686881232112100-577656448725847821857846888458856630046
Q gi|254780781|r  137 GAYIGEGSMIDTW--STVGSCAQIGKNVHISGGVGIGGVL-EPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVF  213 (285)
Q Consensus       137 GA~Ig~gt~I~~~--a~IG~~a~IG~~vhI~~g~~IGGvl-ep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~v  213 (285)
                      +|.||.|.|||++  ..||..|.||++|.|..|++|||.- +.....|+ |+|+|+|||++.|+..+.||+++.||||+|
T Consensus        73 ~A~IG~g~fIdHg~GvVIgeta~IGddv~I~~gVTLGgtg~~~g~RhPt-Ig~~V~IGagAkILG~I~IGd~a~IGA~sV  151 (194)
T COG1045          73 GAKIGRGLFIDHGTGVVIGETAVIGDDVTIYHGVTLGGTGKESGKRHPT-IGNGVYIGAGAKILGNIEIGDNAKIGAGSV  151 (194)
T ss_pred             CCEECCCEEECCCCEEEECCEEEECCCEEEEECEEECCCCCCCCCCCCC-CCCCEEECCCCEEECCEEECCCCEECCCCE
T ss_conf             7727785687377558976424987972897061766887877877983-178859899988971668878978887866


Q ss_pred             ECCCCEEEECCCCCEEEEECCCCCEEECC
Q ss_conf             52783368715881464454998789605
Q gi|254780781|r  214 IGKSTKIIDRNTGEITYGEVPSYSVVVPG  242 (285)
Q Consensus       214 it~st~i~d~~~~~~~~g~vP~~~vvvpg  242 (285)
                      +.+     |++.+....| ||++-+.-++
T Consensus       152 Vlk-----dVP~~~tvvG-vPArii~~~~  174 (194)
T COG1045         152 VLK-----DVPPNATVVG-VPARVIGRPG  174 (194)
T ss_pred             ECC-----CCCCCCEEEC-CCCEEECCCC
T ss_conf             815-----7899966866-7646853578


No 36 
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; InterPro: IPR010137   This entry describes LpxA, an enzyme for the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria. Some differences are found between lipid A of different species, but this protein represents the first step (from UDP-N-acetyl-D-glucosamine) and appears to be conserved in function. Proteins from this family contain many copies of the bacterial transferase hexapeptide repeat.; GO: 0008780 acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase activity, 0008610 lipid biosynthetic process.
Probab=99.66  E-value=6e-16  Score=118.22  Aligned_cols=144  Identities=25%  Similarity=0.360  Sum_probs=76.5

Q ss_pred             CCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCC------------
Q ss_conf             25431035640066514620-10302353367720156612322047306868812321121005776------------
Q gi|254780781|r  112 IPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQ------------  178 (285)
Q Consensus       112 ~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~------------  178 (285)
                      .|.|+|.+||.||++|.+-| |+|.-++.||+||.|.+|++|-....||+||.|.++|.||+.   +|            
T Consensus         2 HPTA~ie~gA~iG~~V~iGPf~~v~~~V~ig~g~~l~shV~i~G~T~iG~~~~i~p~A~iG~~---PQdlky~GE~t~l~   78 (257)
T TIGR01852         2 HPTAIIEPGAEIGEDVEIGPFCIVGPGVKIGDGVELKSHVVIEGHTTIGEGTKIFPGAVIGGE---PQDLKYKGERTELI   78 (257)
T ss_pred             CCCEEECCCCEECCCCEEEEEEEECCCCEECCCCEECCCEEEECCEEECCCCEEECCEEECCC---CCCCEECCCCCEEE
T ss_conf             962187886682898578018887897588688587573689677087899888076076798---85650148701799


Q ss_pred             --------------------------------------------------------CCCEEECCCCEEECCCEEECCEEE
Q ss_conf             --------------------------------------------------------564487258478218578468884
Q gi|254780781|r  179 --------------------------------------------------------TGPTIIEDNCFIGARSEIVEGCII  202 (285)
Q Consensus       179 --------------------------------------------------------a~pviIeD~v~IGa~s~I~~Gv~I  202 (285)
                                                                              |+-|.|||.|+||..|-|.+=++|
T Consensus        79 IG~~n~IRE~VTi~~GT~~g~g~T~iG~~nllMAysHvAHDC~vGn~vv~aN~a~LAGHV~vgD~a~iGG~~avHQFvRI  158 (257)
T TIGR01852        79 IGDNNTIREFVTINRGTKSGGGVTSIGNNNLLMAYSHVAHDCVVGNHVVLANNATLAGHVEVGDYAIIGGLVAVHQFVRI  158 (257)
T ss_pred             ECCCCEEEEEEEECCCCCCCCCEEEECCCCEECCCCEEEECCEECCEEEEECCCEECEEEEECCEEEECCCCCEEEEEEE
T ss_conf             88965697557850662588888998887657205356124368881698136312227998889997789721101330


Q ss_pred             CCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCC-CCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHHHHH
Q ss_conf             58856630046527833687158814644549987896056-44556776657764467279896120246688899875
Q gi|254780781|r  203 REGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS-YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLL  281 (285)
Q Consensus       203 g~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~-~~~~~~~~~~~~~~~~cavi~~~~d~~t~~k~~ln~~l  281 (285)
                      |+.|+||+.+-|.+               +||||.++ .|. +..-      .|+|   -+=+||+-=.....+.|..++
T Consensus       159 G~~aMigG~s~v~~---------------DvpPY~~~-~G~~~a~l------~GlN---~vGLrR~Gf~~~~i~~i~~ay  213 (257)
T TIGR01852       159 GRYAMIGGLSAVSK---------------DVPPYGLV-EGNSRAVL------RGLN---IVGLRRRGFDREEITAIKKAY  213 (257)
T ss_pred             HHHHHHHHHCCCCC---------------CCCCCEEE-CCCCCCEE------EEEE---EEEEECCCCCHHHHHHHHHHH
T ss_conf             00232212002467---------------87761786-37875337------8870---132213787989999999998


Q ss_pred             HC
Q ss_conf             11
Q gi|254780781|r  282 RD  283 (285)
Q Consensus       282 R~  283 (285)
                      |.
T Consensus       214 r~  215 (257)
T TIGR01852       214 RL  215 (257)
T ss_pred             HH
T ss_conf             87


No 37 
>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional
Probab=99.66  E-value=3.8e-16  Score=119.47  Aligned_cols=93  Identities=19%  Similarity=0.232  Sum_probs=72.5

Q ss_pred             CCCCCCCCCCCCC--CEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEE
Q ss_conf             3533677201566--12322047306868812321121005776564487258478218578468884588566300465
Q gi|254780781|r  137 GAYIGEGSMIDTW--STVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFI  214 (285)
Q Consensus       137 GA~Ig~gt~I~~~--a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vi  214 (285)
                      +|.||+|-+|+++  ..||..++||+||.|..|++||+.-......|+ |+|||+||+||.|+.+++||++++||||+++
T Consensus        47 ~a~IG~gl~I~H~~GiVIg~~~~IG~n~~I~q~VTiG~~~~~~~~~P~-Ig~~V~Igaga~IlG~i~IG~~~~IGA~svV  125 (146)
T PRK10191         47 AATIGRRFTIHHGYAVVINKNVVAGDDFTIRHGVTIGNRGADNMACPH-IGNGVELGANVIILGDITLGNNVTVGAGSVV  125 (146)
T ss_pred             CCEECCCEEEECCEEEEECCCEEECCCEEEECCEEECCCCCCCCCCCE-ECCCEEEECCCEEECCCEECCCCEECCCCEE
T ss_conf             988789879837825899997198998099488788886787789898-7999599289999648599999999989589


Q ss_pred             CCCCEEEECCCCCEEEEECCCC
Q ss_conf             2783368715881464454998
Q gi|254780781|r  215 GKSTKIIDRNTGEITYGEVPSY  236 (285)
Q Consensus       215 t~st~i~d~~~~~~~~g~vP~~  236 (285)
                      ++     |++.+.+..| +|++
T Consensus       126 ~~-----dvp~~~~v~G-~Par  141 (146)
T PRK10191        126 LD-----SVPDNALVVG-EKAR  141 (146)
T ss_pred             CC-----CCCCCCEEEE-ECCE
T ss_conf             70-----3599999997-6809


No 38 
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity, however, some subfamilies in this hierarchy also show activities related to ion transport or translation initiation. Many are trimeric in their active forms.
Probab=99.65  E-value=3.1e-16  Score=120.01  Aligned_cols=78  Identities=37%  Similarity=0.572  Sum_probs=74.5

Q ss_pred             CCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEEC
Q ss_conf             533677201566123220473068688123211210057765644872584782185784688845885663004652
Q gi|254780781|r  138 AYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIG  215 (285)
Q Consensus       138 A~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit  215 (285)
                      .+||++++|+++++|+..++||++|.|++++.|++...+.+..|++||||||||+||.|.+|++||++++||||+++|
T Consensus         1 V~IG~~~~I~~~~~I~~~v~IG~~~~I~~~~~I~~~~~~~~~~~~~Ig~~v~Ig~~a~I~~gv~IGdn~~IgagavVt   78 (78)
T cd00208           1 VFIGEGVKIHPKAVIRGPVVIGDNVNIGPGAVIGAATGPNEKNPTIIGDNVEIGANAVIHGGVKIGDNAVIGAGAVVT   78 (78)
T ss_pred             CEECCCCEECCCCEECCCEEECCCCEECCCCEEEECCCCCCCCCCEECCCEEECCCCEEECCEEECCCCEECCCCEEC
T ss_conf             999998499998499882699999989999899637988667898999996998689897981999999999885699


No 39 
>PRK11132 cysE serine acetyltransferase; Provisional
Probab=99.65  E-value=3.9e-16  Score=119.40  Aligned_cols=97  Identities=29%  Similarity=0.382  Sum_probs=80.2

Q ss_pred             CCCCCCCCCCC--CCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEE
Q ss_conf             35336772015--6612322047306868812321121005776564487258478218578468884588566300465
Q gi|254780781|r  137 GAYIGEGSMID--TWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFI  214 (285)
Q Consensus       137 GA~Ig~gt~I~--~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vi  214 (285)
                      +|.||.|.|||  ++..||..|.||++|.|..|+++||.-...+..--.|+|+|.|||++.|+.++.||++|.||||+++
T Consensus       147 ~A~iG~gi~iDH~~GvVIGETavigd~vsi~~~VTLGgt~~~~g~RHP~i~~~v~igaga~iLG~i~iG~~a~igA~svV  226 (273)
T PRK11132        147 AAKIGRGIMLDHATGIVVGETAVIENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGAGSVV  226 (273)
T ss_pred             CCEECCCEEEECCCCEEECCEEEECCCEEEECCEEEECCCCCCCCCCCCCCCCEEECCCCEEECCEEECCCCEECCCCEE
T ss_conf             65116856883476358756468668548951235403556688989804888487548889718588999888678668


Q ss_pred             CCCCEEEECCCCCEEEEECCCCCEE
Q ss_conf             2783368715881464454998789
Q gi|254780781|r  215 GKSTKIIDRNTGEITYGEVPSYSVV  239 (285)
Q Consensus       215 t~st~i~d~~~~~~~~g~vP~~~vv  239 (285)
                      .+     |++.+....| ||++-|=
T Consensus       227 l~-----dvp~~~tv~G-vPa~~vg  245 (273)
T PRK11132        227 LQ-----PVPPHTTAAG-VPARIVG  245 (273)
T ss_pred             CC-----CCCCCCEEEC-CCCEEEC
T ss_conf             64-----3799987966-6720308


No 40 
>PRK13627 carnitine operon protein CaiE; Provisional
Probab=99.64  E-value=2.7e-15  Score=114.26  Aligned_cols=124  Identities=23%  Similarity=0.358  Sum_probs=84.2

Q ss_pred             CCHHHCCCCCCCCCCHHHHHHCCCCCCCCCEECCCCCCCCCCEEEC--CEEECCCCCCCCCCCCCCCEE----CCEEEEC
Q ss_conf             2011017753236520234424751025431035640066514620--103023533677201566123----2204730
Q gi|254780781|r   86 STWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMP--SFVNMGAYIGEGSMIDTWSTV----GSCAQIG  159 (285)
Q Consensus        86 ~~~~DKvp~Kf~~~~~~~f~~~g~rv~P~a~vr~ga~Ig~g~vimp--~~VniGA~Ig~gt~I~~~a~I----G~~a~IG  159 (285)
                      ++|-+|.|.=    .+..|-..+..+.=.-.+..+++|.+|++|-+  ..|    .||++|-|..++++    +....||
T Consensus         4 y~f~g~~P~i----~~~afIap~A~viGdV~ig~~~sIw~~aVlRGD~~~I----~IG~~tNIQD~~viH~~~~~~~~IG   75 (196)
T PRK13627          4 YAFEGLIPVV----HPTAFVHPSAVLIGDVIVGAGVYIGPLASLRGDYGRL----IVQAGANLQDGCIMHGYCDTDTIVG   75 (196)
T ss_pred             EECCCCCCCC----CCCEEECCCCEEEEEEEECCCCEECCCEEEECCCCCE----EECCCCEECCCCEEECCCCCCCEEC
T ss_conf             8669958722----9983889999899849999998897770895688717----9899867679837814899985888


Q ss_pred             CCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEE
Q ss_conf             68688123211210057765644872584782185784688845885663004652783368715881464454998789
Q gi|254780781|r  160 KNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVV  239 (285)
Q Consensus       160 ~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vv  239 (285)
                      ++|+|+.++.+-|         ..|+|||+||.||+|.+|+.||++|+|+||+++++.++             +|+++++
T Consensus        76 ~~vtIGH~ailhg---------c~Igd~~lIGmgavVldga~Ig~~~iI~AgslV~~g~~-------------ip~~~L~  133 (196)
T PRK13627         76 ENGHIGHGAILHG---------CVIGRDALVGMNSVIMDGAVIGEESIVAAMSFVKAGFQ-------------GEKRQLL  133 (196)
T ss_pred             CCEEECCCEEEEE---------EEEECCCEECCCCEEECCCEECCCCEECCCCEECCCCC-------------CCCCCEE
T ss_conf             9805878729963---------49948978846979928889999989976864579949-------------3898199


No 41 
>KOG4750 consensus
Probab=99.61  E-value=1e-15  Score=116.87  Aligned_cols=121  Identities=30%  Similarity=0.459  Sum_probs=94.2

Q ss_pred             HHCCCCCCCCCEECCCCCCC--CCCEEECCE-E--ECCCCCCCCCCCC--CCCEECCEEEECCCCEEECCCEECCEECCC
Q ss_conf             42475102543103564006--651462010-3--0235336772015--661232204730686881232112100577
Q gi|254780781|r  105 EKHNFRIIPGTIVRHSAYIG--PKAVLMPSF-V--NMGAYIGEGSMID--TWSTVGSCAQIGKNVHISGGVGIGGVLEPI  177 (285)
Q Consensus       105 ~~~g~rv~P~a~vr~ga~Ig--~g~vimp~~-V--niGA~Ig~gt~I~--~~a~IG~~a~IG~~vhI~~g~~IGGvlep~  177 (285)
                      .-+-.|+.-+......+.++  -++-+.|+| |  .-+|.||+|-+.|  ++..||..|.||++|.|-.++.+||.....
T Consensus       117 A~Qa~RiaH~Lw~~~rk~lal~~q~ris~~~gvdihpaa~ig~gilldhatgvvigeTAvvg~~vSilH~Vtlggtgk~~  196 (269)
T KOG4750         117 ANQAYRIAHNLWTQDRKILALGLQVRISPNFGVDIHPAAKIGKGILLDHATGVVIGETAVVGDNVSILHPVTLGGTGKGS  196 (269)
T ss_pred             HHHHHHHHHHHEECCCEEEEEEECCEECCCCCCCCCCHHHCCCCEEECCCCCEEECCEEEECCCEEEECCEEECCCCCCC
T ss_conf             63687764211553771688764123324202124620102653122133323531024742644664443114654665


Q ss_pred             CCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEE
Q ss_conf             656448725847821857846888458856630046527833687158814644549987896
Q gi|254780781|r  178 QTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV  240 (285)
Q Consensus       178 ~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvv  240 (285)
                      +.+--.|+|||+||++++|+.+|.||+||+|+||+++++               +||++++++
T Consensus       197 gdrhP~Igd~vliGaGvtILgnV~IGegavIaAGsvV~k---------------DVP~~~~Av  244 (269)
T KOG4750         197 GDRHPKIGDNVLIGAGVTILGNVTIGEGAVIAAGSVVLK---------------DVPPNTLAV  244 (269)
T ss_pred             CCCCCCCCCCEEECCCCEEECCEEECCCCEEECCCEEEE---------------CCCCCCEEC
T ss_conf             556885567708755417857816778867730506972---------------169875304


No 42 
>PRK00892 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional
Probab=99.60  E-value=3.4e-15  Score=113.65  Aligned_cols=69  Identities=32%  Similarity=0.466  Sum_probs=52.7

Q ss_pred             CCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             36772015661232204730686881232112100577656448725847821857846888458856630046527
Q gi|254780781|r  140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       140 Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                      ||+||+||..+.|+|+|+||+||.|.+.++|+|        .|.|+|+|+||..+.|.+.++||++++|++.+-+++
T Consensus       226 Ig~~~kidn~vhIaHn~~IG~~~iia~~~giaG--------s~~igd~v~igG~~gi~~h~~Ig~~~~i~~~sgv~~  294 (343)
T PRK00892        226 IGEGVKIDNLVQIAHNVRIGRHCAIAAQVGIAG--------STKIGRYCMIGGQVGIAGHLEIGDGVQITAMSGVMK  294 (343)
T ss_pred             ECCCCEEEEEEEECCCCEECCCCEEEECCEEEE--------EEEECCCEEECCCCCCCCCCEECCCCEEEECCEECC
T ss_conf             898965921117616747878838852114700--------579999149944132348869899979900651436


No 43 
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E. coli wcaF gene and similar proteins. WcaF is part of the gene cluster responsible for the biosynthesis of the extracellular polysaccharide colanic acid. The wcaF protein is predicted to contain a left-handed parallel beta-helix (LbH) domain encoded by imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. Many are trimeric in their active forms.
Probab=99.58  E-value=5.1e-15  Score=112.53  Aligned_cols=93  Identities=28%  Similarity=0.401  Sum_probs=61.3

Q ss_pred             CCCCCCCCCCC--CEECCEEEECCCCEEECCCEE-CCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEEC
Q ss_conf             33677201566--123220473068688123211-210057765644872584782185784688845885663004652
Q gi|254780781|r  139 YIGEGSMIDTW--STVGSCAQIGKNVHISGGVGI-GGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIG  215 (285)
Q Consensus       139 ~Ig~gt~I~~~--a~IG~~a~IG~~vhI~~g~~I-GGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit  215 (285)
                      +||+++.|+..  .+||+.+.|+.+|+|..+.-. .....+..++|++|||+||||++|.|.+|++||++|+||||++++
T Consensus        11 ~Ig~~~~I~~~~~i~IG~~~~i~~~v~I~~~~h~~~~~~~~~~~~~v~Ig~~v~IG~~~~I~~gv~Ig~~svVgagSvV~   90 (107)
T cd05825          11 WIGEGVWIYNLAPVTIGSDACISQGAYLCTGSHDYRSPAFPLITAPIVIGDGAWVAAEAFVGPGVTIGEGAVVGARSVVV   90 (107)
T ss_pred             EECCCCEEEECCCEEECCCCEECCCCEECCCCCCCCCCCCCEECCCEEECCCCEECCCCEEECCCEECCCCEEECCCEEC
T ss_conf             89999899538857999973995995970788887676653163997993885874987896991918997994898890


Q ss_pred             CCCEEEECCCCCEEEEECCCCC
Q ss_conf             7833687158814644549987
Q gi|254780781|r  216 KSTKIIDRNTGEITYGEVPSYS  237 (285)
Q Consensus       216 ~st~i~d~~~~~~~~g~vP~~~  237 (285)
                      +     |++...++.| .||+-
T Consensus        91 k-----dvp~~~i~~G-~PAk~  106 (107)
T cd05825          91 R-----DLPAWTVYAG-NPAVP  106 (107)
T ss_pred             C-----CCCCCCEEEE-ECCEE
T ss_conf             3-----8599979981-47589


No 44 
>TIGR01853 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; InterPro: IPR007691 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase (2.3.1 from EC) catalyses an early step in lipid A biosynthesis : UDP-3-O-(3-hydroxytetradecanoyl)glucosamine + (R)-3-hydroxytetradecanoyl- [acyl carrier protein] = UDP-2,3-bis(3-hydroxytetradecanoyl)glucosamine + [acyl carrier protein]  Members of this family also contain a hexapeptide repeat (IPR001451 from INTERPRO). This entry represents the non-repeating region of LPXD proteins.; GO: 0016747 transferase activity transferring groups other than amino-acyl groups, 0009245 lipid A biosynthetic process.
Probab=99.58  E-value=7.5e-15  Score=111.54  Aligned_cols=132  Identities=23%  Similarity=0.277  Sum_probs=91.6

Q ss_pred             CCCCEEEECCCCCCCHHHCCCCCCCCCCHHHH---HHCCCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCC
Q ss_conf             26744762477642011017753236520234---424751025431035640066514620-10302353367720156
Q gi|254780781|r   73 INPTKIISDGNGYSTWWDKIPAKFDDWKTKDF---EKHNFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDT  148 (285)
Q Consensus        73 i~~~~~i~~g~~~~~~~DKvp~Kf~~~~~~~f---~~~g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~  148 (285)
                      ...+..+=...||+. |-|+-.-|..-+++.+   .++|  +.|.|++.+.|.|+++|.+|| .+|--++.||++|.|.+
T Consensus        66 ~~~~~~L~v~~P~l~-fA~~~~~F~~~~~~~lvaR~~~g--i~p~a~~~~~a~~~~~v~I~pnvvIG~~v~IG~~~~I~p  142 (336)
T TIGR01853        66 PKKCAALVVKDPYLA-FAKVAELFDPPPKRLLVARMEAG--IHPTAVVEPSAKIGEGVTIGPNVVIGAGVEIGENVIIGP  142 (336)
T ss_pred             CCCCCEEEECCCHHH-HHHHHHHHCCCCCCHHHHCCCCC--CCCCCCCCCCCCCCCCCEECCEEEECCCCEECCCCEECC
T ss_conf             232505781781799-99999860887650121101035--676873056531078436875417888868778636357


Q ss_pred             CCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEEC--------------------CEEECCCCEE
Q ss_conf             61232204730686881232112100577656448725847821857846--------------------8884588566
Q gi|254780781|r  149 WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVE--------------------GCIIREGSVL  208 (285)
Q Consensus       149 ~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~--------------------Gv~Ig~gavI  208 (285)
                      +++||++++||++|.|.++|.|-        ..|.|||||.|=++|+|..                    .|+|+++.-|
T Consensus       143 g~~iG~~v~IG~~~~i~~~v~i~--------~~~~lG~nV~I~~GaVIG~DGFGya~~~~g~~~KI~q~G~ViI~D~VEI  214 (336)
T TIGR01853       143 GVVIGDDVVIGDGSVIYPNVVIY--------ERVQLGKNVIIHAGAVIGSDGFGYAHTANGGHVKIPQIGRVIIEDDVEI  214 (336)
T ss_pred             CCEECCCCEECCCCEEECCCEEE--------ECCEECCEEEECCCCEECCCCCCEEECCCCCEEEEEEECEEEEECEEEE
T ss_conf             76876886879967780670897--------2415647158768878867873203578897154413024896023387


Q ss_pred             EEEEEEC
Q ss_conf             3004652
Q gi|254780781|r  209 GMGVFIG  215 (285)
Q Consensus       209 gaG~vit  215 (285)
                      |||+.|=
T Consensus       215 GANTtID  221 (336)
T TIGR01853       215 GANTTID  221 (336)
T ss_pred             CCCCHHH
T ss_conf             4687021


No 45 
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains. Members in this family are predicted to be glucose-1-phosphate thymidylyltransferases, which are involved in the dTDP-L-rhamnose biosynthetic pathway. Glucose-1-phosphate thymidylyltransferase catalyzes the synthesis of deoxy-thymidine di-phosphate (dTDP)-L-rhamnose, an important component of the cell wall of many microorganisms. The C-terminal LbH domain contains multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=99.57  E-value=9.8e-15  Score=110.80  Aligned_cols=74  Identities=23%  Similarity=0.327  Sum_probs=52.9

Q ss_pred             CCCCCCCCCCCEECCEEEECCCCEEECCCEECCEE-C---------------CCCCCCEEECCCCEEECCCEEECCEEEC
Q ss_conf             36772015661232204730686881232112100-5---------------7765644872584782185784688845
Q gi|254780781|r  140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVL-E---------------PIQTGPTIIEDNCFIGARSEIVEGCIIR  203 (285)
Q Consensus       140 Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvl-e---------------p~~a~pviIeD~v~IGa~s~I~~Gv~Ig  203 (285)
                      +++++.+.+.+.++. +.||++|+|++++.+.... +               ..+...++|+|+|.||+|+.|.+|++||
T Consensus        73 i~~~~~i~~~~~ig~-siIG~~v~IGagtvi~n~~~~~~~~~v~~~~~~~~~~~~~~G~vIGd~~~IG~ns~I~~G~~IG  151 (163)
T cd05636          73 IMDGTKVPHLNYVGD-SVLGENVNLGAGTITANLRFDDKPVKVRLKGERVDTGRRKLGAIIGDGVKTGINVSLNPGVKIG  151 (163)
T ss_pred             CCCCCCCCCCCEECC-CEECCCCEECCCEEEECCCCCCCCEEEEECCEEECCCCEECCCEECCCCEECCCCEECCCEEEC
T ss_conf             147843277568777-2992996988983781776788634784077062367704077977997999898986995999


Q ss_pred             CCCEEEEEEEE
Q ss_conf             88566300465
Q gi|254780781|r  204 EGSVLGMGVFI  214 (285)
Q Consensus       204 ~gavIgaG~vi  214 (285)
                      ++|.|+||++|
T Consensus       152 ~~a~IgaGsvV  162 (163)
T cd05636         152 PGSWVYPGCVV  162 (163)
T ss_pred             CCCEECCCCEE
T ss_conf             99899999796


No 46 
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins. MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively while GAT specifically acetylates galactopyranosides. XAT catalyzes the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients. Members of this family contain a a left-handed parallel beta-helix (LbH) domain with at least 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). They are trimeric in their active form.
Probab=99.56  E-value=1.2e-14  Score=110.32  Aligned_cols=103  Identities=28%  Similarity=0.457  Sum_probs=72.3

Q ss_pred             ECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEE-CCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCE
Q ss_conf             035640066514620103023533677201566123-2204730686881232112100577656448725847821857
Q gi|254780781|r  117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTV-GSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSE  195 (285)
Q Consensus       117 vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~I-G~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~  195 (285)
                      +.++++|++++++++.   -+..||++|+|..++.+ ++...++.++++..+..+        .+++.|||+||||++|.
T Consensus         4 IG~~~~Ig~~~~I~~~---~~i~IG~~~~I~~~~~i~~~~~~~~~~~~~~~~~~~--------~~~v~Ig~~v~IG~~~~   72 (109)
T cd04647           4 IGDNVYIGPGCVISAG---GGITIGDNVLIGPNVTIYDHNHDIDDPERPIEQGVT--------SAPIVIGDDVWIGANVV   72 (109)
T ss_pred             ECCCCEECCCCEEECC---CCEEECCCCEECCEEEEEEEEEECCCCCEECCCCCE--------ECCEEEECCCEECCCEE
T ss_conf             9999899999999689---887999984993508983300132887525267637--------18979942357889839


Q ss_pred             EECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCC
Q ss_conf             84688845885663004652783368715881464454998
Q gi|254780781|r  196 IVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY  236 (285)
Q Consensus       196 I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~  236 (285)
                      |.+|++||++|+||||+++++     |.+.+.++.| .||+
T Consensus        73 I~~gv~Ig~~~iIga~SvV~k-----~i~~~~i~~G-~PAk  107 (109)
T cd04647          73 ILPGVTIGDGAVVGAGSVVTK-----DVPPNSIVAG-NPAK  107 (109)
T ss_pred             EEECCEECCCCEECCCCEECC-----CCCCCCEEEE-ECCE
T ss_conf             928513089869937988914-----8399989997-5869


No 47 
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three distinct groups of  carbonic anhydrases - alpha, beta and gamma - which show no significant sequence identity or structural similarity. Gamma CAs are homotrimeric enzymes, with each subunit containing a left-handed parallel beta helix (LbH) structural domain.
Probab=99.56  E-value=1.7e-14  Score=109.41  Aligned_cols=100  Identities=29%  Similarity=0.478  Sum_probs=73.5

Q ss_pred             CCCCCCCCEECCCCCCCCCCEEEC-CEEEC----CCCCCCCCCCCCCCEE----CCEEEECCCCEEECCCEECCEECCCC
Q ss_conf             751025431035640066514620-10302----3533677201566123----22047306868812321121005776
Q gi|254780781|r  108 NFRIIPGTIVRHSAYIGPKAVLMP-SFVNM----GAYIGEGSMIDTWSTV----GSCAQIGKNVHISGGVGIGGVLEPIQ  178 (285)
Q Consensus       108 g~rv~P~a~vr~ga~Ig~g~vimp-~~Vni----GA~Ig~gt~I~~~a~I----G~~a~IG~~vhI~~g~~IGGvlep~~  178 (285)
                      ...+.|+|++--...|++++.+.| +.+..    .-.||++|-|..+++|    ++.+.||++|+|+.++.|.|      
T Consensus         8 ~afIap~A~viGdV~ig~~~sIw~~aviRgD~~~~I~IG~~~nIqD~~viH~~~~~~~~IG~~vtIgh~a~ihG------   81 (167)
T cd00710           8 SAYVHPTAVVIGDVIIGDNVFVGPGASIRADEGTPIIIGANVNIQDGVVIHALEGYSVWIGKNVSIAHGAIVHG------   81 (167)
T ss_pred             CEEECCCCEEEEEEEECCCCEECCCCEEECCCCCCEEECCCCCCCCCEEEECCCCCCEEECCCCEECCCCEECC------
T ss_conf             93989999899708999999998887894788887698887434777078225766749779828989848812------


Q ss_pred             CCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             56448725847821857846888458856630046527
Q gi|254780781|r  179 TGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       179 a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                        |+.|+|+||||.+|+|.. ..||++|+||||+++..
T Consensus        82 --~c~Igd~~~IG~gaiv~~-a~Ig~~~vIgags~V~g  116 (167)
T cd00710          82 --PAYIGDNCFIGFRSVVFN-AKVGDNCVIGHNAVVDG  116 (167)
T ss_pred             --EEEECCCCEECCCCEEEC-CEECCCCEECCCCEEEC
T ss_conf             --049839988988989982-59769989988988847


No 48 
>cd04645 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E. coli paaY protein, and similar proteins. CAs are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three evolutionary distinct groups - alpha, beta and gamma carbonic anhydrases - which show no significant sequence identity or structural similarity. Gamma CAs are trimeric enzymes with left-handed parallel beta helix (LbH) structural domain.
Probab=99.55  E-value=8e-14  Score=105.21  Aligned_cols=134  Identities=29%  Similarity=0.399  Sum_probs=93.0

Q ss_pred             ECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEE---CCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECC
Q ss_conf             035640066514620103023533677201566123---22047306868812321121005776564487258478218
Q gi|254780781|r  117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTV---GSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGAR  193 (285)
Q Consensus       117 vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~I---G~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~  193 (285)
                      +.+.|||.|++++.+     ...||++|+|..+++|   .....||++|.|..++.|..    ....++.|+|+|+||.+
T Consensus         2 I~~~a~I~p~A~I~G-----~V~IG~~~~I~~~~~I~~d~~~i~IG~~~~I~~~~~Ih~----~~~~~~~IG~~v~Ig~~   72 (153)
T cd04645           2 IDPSAFIAPNATVIG-----DVTLGEGSSVWFGAVLRGDVNPIRIGERTNIQDGSVLHV----DPGYPTIIGDNVTVGHG   72 (153)
T ss_pred             CCCCEEECCCCEEEC-----CEEECCCCEECCCCEEECCCCCEEECCCCEECCCCCCCC----CCCCCCEECCCCEECCC
T ss_conf             189819999999977-----269989999965838424666359999989896854352----59999798999899999


Q ss_pred             CEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCC-CCCCCCCCCCCCCCCCCCEEEEECCHHHH
Q ss_conf             57846888458856630046527833687158814644549987896056-44556776657764467279896120246
Q gi|254780781|r  194 SEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS-YPSINLKGDIAGPHLYCAVIIKKVDEKTR  272 (285)
Q Consensus       194 s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~-~~~~~~~~~~~~~~~~cavi~~~~d~~t~  272 (285)
                      +.+ .|++||+++.||+|++|...++|.+-.       -|-++|||.|++ .|.         .++|.-.=.|...+-++
T Consensus        73 ~~i-~g~~Ig~~~~IG~~a~I~~gv~IG~~~-------vIgagsvV~~~~~vp~---------~~v~~G~PAr~ir~~~~  135 (153)
T cd04645          73 AVL-HGCTIGDNCLIGMGAIILDGAVIGKGS-------IVAAGSLVPPGKVIPP---------GSLVAGSPAKVVRELTD  135 (153)
T ss_pred             CEE-ECEEEEEEEEECCCCEECCCCEECCCC-------EECCCCEECCCCEECC---------CCEEEECCCEEECCCCH
T ss_conf             599-241873004770543985699988997-------9944989748979699---------85999628379715999


Q ss_pred             HHHH
Q ss_conf             6888
Q gi|254780781|r  273 SKTS  276 (285)
Q Consensus       273 ~k~~  276 (285)
                      +...
T Consensus       136 ~e~~  139 (153)
T cd04645         136 EEIA  139 (153)
T ss_pred             HHHH
T ss_conf             9999


No 49 
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport. Dynactin is a heterocomplex of at least eight subunits, including a 150,000-MW protein called Glued, the actin-capping protein Arp1, and dynamatin. In vitro binding experiments show that dynactin enhances dynein-dependent motility, possibly through interaction with microtubules and vesicles. Subunit p25 is part of the pointed-end subcomplex in dynactin that also includes p26, p27, and Arp11. This subcomplex interacts with membranous cargoes. p25 and p27 contain imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), indicating a left-handed parallel beta helix (LbH) structural domain. Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=99.53  E-value=1.1e-13  Score=104.29  Aligned_cols=135  Identities=19%  Similarity=0.260  Sum_probs=84.1

Q ss_pred             CCCCCCCCEECC--CCCCCCCCEEEC-CEEEC---CCCCCCCCCCCCCCEEC------------CEEEECCCCEEECCCE
Q ss_conf             751025431035--640066514620-10302---35336772015661232------------2047306868812321
Q gi|254780781|r  108 NFRIIPGTIVRH--SAYIGPKAVLMP-SFVNM---GAYIGEGSMIDTWSTVG------------SCAQIGKNVHISGGVG  169 (285)
Q Consensus       108 g~rv~P~a~vr~--ga~Ig~g~vimp-~~Vni---GA~Ig~gt~I~~~a~IG------------~~a~IG~~vhI~~g~~  169 (285)
                      |.|+--.|++.-  .-.|+.++.++| +.+.-   ...||++|.|..+++|.            +...||++|+|+.++.
T Consensus         7 gn~I~k~a~I~G~~nI~IG~~ssI~~~avirGD~~~I~IG~~~~I~d~~~I~~~~~~~~~~~~~~p~~IGd~v~Ig~~~~   86 (161)
T cd03359           7 GNKVSRKSVICGSQNIVLNGKTIIQSDVIIRGDLATVSIGRYCILSEGCVIRPPFKKFSKGVAFFPLHIGDYVFIGENCV   86 (161)
T ss_pred             CCEECCCCEEECCCCEEECCCCEECCCCEEECCCCCEEECCCCEECCCCEEECCCCCCCCCCCCCCCEECCCEEECCCEE
T ss_conf             99587762997887759999878999968967886549999858889989924644357788887728489879899828


Q ss_pred             ECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCC
Q ss_conf             12100577656448725847821857846888458856630046527833687158814644549987896056445567
Q gi|254780781|r  170 IGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINL  249 (285)
Q Consensus       170 IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~  249 (285)
                      +.+         ..|+++|+||.+|.|.+|+.||++++|++|++|++.+.             ||+++++  +..     
T Consensus        87 i~~---------~~Ig~~v~IG~~~~I~~g~~Ig~~~~I~~gsvV~~~~~-------------ip~~~~~--~G~-----  137 (161)
T cd03359          87 VNA---------AQIGSYVHIGKNCVIGRRCIIKDCVKILDGTVVPPDTV-------------IPPYSVV--SGR-----  137 (161)
T ss_pred             EEC---------CEECCCEEECCCCEECCCCEECCCCEECCCCEECCCCE-------------ECCCCEE--EEC-----
T ss_conf             848---------89667715579819949979999989988989889989-------------8998199--851-----


Q ss_pred             CCCCCCCCCCCCEEEEECCHHHHHHHHHHHHHHC
Q ss_conf             7665776446727989612024668889987511
Q gi|254780781|r  250 KGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD  283 (285)
Q Consensus       250 ~~~~~~~~~~cavi~~~~d~~t~~k~~ln~~lR~  283 (285)
                                +|-+++.+.|+..  ..|.+..++
T Consensus       138 ----------Pak~i~~l~e~~~--~~~~~~~~~  159 (161)
T cd03359         138 ----------PARFIGELPECTQ--ELMEEETKE  159 (161)
T ss_pred             ----------CEEEEEECCHHHH--HHHHHHHHH
T ss_conf             ----------8089576999999--999998986


No 50 
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport. Dynactin is a heterocomplex of at least eight subunits, including a 150,000-MW protein called Glued, the actin-capping protein Arp1, and dynamatin. In vitro binding experiments show that dynactin enhances dynein-dependent motility, possibly through interaction with microtubules and vesicles. Subunit p27 is part of the pointed-end subcomplex in dynactin that also includes p25, p26, and Arp11. This subcomplex interacts with membranous cargoes. p25 and p27 contain the imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), indicating a left-handed parallel beta helix (LbH) structural domain. Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=99.53  E-value=4.3e-14  Score=106.89  Aligned_cols=108  Identities=25%  Similarity=0.377  Sum_probs=78.9

Q ss_pred             CCCCCEECCCCCCCCCCEEEC-CEEECCC---CCCCCCCCCCCCEE----------CCEEEECCCCEEECCCEECCEECC
Q ss_conf             025431035640066514620-1030235---33677201566123----------220473068688123211210057
Q gi|254780781|r  111 IIPGTIVRHSAYIGPKAVLMP-SFVNMGA---YIGEGSMIDTWSTV----------GSCAQIGKNVHISGGVGIGGVLEP  176 (285)
Q Consensus       111 v~P~a~vr~ga~Ig~g~vimp-~~VniGA---~Ig~gt~I~~~a~I----------G~~a~IG~~vhI~~g~~IGGvlep  176 (285)
                      |.|.|.+.-...||+++.+.| +.+....   .||++|.|..+++|          |....||+++++..|+.|-+    
T Consensus         8 I~~~A~iiGdV~IG~~~sI~p~avIrgd~g~I~IG~~~nIqd~~~I~~~~~~~~~~g~~~~IG~~~~i~~g~~ih~----   83 (164)
T cd04646           8 VCQESEIRGDVTIGPGTVVHPRATIIAEAGPIIIGENNIIEEQVTIVNKKPKDPAEPKPMIIGSNNVFEVGCKCEA----   83 (164)
T ss_pred             ECCCCEEEEEEEECCCCEECCCCEEEECCCCEEECCCCEECCCEEEECCCCCCCCCCCCEEECCCCEECCCEEEEC----
T ss_conf             9999999821799999989957599814378898999666698599417877778998879889988867819955----


Q ss_pred             CCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEE
Q ss_conf             7656448725847821857846888458856630046527833687158814644549987896
Q gi|254780781|r  177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV  240 (285)
Q Consensus       177 ~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvv  240 (285)
                           +.|+|||+||.+|.|.+|++||++|+||||+++++.+.             +|+++++.
T Consensus        84 -----~~IG~~~lIg~~a~V~~ga~Ig~~ciIgags~V~~~~~-------------ip~~slv~  129 (164)
T cd04646          84 -----LKIGNNNVFESKSFVGKNVIITDGCIIGAGCKLPSSEI-------------LPENTVIY  129 (164)
T ss_pred             -----CEECCCCEECCCCEECCCCEECCCCEECCCCCCCCCCE-------------ECCCEEEE
T ss_conf             -----59767888968989999989999989998989289979-------------29985997


No 51 
>cd05636 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains. Members in this family are predicted to be glucose-1-phosphate thymidylyltransferases, which are involved in the dTDP-L-rhamnose biosynthetic pathway. Glucose-1-phosphate thymidylyltransferase catalyzes the synthesis of deoxy-thymidine di-phosphate (dTDP)-L-rhamnose, an important component of the cell wall of many microorganisms. The C-terminal LbH domain contains multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=99.52  E-value=7e-14  Score=105.56  Aligned_cols=113  Identities=19%  Similarity=0.380  Sum_probs=78.8

Q ss_pred             CCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECC-EECC-------CCCC
Q ss_conf             1025431035640066514620-10302353367720156612322047306868812321121-0057-------7656
Q gi|254780781|r  110 RIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGG-VLEP-------IQTG  180 (285)
Q Consensus       110 rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGG-vlep-------~~a~  180 (285)
                      .+.|+|+++..++|++++.+.| +++.-+++||++|.|..+|.++..+.||++|.|+.++.|.. ++.+       ...+
T Consensus         7 ~I~p~a~I~~~v~Ig~~a~I~~~a~I~~~v~IG~~~~Ig~~~~I~~~~~IG~~~~IG~~~~I~~~vi~~~~~i~~~~~ig   86 (163)
T cd05636           7 TVEEGVTIKGPVWIGEGAIVRSGAYIEGPVIIGKGCEIGPNAYIRGYTVLGDGCVVGNSVEVKNSIIMDGTKVPHLNYVG   86 (163)
T ss_pred             EECCCCEECCCEEECCCCEECCCCEEECCEEECCCCEEEECCCCCCCEEECCEEEECCCEEECCCCCCCCCCCCCCCEEC
T ss_conf             99999999898199999999999999797599899899364122698586130120551242124014784327756877


Q ss_pred             CEEECCCCEEECCCEEEC------------------------CEEECCCCEEEEEEEECCCCEEEE
Q ss_conf             448725847821857846------------------------888458856630046527833687
Q gi|254780781|r  181 PTIIEDNCFIGARSEIVE------------------------GCIIREGSVLGMGVFIGKSTKIID  222 (285)
Q Consensus       181 pviIeD~v~IGa~s~I~~------------------------Gv~Ig~gavIgaG~vit~st~i~d  222 (285)
                      .++|+++|+||+++.+..                        |+.||+++.||+++++.++++|.+
T Consensus        87 ~siIG~~v~IGagtvi~n~~~~~~~~~v~~~~~~~~~~~~~~G~vIGd~~~IG~ns~I~~G~~IG~  152 (163)
T cd05636          87 DSVLGENVNLGAGTITANLRFDDKPVKVRLKGERVDTGRRKLGAIIGDGVKTGINVSLNPGVKIGP  152 (163)
T ss_pred             CCEECCCCEECCCEEEECCCCCCCCEEEEECCEEECCCCEECCCEECCCCEECCCCEECCCEEECC
T ss_conf             729929969889837817767886347840770623677040779779979998989869959999


No 52 
>cd03352 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc. This constitutes the third step in the lipid A biosynthetic pathway in Gram-negative bacteria. LpxD is a homotrimer, with each subunit consisting of a novel combination of an N-terminal uridine-binding domain, a core lipid-binding left-handed parallel beta helix (LbH) domain, and a C-terminal alpha-helical extension. The LbH domain contains 9 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).
Probab=99.49  E-value=3e-13  Score=101.68  Aligned_cols=130  Identities=26%  Similarity=0.265  Sum_probs=71.7

Q ss_pred             CCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEEC--CEECC-C--------
Q ss_conf             1025431035640066514620-1030235336772015661232204730686881232112--10057-7--------
Q gi|254780781|r  110 RIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIG--GVLEP-I--------  177 (285)
Q Consensus       110 rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IG--Gvlep-~--------  177 (285)
                      ++.+++.+.+.|+|++++.|.+ ++|.-+++|++++.|+..+.|++.+.|+.++.|+.++.|+  -++-. .        
T Consensus         3 ~ig~~v~I~~~avI~~~v~Ig~n~~I~~~~~I~~~v~IG~~~~I~~~~~I~~~~~IG~~~~I~~~~vIg~~~f~~~~~~~   82 (205)
T cd03352           3 KIGENVSIGPNAVIGEGVVIGDGVVIGPGVVIGDGVVIGDDCVIHPNVTIYEGCIIGDRVIIHSGAVIGSDGFGFAPDGG   82 (205)
T ss_pred             EECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEEECCCEECCCCEECCEEEECCCEEECCCCCCCCCCCC
T ss_conf             91999999998799999999999999898899999688988366003447278687544777153486213532314798


Q ss_pred             ------CCCCEEECCCCEEECCCEEEC----------------------------------------CEEECCCCEEEEE
Q ss_conf             ------656448725847821857846----------------------------------------8884588566300
Q gi|254780781|r  178 ------QTGPTIIEDNCFIGARSEIVE----------------------------------------GCIIREGSVLGMG  211 (285)
Q Consensus       178 ------~a~pviIeD~v~IGa~s~I~~----------------------------------------Gv~Ig~gavIgaG  211 (285)
                            +.+.|+|+|+|+||+++.|..                                        .+.||+++.||++
T Consensus        83 ~~~~~~~~g~v~Ig~~v~Ig~~~~I~~g~~~~T~IG~~~~i~~~v~igh~~~iG~~~~i~~~~~~~g~~~Igd~~~iG~~  162 (205)
T cd03352          83 GWVKIPQLGGVIIGDDVEIGANTTIDRGALGDTVIGDGTKIDNLVQIAHNVRIGENCLIAAQVGIAGSTTIGDNVIIGGQ  162 (205)
T ss_pred             CCEECCCCCCEEECCCEEECCCCEECCCCCCCCCCCCCCEECCCCCCCCCCCCCCCEEECCCCCCCCCEEECCCCEECCC
T ss_conf             40451421318984884988862763664267747877686454525564041587075032000265249743539896


Q ss_pred             EEECCCCEEEE---CCCCCEEEEECCCCCEE
Q ss_conf             46527833687---15881464454998789
Q gi|254780781|r  212 VFIGKSTKIID---RNTGEITYGEVPSYSVV  239 (285)
Q Consensus       212 ~vit~st~i~d---~~~~~~~~g~vP~~~vv  239 (285)
                      ++|.+.++|.+   +..|.+...+|||++++
T Consensus       163 s~i~~gv~IG~~a~VgagSvVtkdVp~~~iv  193 (205)
T cd03352         163 VGIAGHLTIGDGVVIGAGSGVTSIVPPGEYV  193 (205)
T ss_pred             CEECCCCEECCCCEECCCCEECCCCCCCCEE
T ss_conf             4882993999998998688796486999699


No 53 
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]
Probab=99.48  E-value=2e-13  Score=102.79  Aligned_cols=106  Identities=30%  Similarity=0.497  Sum_probs=75.9

Q ss_pred             CCCCCCCEE------CCCCCCCCCCEEEC--CEEECCCCCCCCCCCCCCCEE----CCEEEECCCCEEECCCEECCEECC
Q ss_conf             510254310------35640066514620--103023533677201566123----220473068688123211210057
Q gi|254780781|r  109 FRIIPGTIV------RHSAYIGPKAVLMP--SFVNMGAYIGEGSMIDTWSTV----GSCAQIGKNVHISGGVGIGGVLEP  176 (285)
Q Consensus       109 ~rv~P~a~v------r~ga~Ig~g~vimp--~~VniGA~Ig~gt~I~~~a~I----G~~a~IG~~vhI~~g~~IGGvlep  176 (285)
                      .-+.|.|.+      ..+++|.+++++-+  ..+.    ||++|-|..++.+    +.-+.||++|+|+.++.|-|    
T Consensus        18 a~Va~~A~viGdV~Ig~~vsIw~~aVlRgD~~~I~----IG~~tNIQDg~ViH~~~~~p~~IG~~vtIGH~aivHG----   89 (176)
T COG0663          18 AFVAPSATVIGDVRIGAGVSIWPGAVLRGDVEPIR----IGARTNIQDGVVIHADPGYPVTIGDDVTIGHGAVVHG----   89 (176)
T ss_pred             EEECCCCEEEEEEEECCCCEECCCEEEECCCCCEE----ECCCCEECCCEEEECCCCCCEEECCCCEECCCCEEEE----
T ss_conf             28779997998599999978877638974677569----8788560378389527999929779958857658988----


Q ss_pred             CCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEE
Q ss_conf             7656448725847821857846888458856630046527833687158814644549987896
Q gi|254780781|r  177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV  240 (285)
Q Consensus       177 ~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvv  240 (285)
                           ..|||+||||-||+|+.|..||++|+||||+++++++.             +|++++++
T Consensus        90 -----c~Ig~~~lIGmgA~vldga~IG~~~iVgAgalV~~~k~-------------~p~~~L~~  135 (176)
T COG0663          90 -----CTIGDNVLIGMGATVLDGAVIGDGSIVGAGALVTPGKE-------------IPGGSLVV  135 (176)
T ss_pred             -----EEECCCCEEECCCEEECCCEECCCCEECCCCCCCCCCC-------------CCCCEEEE
T ss_conf             -----59878858913866757869889869866870058837-------------79975962


No 54 
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional
Probab=99.43  E-value=9.3e-13  Score=98.71  Aligned_cols=135  Identities=18%  Similarity=0.276  Sum_probs=80.3

Q ss_pred             CCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCC-----CEECCEEEECCCCEEECCCEEC------CEECC
Q ss_conf             51025431035640066514620-103023533677201566-----1232204730686881232112------10057
Q gi|254780781|r  109 FRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTW-----STVGSCAQIGKNVHISGGVGIG------GVLEP  176 (285)
Q Consensus       109 ~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~-----a~IG~~a~IG~~vhI~~g~~IG------Gvlep  176 (285)
                      +.+.|+++++....||+||++.| +++. ++.||++|.|..+     |.||+.|.||.++||-+|+.|+      -..|-
T Consensus       272 v~I~~nvvi~G~v~IG~~v~Ig~g~~I~-ns~Ig~~~~I~~~S~Ie~s~Ig~~~~IGPfA~lRp~t~i~~~~~iGnfvEi  350 (456)
T PRK09451        272 VEIDTNVIIEGNVTLGHRVKIGAGCVLK-NCVIGDDCEISPYSVVEDANLGAACTIGPFARLRPGAELLEGAHVGNFVEM  350 (456)
T ss_pred             EEECCCEEEECCEEECCCEEECCCEEEE-CCEECCCCEEECCEEECCCEECCCCEECCCCCCCCCCEECCCCEEEEEEEE
T ss_conf             0775770884424757975982407985-769846878942256506634367168886434887623678888228998


Q ss_pred             CCC--------------CCEEECCCCEEECCCEEEC-------CEEECCCCEEEEEEEECCCCEEEE---CCCCCEEEEE
Q ss_conf             765--------------6448725847821857846-------888458856630046527833687---1588146445
Q gi|254780781|r  177 IQT--------------GPTIIEDNCFIGARSEIVE-------GCIIREGSVLGMGVFIGKSTKIID---RNTGEITYGE  232 (285)
Q Consensus       177 ~~a--------------~pviIeD~v~IGa~s~I~~-------Gv~Ig~gavIgaG~vit~st~i~d---~~~~~~~~g~  232 (285)
                      -++              +..+|+.+|=|||++....       ++.||+++.||.++.+-+.++|.|   +.+|.+...+
T Consensus       351 K~s~i~~g~k~~HlsYiGDa~iG~~~NiGAGtit~NyDG~~K~~t~igd~~fiGsn~~lvapv~iG~~a~i~aGs~it~d  430 (456)
T PRK09451        351 KKARLGKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVGKGATIGAGTTVTRD  430 (456)
T ss_pred             ECCEECCCCEECCEEEECCCEECCCCEECCCEEEEECCCCCCCCCEECCCCEECCCCEEECCEEECCCCEECCCCEECCC
T ss_conf             24597589770423366144765886888876997224876656487898299878448358498899799989878850


Q ss_pred             CCCCCEEECCCC
Q ss_conf             499878960564
Q gi|254780781|r  233 VPSYSVVVPGSY  244 (285)
Q Consensus       233 vP~~~vvvpg~~  244 (285)
                      ||+.++++.-++
T Consensus       431 Vp~~~l~i~r~~  442 (456)
T PRK09451        431 VAENELVISRVP  442 (456)
T ss_pred             CCCCCEEECCCC
T ss_conf             699977770466


No 55 
>cd03350 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA. It is the committed step in the succinylase pathway by which bacteria synthesize L-lysine and meso-diaminopimelate, a component of peptidoglycan. The enzyme is homotrimeric and each subunit contains an N-terminal region with alpha helices and hairpin loops, as well as a C-terminal region with a left-handed parallel alpha-helix (LbH) structural motif encoded by hexapeptide repeat motifs.
Probab=99.42  E-value=6.8e-13  Score=99.55  Aligned_cols=100  Identities=19%  Similarity=0.251  Sum_probs=82.5

Q ss_pred             CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEEC--------CEEEC
Q ss_conf             1030235336772015661232204730686881232112100577656448725847821857846--------88845
Q gi|254780781|r  132 SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVE--------GCIIR  203 (285)
Q Consensus       132 ~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~--------Gv~Ig  203 (285)
                      ++|.-+|+||+||.|..++.|+..+.||++|.|..++.|+.        .+.|++||+|++++.+..        .++|+
T Consensus         8 A~I~~ga~IG~g~vI~~~a~I~~g~~IG~~~~I~~~~~Ig~--------~~~IG~~v~I~~g~~i~g~~~p~~~~~v~Ie   79 (139)
T cd03350           8 AIIRDGAFIGPGAVLMMPSYVNIGAYVDEGTMVDSWATVGS--------CAQIGKNVHLSAGAVIGGVLEPLQATPVIIE   79 (139)
T ss_pred             CEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECC--------CCEECCCCEECCCCEECCCCCCCCCCCCEEC
T ss_conf             29889999999989988999843989898727866660268--------6699993289888678444257646886887


Q ss_pred             CCCEEEEEEEECCCCEEEE---CCCCCEEEEECCCCCEE
Q ss_conf             8856630046527833687---15881464454998789
Q gi|254780781|r  204 EGSVLGMGVFIGKSTKIID---RNTGEITYGEVPSYSVV  239 (285)
Q Consensus       204 ~gavIgaG~vit~st~i~d---~~~~~~~~g~vP~~~vv  239 (285)
                      +++.||+|++|.+.+.|..   +..|.+..-++|+|.++
T Consensus        80 D~~~IGa~a~V~~Gv~IG~~avIGAGsVVtkdvp~y~~~  118 (139)
T cd03350          80 DDVFIGANCEVVEGVIVGKGAVLAAGVVLTQSTPIYDRE  118 (139)
T ss_pred             CCEEEEECCEEECCCEECCCCEECCCCEEECCCCCEEEE
T ss_conf             995993099894687999998999798891898846823


No 56 
>TIGR03570 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family. These proteins contain repeats of the bacterial transferase hexapeptide (pfam00132), although often these do not register above the trusted cutoff.
Probab=99.42  E-value=6.8e-13  Score=99.55  Aligned_cols=101  Identities=29%  Similarity=0.420  Sum_probs=85.9

Q ss_pred             CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEE
Q ss_conf             10302353367720156612322047306868812321121005776564487258478218578468884588566300
Q gi|254780781|r  132 SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMG  211 (285)
Q Consensus       132 ~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG  211 (285)
                      ++|.-.+.||+|++|..+++|++.++||++|+|..++.||        +.+.|+|+|+|++++.+..+++||+++.||+|
T Consensus        94 a~i~~~~~ig~G~~I~~~~~i~~~~~IG~~~~i~~~~~I~--------Hd~~ig~~~~i~~~~~i~G~v~Ig~~~~iG~~  165 (201)
T TIGR03570        94 AIVSPSASIGEGTVIMAGAVINPDVRIGDNVIINTGAIVE--------HDCVIGDYVHIAPGVTLSGGVVIGEGVFIGAG  165 (201)
T ss_pred             CEECCCCEECCCCEEECCCEECCCCEEEEEEEECCCCCCC--------CCCEECCCCEECCCCEECCCCEECCCCEECCC
T ss_conf             0988986787998996286987664780267980423214--------42547787689998599898879777359898


Q ss_pred             EEECCCCEEEE---CCCCCEEEEECCCCCEEE
Q ss_conf             46527833687---158814644549987896
Q gi|254780781|r  212 VFIGKSTKIID---RNTGEITYGEVPSYSVVV  240 (285)
Q Consensus       212 ~vit~st~i~d---~~~~~~~~g~vP~~~vvv  240 (285)
                      +.+.+.++|.+   +-.|.+..-.+|+.++++
T Consensus       166 ~~i~~~i~Ig~~~~Igags~V~~~v~~~~~~~  197 (201)
T TIGR03570       166 ATIIQGVTIGAGAIVGAGAVVTKDIPDGGVVV  197 (201)
T ss_pred             CEECCCCEECCCCEECCCCEEECCCCCCCEEE
T ss_conf             89889989999999997988904379997999


No 57 
>COG1044 LpxD UDP-3-O-[3-hydroxymyristoyl]
Probab=99.41  E-value=9.1e-13  Score=98.76  Aligned_cols=131  Identities=22%  Similarity=0.366  Sum_probs=80.0

Q ss_pred             ECCCCEEEECCCCCCCHHHCCCCCCCCCCHHHHHHCCCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCC
Q ss_conf             426744762477642011017753236520234424751025431035640066514620-1030235336772015661
Q gi|254780781|r   72 QINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWS  150 (285)
Q Consensus        72 ri~~~~~i~~g~~~~~~~DKvp~Kf~~~~~~~f~~~g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a  150 (285)
                      ..+.+.++.. .||+. |-|+--.|.    +.|. .-..+.|.|++.++|.+++++.++| .+|..++.||+++.|..+|
T Consensus        70 ~~~~~~Lv~~-~P~~~-fA~~~~~f~----~~~~-~~~~I~~~A~i~p~A~i~~~~~ig~~vvI~~~v~IG~~~~I~~~a  142 (338)
T COG1044          70 PAKKNALVVK-DPYLA-FAKVAQLFY----RPFN-PAAGIHPTAVIDPTATIGKNVSIGPNVVIGAGVVIGENVVIGAGA  142 (338)
T ss_pred             CCCCEEEEEC-CCHHH-HHHHHHHHC----CCCC-CCCCCCCCCCCCCCCCCCCCCCCCCCEEECCCCEECCCCEECCCC
T ss_conf             6687089948-80678-999998851----4776-535547655317767037787328874988897878985898897


Q ss_pred             EECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEEC-------------------CEEECCCCEEEEE
Q ss_conf             232204730686881232112100577656448725847821857846-------------------8884588566300
Q gi|254780781|r  151 TVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVE-------------------GCIIREGSVLGMG  211 (285)
Q Consensus       151 ~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~-------------------Gv~Ig~gavIgaG  211 (285)
                      .||..++||++|.|.+++.|.-        .+.|+++|.|++++.|.+                   .|+||++.-|||+
T Consensus       143 vIg~~~~IG~~~~i~~~v~I~~--------~~~IG~~v~I~~GavIG~dgFg~a~~~~g~~Ki~q~g~V~Igd~VeIGan  214 (338)
T COG1044         143 VIGENVKIGDGTVIHPNVTIYH--------NVVIGNNVIIHSGAVIGADGFGYAGTAIGWVKIPQIGRVIIGDDVEIGAN  214 (338)
T ss_pred             EECCCCEECCCCEECCCCEEEC--------CCEECCCEEECCCCEECCCCCCCCCCCCCCEECCEECEEEECCCEEECCC
T ss_conf             8888968888858847878952--------75787822888998875685212246688567126065997982487355


Q ss_pred             EEECCC
Q ss_conf             465278
Q gi|254780781|r  212 VFIGKS  217 (285)
Q Consensus       212 ~vit~s  217 (285)
                      +.|.++
T Consensus       215 T~Idrg  220 (338)
T COG1044         215 TTIDRG  220 (338)
T ss_pred             CEECCC
T ss_conf             242565


No 58 
>cd03360 LbH_AT_putative Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain. The alignment contains 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. A few members are identified as NeuD, a sialic acid (Sia) O-acetyltransferase that is required for Sia synthesis and surface polysaccharide sialylation.
Probab=99.40  E-value=5.1e-13  Score=100.32  Aligned_cols=100  Identities=34%  Similarity=0.443  Sum_probs=85.9

Q ss_pred             EEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEE
Q ss_conf             03023533677201566123220473068688123211210057765644872584782185784688845885663004
Q gi|254780781|r  133 FVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGV  212 (285)
Q Consensus       133 ~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~  212 (285)
                      ++.-.+.+|+|++|..+++|+++++||++|+|..++.|+        +.+.|+|+|+|++++.+..+++||+++.||+|+
T Consensus        92 ~i~~~~~ig~G~~I~~~~~i~~~~~IG~~~~i~~~~~i~--------Hd~~ig~~~~i~~~~~i~g~v~Ig~~~~iG~~~  163 (197)
T cd03360          92 VVSPSAVIGEGCVIMAGAVINPDARIGDNVIINTGAVIG--------HDCVIGDFVHIAPGVVLSGGVTIGEGAFIGAGA  163 (197)
T ss_pred             EECCCCEECCCCEEECCCEECCCCCCCCEEEECCCHHCC--------CCCCCCCCCEECCCEEECCCEEEEEECCCCCCC
T ss_conf             987774799942993175986565304368987700105--------315013101066723677830891216298998


Q ss_pred             EECCCCEEEE---CCCCCEEEEECCCCCEEE
Q ss_conf             6527833687---158814644549987896
Q gi|254780781|r  213 FIGKSTKIID---RNTGEITYGEVPSYSVVV  240 (285)
Q Consensus       213 vit~st~i~d---~~~~~~~~g~vP~~~vvv  240 (285)
                      +|.+.++|.+   +-.|.+..-.||+.++++
T Consensus       164 ~i~~~i~Ig~~~~igags~v~~~i~~~~~~~  194 (197)
T cd03360         164 TIIQGVTIGAGAIIGAGAVVTKDVPDGSVVV  194 (197)
T ss_pred             EECCCCEECCCCEECCCCEEEEECCCCEEEE
T ss_conf             9879989999999997998912569990999


No 59 
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only]
Probab=99.38  E-value=2.2e-12  Score=96.46  Aligned_cols=74  Identities=35%  Similarity=0.653  Sum_probs=52.6

Q ss_pred             EECCEEEECCCCEEECCCEECCEE-C----CCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCC
Q ss_conf             232204730686881232112100-5----77656448725847821857846888458856630046527833687158
Q gi|254780781|r  151 TVGSCAQIGKNVHISGGVGIGGVL-E----PIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNT  225 (285)
Q Consensus       151 ~IG~~a~IG~~vhI~~g~~IGGvl-e----p~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~  225 (285)
                      ++|..+.++.+|+|....-.+... .    ...++|++|+++||||+++.|.+|++||+||+||||+++|+         
T Consensus        89 ~ig~~~~i~~~v~i~~~~h~~~~~~~~~~~~~~~~~v~IG~~vwIG~~a~IlpGV~IG~gavigagsVVtk---------  159 (190)
T COG0110          89 TIGDNVVVGPNVTIYTNSHPGDFVTANIGALVGAGPVTIGEDVWIGAGAVILPGVTIGEGAVIGAGSVVTK---------  159 (190)
T ss_pred             EECCCCEECCCEEECCCCCCCCCCCCCCCCCCCCCCCEECCCCEECCCCEECCCEEECCCEEEECCEEEEC---------
T ss_conf             88998589599498268765652200014323578978899858778978979859899819978858957---------


Q ss_pred             CCEEEEECCCCCEE
Q ss_conf             81464454998789
Q gi|254780781|r  226 GEITYGEVPSYSVV  239 (285)
Q Consensus       226 ~~~~~g~vP~~~vv  239 (285)
                            ++|+++++
T Consensus       160 ------dvp~~~iv  167 (190)
T COG0110         160 ------DVPPYGIV  167 (190)
T ss_pred             ------CCCCCEEE
T ss_conf             ------77998289


No 60 
>COG1043 LpxA Acyl-[acyl carrier protein]
Probab=99.34  E-value=1e-11  Score=92.36  Aligned_cols=112  Identities=26%  Similarity=0.372  Sum_probs=66.0

Q ss_pred             CCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEE-------C-------
Q ss_conf             025431035640066514620-1030235336772015661232204730686881232112100-------5-------
Q gi|254780781|r  111 IIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVL-------E-------  175 (285)
Q Consensus       111 v~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvl-------e-------  175 (285)
                      +.|.|+|.+||.|+++|.+-| ++|.-.+.|++||.+.+|++|.....||+++.|.+.+.||+.-       |       
T Consensus         6 IHPTAiIe~gA~ig~~V~IGpf~iIg~~V~ig~~t~l~shvvv~G~T~IG~~n~I~~~A~iG~~pQdlKykge~T~l~IG   85 (260)
T COG1043           6 IHPTAIIEPGAEIGEDVKIGPFCIIGPNVEIGDGTVLKSHVVVEGHTTIGRNNRIFPFASIGEDPQDLKYKGEPTRLIIG   85 (260)
T ss_pred             CCCCEEECCCCCCCCCCEECCEEEECCCCEECCCCEECCCEEEECCCEECCCCEEECCCCCCCCCCCCCCCCCCEEEEEC
T ss_conf             57621527878828998888337988971988995883437996770777898791110428987545027984279988


Q ss_pred             ---------------CCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEE
Q ss_conf             ---------------77656448725847821857846888458856630046527833687
Q gi|254780781|r  176 ---------------PIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIID  222 (285)
Q Consensus       176 ---------------p~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d  222 (285)
                                     -.+-+-|+|+||+++=+.+.|...+.||.++++..++.|..-+.|.|
T Consensus        86 ~~n~IRE~vTi~~GT~~g~g~T~IGdnnl~May~HVAHDC~iGn~~ilaNnatLAGHV~igD  147 (260)
T COG1043          86 DNNTIREFVTIHRGTVQGGGVTRIGDNNLIMAYAHVAHDCVIGNNCILANNATLAGHVEVGD  147 (260)
T ss_pred             CCCEEEEEEEEECCCCCCCEEEEECCCCEEEEEEEEECCCEECCCEEEECCCEEECEEEECC
T ss_conf             99758668898615447861599778878987310313444567179966866854078877


No 61 
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882    N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2.7.7.23 from EC) is a trimeric bifunctional enzyme that catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-GlcNAc.    The X-ray crystal structure of Escherichia coli GlmU in complex with UDP-GlcNAc and CoA has been determined to 2.1 A resolution and reveals a two-domain architecture that is responsible for these two reactions . The C-terminal domain is responsible for the CoA-dependent acetylation of Glc-1-PO(4) to GlcNAc-1-PO(4) and displays the longest left-handed parallel beta-helix observed to date. The acetyltransferase active site defined by the binding site for CoA makes use of residues from all three subunits and is positioned beneath an open cavity large enough to accommodate the Glc-1-PO(4) acetyl acceptor. The N-terminal domain catalyzes uridyl transfer from UTP to GlcNAc-1-PO(4) to form the final products UDP-GlcNAc and pyrophosphate. This domain is composed of a central seven-stranded beta-sheet surrounded by six alpha-helices in a Rossmann fold-like topology. ; GO: 0003977 UDP-N-acetylglucosamine diphosphorylase activity, 0009103 lipopolysaccharide biosynthetic process.
Probab=99.33  E-value=4.9e-12  Score=94.30  Aligned_cols=209  Identities=23%  Similarity=0.312  Sum_probs=109.6

Q ss_pred             CCCHHHHHHHHHHHHHHH-CC-CEEEEEECCCCC-EEEEHHHHHHHHHEE---ECCCCEEEECC----CCCCCHHHC-CC
Q ss_conf             441789999999999730-79-379988759996-886078862322206---42674476247----764201101-77
Q gi|254780781|r   25 SIPQDVKDAVQSTLDLLD-RG-IIRIASRDDNGH-WNTHQWIKKAILLSF---QINPTKIISDG----NGYSTWWDK-IP   93 (285)
Q Consensus        25 ~~~~~~~~aI~~~I~~LD-~G-~iRVAEk~~nG~-W~VNeWvKKAILL~F---ri~~~~~i~~g----~~~~~~~DK-vp   93 (285)
                      |..+|.-  .-++|+++. .| +++.+...|.-+ ==||.-+..|-|-.|   |+.+ +.|..|    .|-.+|.+. |-
T Consensus       197 NaqgEYY--LTD~ia~a~~~g~~v~~~~~~d~~E~~GvNdR~qLa~lE~~~q~r~~~-~l~~~GVt~~dP~~~~i~~~v~  273 (461)
T TIGR01173       197 NAQGEYY--LTDVIALAVADGEEVRAVQVDDSEEVLGVNDRLQLAQLERILQRRIAK-KLLLQGVTLIDPARTDIRGTVE  273 (461)
T ss_pred             CCCCCCC--HHHHHHHHHCCCCEEEEEEECCHHHHCCCCCHHHHHHHHHHHHHHHHH-HHHHCCCEEECCCEEEECCCEE
T ss_conf             0444314--789999985089478999808759833667988999999999999999-8985892998683378735479


Q ss_pred             CCCCCCCHHHH-HHCCCCCCCCCEECCCCCCCCCCEEECCEEEC-----------CCCCCCCCCCCCCCEECCEEEECCC
Q ss_conf             53236520234-42475102543103564006651462010302-----------3533677201566123220473068
Q gi|254780781|r   94 AKFDDWKTKDF-EKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNM-----------GAYIGEGSMIDTWSTVGSCAQIGKN  161 (285)
Q Consensus        94 ~Kf~~~~~~~f-~~~g~rv~P~a~vr~ga~Ig~g~vimp~~Vni-----------GA~Ig~gt~I~~~a~IG~~a~IG~~  161 (285)
                      ..      .|- -+-++++.....+..++.|||+++|+.|.|.-           ++.|+++|-|+..|++-..+.|+++
T Consensus       274 ~G------~Dv~I~~~v~leG~v~iG~~v~IGp~~~I~ns~I~~~~~I~~~s~~e~~~ig~~~~vGPFArLRP~~~L~~~  347 (461)
T TIGR01173       274 IG------QDVVIDPNVILEGKVQIGDDVVIGPGCVIKNSVIGSNAVIKPYSVLEGSEIGEGCDVGPFARLRPGSVLGAG  347 (461)
T ss_pred             EC------CEEEECCCCEECCEEEECCCEEECCCCEEEEEEECCCCEEEEEEECCCCEECCCCEECCCCCCCCCCHHHCC
T ss_conf             87------716975583883407987870788985899728868855888884146786156402773001864321177


Q ss_pred             CEEECCC-----EECC-E----ECCCCCCCEEECCCCEEECCCEEEC--C-----EEECCCCEEEEEEEECCCCEEEE--
Q ss_conf             6881232-----1121-0----0577656448725847821857846--8-----88458856630046527833687--
Q gi|254780781|r  162 VHISGGV-----GIGG-V----LEPIQTGPTIIEDNCFIGARSEIVE--G-----CIIREGSVLGMGVFIGKSTKIID--  222 (285)
Q Consensus       162 vhI~~g~-----~IGG-v----lep~~a~pviIeD~v~IGa~s~I~~--G-----v~Ig~gavIgaG~vit~st~i~d--  222 (285)
                      |||+.-|     .||. +    |.=  .+..-||.+|=|||+++.+.  |     ++||+++.||+++.+=+=++|.|  
T Consensus       348 ~hiGNFVE~Kna~iG~gsKA~HLsY--lGDAeiG~~vNiGAGtITcNYDG~nK~~T~IGd~VFiGSnt~LVAPV~iG~gA  425 (461)
T TIGR01173       348 VHIGNFVEVKNARIGEGSKAGHLSY--LGDAEIGSNVNIGAGTITCNYDGVNKHKTIIGDGVFIGSNTQLVAPVKIGDGA  425 (461)
T ss_pred             CEEEEEEEEECCEECCCCCCCCCCE--EEEEEECCCCEECCEEEEEECCCCCCCCCEECCCCEECCCCEEECCEEECCCC
T ss_conf             8160258652476188644231433--32025079600323168993279622034864887877676045543943811


Q ss_pred             -CCCCCEEEEECCCCCEEECCCC
Q ss_conf             -1588146445499878960564
Q gi|254780781|r  223 -RNTGEITYGEVPSYSVVVPGSY  244 (285)
Q Consensus       223 -~~~~~~~~g~vP~~~vvvpg~~  244 (285)
                       ...|.+..-+||+++.++.-++
T Consensus       426 ~iaAGstvt~DVp~g~La~~R~~  448 (461)
T TIGR01173       426 TIAAGSTVTKDVPEGALAIARAR  448 (461)
T ss_pred             EECCCCEEECCCCCCCCEEECCC
T ss_conf             87124148023488852662455


No 62 
>TIGR03532 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase. Alternate name: tetrahydrodipicolinate N-acetyltransferase. Note that IUBMB lists this alternate name as the accepted name. Unfortunately, the related succinyl transferase acting on the same substrate (EC:2.3.1.117, TIGR00695) uses the opposite standard. We have decided to give these two enzymes names which more clearly indicated that they act on the same substrate.
Probab=99.30  E-value=1.2e-11  Score=91.93  Aligned_cols=141  Identities=23%  Similarity=0.315  Sum_probs=99.5

Q ss_pred             CC-CCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEE
Q ss_conf             25-43103564006651462010302353367720156612322047306868812321121005776564487258478
Q gi|254780781|r  112 IP-GTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI  190 (285)
Q Consensus       112 ~P-~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~I  190 (285)
                      +| --.-...|.|.||+++     .-.++||+++.|.++|.|+.+|.||+++.|..++.+|+        ...|+++|+|
T Consensus        77 ipl~d~~~~~aRIepgaii-----r~~v~IG~~aVImmga~INiGA~IGegtmId~~Avvg~--------~a~IGk~~Hi  143 (231)
T TIGR03532        77 IPLLDLKNINARIEPGAII-----RDQVIIGDNAVIMMGAVINIGAEIGEGTMIDMNAVLGG--------RATVGKNVHI  143 (231)
T ss_pred             CCCCCCCCCCCEECCCCEE-----ECCEEECCCEEEECCCEEECCCEECCCCEECCCCEECC--------CCEECCCCEE
T ss_conf             6302201478357788588-----42529879839913888704859878945805856445--------4688797058


Q ss_pred             ECCCEEEC--------CEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             21857846--------8884588566300465278336871588146445499878960564455677665776446727
Q gi|254780781|r  191 GARSEIVE--------GCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAV  262 (285)
Q Consensus       191 Ga~s~I~~--------Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~cav  262 (285)
                      |+++.+..        +|+|++++.||++++|..++.|.             .+||+-+|+...++-+.    .+++.-.
T Consensus       144 saGa~laGVleP~~a~PViIeDnV~IGAnAvIl~GV~IG-------------~gsVIgAGsVVtkdVP~----~sVVaG~  206 (231)
T TIGR03532       144 GAGAVLAGVIEPPSAKPVVIEDNVLIGANAVILEGVRVG-------------KGAVVAAGAIVTEDVPP----NTVVAGV  206 (231)
T ss_pred             CCCCEEECCCCCCCCCCEEECCCEEECCCCEECCCCEEC-------------CCCEECCCCEECCCCCC----CCEEEEC
T ss_conf             898643002257667997987885987997991998999-------------99999849889565799----9799854


Q ss_pred             EEEECCHHHHHHHHHHHHHHC
Q ss_conf             989612024668889987511
Q gi|254780781|r  263 IIKKVDEKTRSKTSINTLLRD  283 (285)
Q Consensus       263 i~~~~d~~t~~k~~ln~~lR~  283 (285)
                      =. |.=.+-|+||.--+.|-|
T Consensus       207 PA-KIIK~vDekT~~Kt~~~~  226 (231)
T TIGR03532       207 PA-KVIKQVDEKTKDKTELED  226 (231)
T ss_pred             CE-EEEEECCHHHHHHHHHHH
T ss_conf             81-999855701445667999


No 63 
>cd04650 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an outer membrane protein which plays a role in iron acquisition. It binds iron when it is complexed with pyochelin. It adopts the left-handed parallel beta-helix (LbH) structure, and contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. Acyltransferase activity has not been observed in this group.
Probab=99.29  E-value=1.6e-11  Score=91.10  Aligned_cols=110  Identities=25%  Similarity=0.371  Sum_probs=73.9

Q ss_pred             ECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEEC---CEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECC
Q ss_conf             0356400665146201030235336772015661232---2047306868812321121005776564487258478218
Q gi|254780781|r  117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVG---SCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGAR  193 (285)
Q Consensus       117 vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG---~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~  193 (285)
                      +.+.|||.|.+++.+     ...||++|.|..+|.+-   ....||++|+|..++.|-.    ....|+.|+|+|+||.+
T Consensus         3 I~~~~~I~p~a~i~G-----~v~IG~~~~I~~~~~Ir~d~~~i~IG~~~~I~~n~~I~~----~~~~~~~ig~~v~ig~~   73 (154)
T cd04650           3 ISPKAYVHPTSYVIG-----DVVIGELTSVWHYAVIRGDNDSIYIGKYSNVQENVSIHT----DHGYPTEIGDYVTIGHN   73 (154)
T ss_pred             CCCCEEECCCCEEEC-----EEEECCCCEECCCCEEECCCCCEEECCCEEECCCCEEEE----CCCCCCEECCCCEECCC
T ss_conf             699879999999976-----059999999987538955887659999339899988984----69998687997688995


Q ss_pred             CEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCC
Q ss_conf             57846888458856630046527833687158814644549987896056
Q gi|254780781|r  194 SEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS  243 (285)
Q Consensus       194 s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~  243 (285)
                      +.+. |++||+++.||+|++|..+..|.|-.       .|-++|||.||.
T Consensus        74 ~~i~-g~~Ig~~v~IG~~a~I~~Gv~IG~~s-------vIgaGsVV~~~~  115 (154)
T cd04650          74 AVVH-GAKVGNYVIVGMGAILLNGAKIGDHV-------IIGAGAVVTPGK  115 (154)
T ss_pred             EEEE-CCEECCEEEECCCEEEECCCEECCCC-------EECCCCEECCCC
T ss_conf             2882-30220135988722996287989997-------998898887997


No 64 
>cd03358 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain. WcxM is thought to be bifunctional, catalyzing both the isomerization and transacetylation reactions of keto-hexoses. It contains an N-terminal LbH domain responsible for the transacetylation function and a C-terminal isomerase domain. The LbH domain contains imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), typical of enzymes with acyltransferase activity.
Probab=99.27  E-value=1.2e-11  Score=91.93  Aligned_cols=93  Identities=30%  Similarity=0.498  Sum_probs=76.5

Q ss_pred             CCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEE---------------CCEEECC
Q ss_conf             3677201566123220473068688123211210057765644872584782185784---------------6888458
Q gi|254780781|r  140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIV---------------EGCIIRE  204 (285)
Q Consensus       140 Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~---------------~Gv~Ig~  204 (285)
                      ||+++.|+.++.|+..+.||++|+|..++.|+.        .+.|+|+|+||.++.+.               .+++||+
T Consensus         1 IG~~~~Ig~~~~I~~~~~IG~~~~I~~~~~I~~--------~~~Ig~~~~Ig~~~~~~~~~~~~~~~~~~~~~~~v~Ig~   72 (119)
T cd03358           1 IGDNCIIGTNVFIENDVKIGDNVKIQSNVSIYE--------GVTIEDDVFIGPNVVFTNDLYPRSKIYRKWELKGTTVKR   72 (119)
T ss_pred             CCCCCEECCCCEECCCCEECCCEEECCCCCCCC--------CCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCEECC
T ss_conf             989989999989999999999969999863678--------999843779778863304446676434676324839878


Q ss_pred             CCEEEEEEEECCCCEEEE---CCCCCEEEEECCCCCEEE
Q ss_conf             856630046527833687---158814644549987896
Q gi|254780781|r  205 GSVLGMGVFIGKSTKIID---RNTGEITYGEVPSYSVVV  240 (285)
Q Consensus       205 gavIgaG~vit~st~i~d---~~~~~~~~g~vP~~~vvv  240 (285)
                      ++.||++++|.+.++|.+   +..+.+...++|+++++.
T Consensus        73 ~v~IG~~~~I~~gv~IG~~~~IgagSvV~~dv~~~~i~~  111 (119)
T cd03358          73 GASIGANATILPGVTIGEYALVGAGAVVTKDVPPYALVV  111 (119)
T ss_pred             CEEECCCCEEECCEEECCCCEECCCCEECCCCCCCCEEE
T ss_conf             838488747789949899989977998903659997999


No 65 
>cd04745 LbH_paaY_like paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E. coli paaY gene, which is part of the paa gene cluster responsible for phenylacetic acid degradation. Proteins in this group are expected to adopt the left-handed parallel beta-helix (LbH) structure. They contain imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Similarity to gamma carbonic anhydrase and Ferripyochelin Binding Protein (FBP) may suggest metal binding capacity.
Probab=99.27  E-value=2.6e-11  Score=89.89  Aligned_cols=109  Identities=24%  Similarity=0.413  Sum_probs=76.0

Q ss_pred             ECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEEC---CEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECC
Q ss_conf             0356400665146201030235336772015661232---2047306868812321121005776564487258478218
Q gi|254780781|r  117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVG---SCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGAR  193 (285)
Q Consensus       117 vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG---~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~  193 (285)
                      +.++|||.|.+++.+     ...||++|.|..+++|-   ....||++|.|..++.|..    ....++.|+|+++||.+
T Consensus         3 i~~~a~I~p~A~I~G-----~V~IG~~~~I~~~~~Ir~d~g~i~IG~~~~I~~n~~Ih~----~~~~~~~Ig~~~~ig~~   73 (155)
T cd04745           3 VDPSSFVHPTAVLIG-----DVIIGKNCYIGPHASLRGDFGRIVIRDGANVQDNCVIHG----FPGQDTVLEENGHIGHG   73 (155)
T ss_pred             CCCCEEECCCCEEEE-----EEEECCCCEECCCEEEECCCCCEEECCCCEECCCCEECC----CCCCCCEECCCCEECCC
T ss_conf             799859999999984-----479989979984607963877789999979787844013----59998698999789987


Q ss_pred             CEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECC
Q ss_conf             5784688845885663004652783368715881464454998789605
Q gi|254780781|r  194 SEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG  242 (285)
Q Consensus       194 s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg  242 (285)
                      +.+ .|++||+++.||+|++|-.++.|.+-.       -|-++|||.++
T Consensus        74 ~~~-~g~~Ig~~~~IG~~a~I~~G~~IG~~s-------iIgagSvV~~~  114 (155)
T cd04745          74 AIL-HGCTIGRNALVGMNAVVMDGAVIGEES-------IVGAMAFVKAG  114 (155)
T ss_pred             CEE-CCCEEEEEEEECCCCEEECCCEECCCC-------EEEECCEECCC
T ss_conf             487-151774324976875995977989997-------99418787699


No 66 
>cd03353 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase. It is a bifunctional bacterial enzyme that catalyzes two consecutive steps in the formation of UDP-N-acetylglucosamine (UDP-GlcNAc), an important precursor in bacterial cell wall formation. The two enzymatic activities, uridyltransferase and acetyltransferase, are carried out by two independent domains. The C-terminal LbH domain possesses the acetyltransferase activity. It catalyzes the CoA-dependent acetylation of GlcN-1-phosphate to GlcNAc-1-phosphate. The LbH domain contains 10 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X. The acetyltransferase active site is located at the interface between two subunits of the active LbH trimer.
Probab=99.25  E-value=2.1e-11  Score=90.43  Aligned_cols=129  Identities=23%  Similarity=0.363  Sum_probs=61.3

Q ss_pred             CCCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEE-----CCEEEECCCCEEECCCEECC------EE
Q ss_conf             4751025431035640066514620-103023533677201566123-----22047306868812321121------00
Q gi|254780781|r  107 HNFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTV-----GSCAQIGKNVHISGGVGIGG------VL  174 (285)
Q Consensus       107 ~g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~I-----G~~a~IG~~vhI~~g~~IGG------vl  174 (285)
                      .++.+.|+|+++.++.|++++.+.| +++ -++.||+++.|..++.+     +..+.||.+++|.+++.|+.      ..
T Consensus        20 ~~v~I~p~~~I~~~v~IG~~~~Ig~~~~I-~~~~IG~~~~I~~~~vi~~~~ig~~~~IG~~~~i~~~~~I~~~~~iG~~v   98 (193)
T cd03353          20 VDVVIDPGVILEGKTVIGEDCVIGPNCVI-KDSTIGDGVVIKASSVIEGAVIGNGATVGPFAHLRPGTVLGEGVHIGNFV   98 (193)
T ss_pred             CCCEECCCEEEECCCEECCCCEECCCEEE-CCCEECCCCEECCCEECCCCEECCCCEECCCEEECCCCEECCEEEECCCE
T ss_conf             99999898299298599999899573457-78688887400210011352517652666850765876887516742535


Q ss_pred             C--------CC------CCCCEEECCCCEEECCCEEEC-------CEEECCCCEEEEEEEECCCCEEEECCCCCEEEEEC
Q ss_conf             5--------77------656448725847821857846-------88845885663004652783368715881464454
Q gi|254780781|r  175 E--------PI------QTGPTIIEDNCFIGARSEIVE-------GCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEV  233 (285)
Q Consensus       175 e--------p~------~a~pviIeD~v~IGa~s~I~~-------Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~v  233 (285)
                      +        ..      ..+.+.|+++|+||+++.+..       .+.||+++.||+++.+.+.++|             
T Consensus        99 ~i~~~~ig~~~~i~h~~~igd~~Ig~~v~Ig~~~i~~n~~g~~~~~t~IGd~v~IG~~~~i~~~v~I-------------  165 (193)
T cd03353          99 EIKKSTIGEGSKANHLSYLGDAEIGEGVNIGAGTITCNYDGVNKHRTVIGDNVFIGSNSQLVAPVTI-------------  165 (193)
T ss_pred             EEECCCCCCCCEECCEEECCCCEECCCCEECCCEEEECCCCCCCCCCEECCCCEECCCCEEECCEEE-------------
T ss_conf             7644433688487724461885677788886675887343433562343356189889879898399-------------


Q ss_pred             CCCCEEECCCCCCCCC
Q ss_conf             9987896056445567
Q gi|254780781|r  234 PSYSVVVPGSYPSINL  249 (285)
Q Consensus       234 P~~~vvvpg~~~~~~~  249 (285)
                      -.++++=+||...|+-
T Consensus       166 G~~a~Igags~V~kdV  181 (193)
T cd03353         166 GDGATIAAGSTITKDV  181 (193)
T ss_pred             CCCCEECCCCEECCCC
T ss_conf             9998998698888423


No 67 
>cd04646 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport. Dynactin is a heterocomplex of at least eight subunits, including a 150,000-MW protein called Glued, the actin-capping protein Arp1, and dynamatin. In vitro binding experiments show that dynactin enhances dynein-dependent motility, possibly through interaction with microtubules and vesicles. Subunit p27 is part of the pointed-end subcomplex in dynactin that also includes p25, p26, and Arp11. This subcomplex interacts with membranous cargoes. p25 and p27 contain the imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), indicating a left-handed parallel beta helix (LbH) structural domain. Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=99.24  E-value=1.3e-10  Score=85.51  Aligned_cols=114  Identities=22%  Similarity=0.267  Sum_probs=82.3

Q ss_pred             ECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEE---EECCCCEEECCCEECCE--ECCCCCCCEEECCCCEEE
Q ss_conf             0356400665146201030235336772015661232204---73068688123211210--057765644872584782
Q gi|254780781|r  117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCA---QIGKNVHISGGVGIGGV--LEPIQTGPTIIEDNCFIG  191 (285)
Q Consensus       117 vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a---~IG~~vhI~~g~~IGGv--lep~~a~pviIeD~v~IG  191 (285)
                      +.+.|||.+.+++.+     ...||++|.|..+|++..+.   .||++|.|..++.|...  .......|++|||++.|+
T Consensus         2 I~~~a~I~~~A~iiG-----dV~IG~~~sI~p~avIrgd~g~I~IG~~~nIqd~~~I~~~~~~~~~~g~~~~IG~~~~i~   76 (164)
T cd04646           2 IAPGAVVCQESEIRG-----DVTIGPGTVVHPRATIIAEAGPIIIGENNIIEEQVTIVNKKPKDPAEPKPMIIGSNNVFE   76 (164)
T ss_pred             CCCCCEECCCCEEEE-----EEEECCCCEECCCCEEEECCCCEEECCCCEECCCEEEECCCCCCCCCCCCEEECCCCEEC
T ss_conf             489879999999982-----179999998995759981437889899966669859941787777899887988998886


Q ss_pred             CCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCC
Q ss_conf             1857846888458856630046527833687158814644549987896056
Q gi|254780781|r  192 ARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS  243 (285)
Q Consensus       192 a~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~  243 (285)
                      .+|.| ++++||++++||+|+.|..++.|.|-.       -|-++|+|-||.
T Consensus        77 ~g~~i-h~~~IG~~~lIg~~a~V~~ga~Ig~~c-------iIgags~V~~~~  120 (164)
T cd04646          77 VGCKC-EALKIGNNNVFESKSFVGKNVIITDGC-------IIGAGCKLPSSE  120 (164)
T ss_pred             CCEEE-ECCEECCCCEECCCCEECCCCEECCCC-------EECCCCCCCCCC
T ss_conf             78199-555976788896898999998999998-------999898928997


No 68 
>cd00710 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site. They are ubiquitous enzymes involved in fundamental processes like photosynthesis, respiration, pH homeostasis and ion transport. There are three distinct groups of  carbonic anhydrases - alpha, beta and gamma - which show no significant sequence identity or structural similarity. Gamma CAs are homotrimeric enzymes, with each subunit containing a left-handed parallel beta helix (LbH) structural domain.
Probab=99.23  E-value=5.9e-11  Score=87.66  Aligned_cols=119  Identities=24%  Similarity=0.360  Sum_probs=80.6

Q ss_pred             EECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEEC----CEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEE
Q ss_conf             10356400665146201030235336772015661232----20473068688123211210057765644872584782
Q gi|254780781|r  116 IVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVG----SCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIG  191 (285)
Q Consensus       116 ~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG----~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IG  191 (285)
                      .+.++|||+|++++++.     ..||+++.|..+|.+-    +...||++|.|.-|+.|-.    ....+++|+|+|.||
T Consensus         4 ~i~~~afIap~A~viGd-----V~ig~~~sIw~~aviRgD~~~~I~IG~~~nIqD~~viH~----~~~~~~~IG~~vtIg   74 (167)
T cd00710           4 VIDPSAYVHPTAVVIGD-----VIIGDNVFVGPGASIRADEGTPIIIGANVNIQDGVVIHA----LEGYSVWIGKNVSIA   74 (167)
T ss_pred             CCCCCEEECCCCEEEEE-----EEECCCCEECCCCEEECCCCCCEEECCCCCCCCCEEEEC----CCCCCEEECCCCEEC
T ss_conf             06999398999989970-----899999999888789478888769888743477707822----576674977982898


Q ss_pred             CCCEEECCEEECCCCEEEEEEEECCCCEEEE---CCCCCEEEE-ECCCCCEEECCCC
Q ss_conf             1857846888458856630046527833687---158814644-5499878960564
Q gi|254780781|r  192 ARSEIVEGCIIREGSVLGMGVFIGKSTKIID---RNTGEITYG-EVPSYSVVVPGSY  244 (285)
Q Consensus       192 a~s~I~~Gv~Ig~gavIgaG~vit~st~i~d---~~~~~~~~g-~vP~~~vvvpg~~  244 (285)
                      .+|.|...++||++++||+|++|-. .+|.|   +..+.+..| .+||++.|-+|++
T Consensus        75 h~a~ihG~c~Igd~~~IG~gaiv~~-a~Ig~~~vIgags~V~g~~i~~g~~v~~G~~  130 (167)
T cd00710          75 HGAIVHGPAYIGDNCFIGFRSVVFN-AKVGDNCVIGHNAVVDGVEIPPGRYVPAGAV  130 (167)
T ss_pred             CCCEECCEEEECCCCEECCCCEEEC-CEECCCCEECCCCEEECCCCCCCCEECCCCE
T ss_conf             9848812049839988988989982-5976998998898884778399989558828


No 69 
>PRK10502 putative colanic acid biosynthesis acetyltransferase WcaF; Provisional
Probab=99.23  E-value=7.6e-11  Score=86.98  Aligned_cols=98  Identities=26%  Similarity=0.375  Sum_probs=75.0

Q ss_pred             CCCCCCCCCCCCCCCEE--CCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEE---------------C
Q ss_conf             23533677201566123--220473068688123211210057765644872584782185784---------------6
Q gi|254780781|r  136 MGAYIGEGSMIDTWSTV--GSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIV---------------E  198 (285)
Q Consensus       136 iGA~Ig~gt~I~~~a~I--G~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~---------------~  198 (285)
                      .||.||+++.|...+.|  .-...||++|.|+.++.|-      +.+++.|||||.|+.++.+.               .
T Consensus        51 FGAkIG~~v~I~p~v~I~~PwnL~IGd~~~Ig~~v~i~------~~~~I~IG~~v~Isq~v~l~t~sHd~~~~~~~l~~~  124 (179)
T PRK10502         51 FGAKIGKGVVIRPSVRITYPWKLTIGDYAWIGDDVVLY------TLGEITIGAHCVISQKSYLCTGSHDYSSPHFDLNAA  124 (179)
T ss_pred             HCCEECCCCEECCCCEEEECCCEEECCCCEECCCCEEE------ECCCCEECCCEEECCCCEEECCCCCCCCCCCCCCCC
T ss_conf             48867999889996579504307988965788981898------489617988412779718963889976766673248


Q ss_pred             CEEECCCCEEEEEEEECCCCEEEE---CCCCCEEEEECCCCCEE
Q ss_conf             888458856630046527833687---15881464454998789
Q gi|254780781|r  199 GCIIREGSVLGMGVFIGKSTKIID---RNTGEITYGEVPSYSVV  239 (285)
Q Consensus       199 Gv~Ig~gavIgaG~vit~st~i~d---~~~~~~~~g~vP~~~vv  239 (285)
                      +++||+++-||++++|.+++.|.+   +..+.+...++|+++++
T Consensus       125 pI~Igd~~wIga~a~I~pGv~Ig~gavigA~SvV~kdv~~~~i~  168 (179)
T PRK10502        125 PIVIGEGCWLATDVFVAPGVTIGDGAVVGARSSVFKSLPANTVC  168 (179)
T ss_pred             CCEECCCEEECCCCEEECCCEECCCCEECCCCEEEEECCCCCEE
T ss_conf             85858996999996990889999997995499892177999699


No 70 
>PRK13627 carnitine operon protein CaiE; Provisional
Probab=99.20  E-value=1.2e-10  Score=85.89  Aligned_cols=140  Identities=21%  Similarity=0.332  Sum_probs=94.1

Q ss_pred             EECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEEC---CEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEEC
Q ss_conf             10356400665146201030235336772015661232---204730686881232112100577656448725847821
Q gi|254780781|r  116 IVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVG---SCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGA  192 (285)
Q Consensus       116 ~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG---~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa  192 (285)
                      .+.++|||++++++.+.     ..||+++.|..+|.+-   ....||++|+|..++.|-+.    ...|++|||+|.||-
T Consensus        12 ~i~~~afIap~A~viGd-----V~ig~~~sIw~~aVlRGD~~~I~IG~~tNIQD~~viH~~----~~~~~~IG~~vtIGH   82 (196)
T PRK13627         12 VVHPTAFVHPSAVLIGD-----VIVGAGVYIGPLASLRGDYGRLIVQAGANLQDGCIMHGY----CDTDTIVGENGHIGH   82 (196)
T ss_pred             CCCCCEEECCCCEEEEE-----EEECCCCEECCCEEEECCCCCEEECCCCEECCCCEEECC----CCCCCEECCCEEECC
T ss_conf             22998388999989984-----999999889777089568871798998676798378148----999858889805878


Q ss_pred             CCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEECCHHHH
Q ss_conf             85784688845885663004652783368715881464454998789605644556776657764467279896120246
Q gi|254780781|r  193 RSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTR  272 (285)
Q Consensus       193 ~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~cavi~~~~d~~t~  272 (285)
                      +|.+. |++||++++||+|++|-.+..|.+-.       -|-|+|+|-||..   .|.+.....  .+|-+++.+.++..
T Consensus        83 ~ailh-gc~Igd~~lIGmgavVldga~Ig~~~-------iI~AgslV~~g~~---ip~~~L~~G--~PAk~vR~lt~~ei  149 (196)
T PRK13627         83 GAILH-GCVIGRDALVGMNSVIMDGAVIGEES-------IVAAMSFVKAGFQ---GEKRQLLMG--TPARAVRSVSDQEL  149 (196)
T ss_pred             CEEEE-EEEEECCCEECCCCEEECCCEECCCC-------EECCCCEECCCCC---CCCCCEEEE--CCEEEEECCCHHHH
T ss_conf             72996-34994897884697992888999998-------9976864579949---389819987--78168114999999


Q ss_pred             HHHHH
Q ss_conf             68889
Q gi|254780781|r  273 SKTSI  277 (285)
Q Consensus       273 ~k~~l  277 (285)
                      +....
T Consensus       150 ~~~~~  154 (196)
T PRK13627        150 HWKRL  154 (196)
T ss_pred             HHHHH
T ss_conf             99887


No 71 
>KOG1461 consensus
Probab=99.17  E-value=9.7e-11  Score=86.35  Aligned_cols=97  Identities=34%  Similarity=0.586  Sum_probs=40.3

Q ss_pred             HCCCCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEEC
Q ss_conf             24751025431035640066514620103023533677201566123220473068688123211210057765644872
Q gi|254780781|r  106 KHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE  185 (285)
Q Consensus       106 ~~g~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIe  185 (285)
                      ..+++-.|-+++.+++.++.++++           |.||.|+.++-|-. ..||.||+|+.++.|-+-.   =...|+||
T Consensus       313 r~~IYk~~dv~~~~~~~v~~~~~i-----------g~gT~Ig~g~~I~N-SVIG~~c~IgsN~~I~~S~---iw~~v~Ig  377 (673)
T KOG1461         313 RRNIYKSPDVVLSHSVIVGANVVI-----------GAGTKIGSGSKISN-SVIGANCRIGSNVRIKNSF---IWNNVTIG  377 (673)
T ss_pred             CCCCCCCCCCEEHHHCCCCCEEEE-----------CCCCCCCCCCEEEC-CEECCCCEECCCEEEEEEE---EECCCEEC
T ss_conf             244014740100012012440795-----------14541267985552-2665897745745885136---62583887


Q ss_pred             CCCEE-----ECCCEEECCEEECCCCEEEEEEEECCC
Q ss_conf             58478-----218578468884588566300465278
Q gi|254780781|r  186 DNCFI-----GARSEIVEGCIIREGSVLGMGVFIGKS  217 (285)
Q Consensus       186 D~v~I-----Ga~s~I~~Gv~Ig~gavIgaG~vit~s  217 (285)
                      |||.|     +.++.|.+|+++..|+|||+|+++++.
T Consensus       378 dnc~I~~aii~d~v~i~~~~~l~~g~vl~~~VVv~~~  414 (673)
T KOG1461         378 DNCRIDHAIICDDVKIGEGAILKPGSVLGFGVVVGRN  414 (673)
T ss_pred             CCCEEEEEEEECCCEECCCCCCCCCCEEEEEEEECCC
T ss_conf             8865734686058376788440788577521686798


No 72 
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane]
Probab=99.09  E-value=6e-10  Score=81.50  Aligned_cols=135  Identities=28%  Similarity=0.459  Sum_probs=88.8

Q ss_pred             CCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCE-----EC-CE----ECC
Q ss_conf             751025431035640066514620-10302353367720156612322047306868812321-----12-10----057
Q gi|254780781|r  108 NFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVG-----IG-GV----LEP  176 (285)
Q Consensus       108 g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~-----IG-Gv----lep  176 (285)
                      ++++.|+++++. +.|++|+++-+ |.++ ++.||+++.|+..|++-..+.+|++|||+.-+-     || |.    |.=
T Consensus       292 ~v~iGpg~~i~d-s~I~~~a~I~~~S~ie-~s~vg~~~~VGPfA~LRPg~~L~~~~hIGNFVEvK~a~ig~gsKa~HLtY  369 (460)
T COG1207         292 NVVIGPGSVIKD-SVIGDNAVIKAYSVIE-GSTVGEGATVGPFARLRPGAVLGADVHIGNFVEVKKATIGKGSKAGHLTY  369 (460)
T ss_pred             CEEECCCCEEEE-EEECCCCEEEECCEEE-CCEECCCCCCCCCCCCCCCCCCCCCCEEEEEEEEECCCCCCCCCCCCEEE
T ss_conf             649999967875-3876998897510430-55854796337831017968526797674259984356068863353234


Q ss_pred             CCCCCEEECCCCEEECCCEEEC--C-----EEECCCCEEEEEEEECCCCEEEE---CCCCCEEEEECCCCCEEECCCCCC
Q ss_conf             7656448725847821857846--8-----88458856630046527833687---158814644549987896056445
Q gi|254780781|r  177 IQTGPTIIEDNCFIGARSEIVE--G-----CIIREGSVLGMGVFIGKSTKIID---RNTGEITYGEVPSYSVVVPGSYPS  246 (285)
Q Consensus       177 ~~a~pviIeD~v~IGa~s~I~~--G-----v~Ig~gavIgaG~vit~st~i~d---~~~~~~~~g~vP~~~vvvpg~~~~  246 (285)
                        .+...|+.+|=|||+++.+.  |     .+||+++.||.++.+-+-.+|.|   ...|.+..-+||+.++.+.-++-.
T Consensus       370 --lGDA~iG~~~NiGAGtItcNYDG~nK~~T~IGd~vFiGSns~LVAPV~IGd~a~iaAGStIT~DVp~~aLai~RarQ~  447 (460)
T COG1207         370 --LGDAEIGENVNIGAGTITCNYDGKNKFKTIIGDNVFIGSNSQLVAPVTIGDGATIAAGSTITKDVPEGALAISRARQT  447 (460)
T ss_pred             --ECCCEECCCCEECCCEEEECCCCCCCCEEEECCCCEECCCCCEEEEEEECCCCEECCCCEECCCCCCCCEEEEECCEE
T ss_conf             --213320687421442599847886332006468857766871886489669848814636836579984467404414


No 73 
>COG0663 PaaY Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only]
Probab=99.05  E-value=2.7e-09  Score=77.52  Aligned_cols=138  Identities=23%  Similarity=0.301  Sum_probs=90.4

Q ss_pred             EECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEEC---CEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEEC
Q ss_conf             10356400665146201030235336772015661232---204730686881232112100577656448725847821
Q gi|254780781|r  116 IVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVG---SCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGA  192 (285)
Q Consensus       116 ~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG---~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa  192 (285)
                      .+.+.|||.|.+++++.     ..||+++.|..+|.+.   +--.||+++.|--|+.|-+-    ...|+.|||+|+||-
T Consensus        13 ~i~~~a~Va~~A~viGd-----V~Ig~~vsIw~~aVlRgD~~~I~IG~~tNIQDg~ViH~~----~~~p~~IG~~vtIGH   83 (176)
T COG0663          13 KIDPTAFVAPSATVIGD-----VRIGAGVSIWPGAVLRGDVEPIRIGARTNIQDGVVIHAD----PGYPVTIGDDVTIGH   83 (176)
T ss_pred             CCCCCEEECCCCEEEEE-----EEECCCCEECCCEEEECCCCCEEECCCCEECCCEEEECC----CCCCEEECCCCEECC
T ss_conf             78986287799979985-----999999788776389746775698788560378389527----999929779958857


Q ss_pred             CCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEECCHHHH
Q ss_conf             85784688845885663004652783368715881464454998789605644556776657764467279896120246
Q gi|254780781|r  193 RSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTR  272 (285)
Q Consensus       193 ~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~cavi~~~~d~~t~  272 (285)
                      +|.|. |++||+++.||+|++|-.+..|.+-.       -|-++|+|-+|..+..+   .  .+.=-.|-++...+++..
T Consensus        84 ~aivH-Gc~Ig~~~lIGmgA~vldga~IG~~~-------iVgAgalV~~~k~~p~~---~--L~~G~Pak~~r~l~~~~~  150 (176)
T COG0663          84 GAVVH-GCTIGDNVLIGMGATVLDGAVIGDGS-------IVGAGALVTPGKEIPGG---S--LVVGSPAKVVRPLDDEEL  150 (176)
T ss_pred             CCEEE-EEEECCCCEEECCCEEECCCEECCCC-------EECCCCCCCCCCCCCCC---E--EEECCCCEEEECCCHHHH
T ss_conf             65898-85987885891386675786988986-------98668700588377997---5--962374014402886676


Q ss_pred             HHH
Q ss_conf             688
Q gi|254780781|r  273 SKT  275 (285)
Q Consensus       273 ~k~  275 (285)
                      +..
T Consensus       151 ~~~  153 (176)
T COG0663         151 AWL  153 (176)
T ss_pred             HHH
T ss_conf             666


No 74 
>COG2171 DapD Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism]
Probab=99.05  E-value=3.9e-09  Score=76.51  Aligned_cols=178  Identities=21%  Similarity=0.288  Sum_probs=107.0

Q ss_pred             HCCCEEE--EEECCCCCEEEEHHHHHHHHHEEECCCCEEEECCCCCCCHHHCC----------------CCCCCC-CCHH
Q ss_conf             0793799--88759996886078862322206426744762477642011017----------------753236-5202
Q gi|254780781|r   42 DRGIIRI--ASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKI----------------PAKFDD-WKTK  102 (285)
Q Consensus        42 D~G~iRV--AEk~~nG~W~VNeWvKKAILL~Fri~~~~~i~~g~~~~~~~DKv----------------p~Kf~~-~~~~  102 (285)
                      ++=.+|+  +.+. +-.=.+++-..+--+|+.|+-+...+ +.++.+.|.-|.                .++..+ |++-
T Consensus        14 ~~~~v~~~~~~~~-~~~~~~~~~~~~L~~~s~r~~~~~~~-~~~~~~~~l~~~v~~~~~~~~~~~l~~~~~~~~~~~~~v   91 (271)
T COG2171          14 ERKAVRTVIYVLD-DLPEAVADAYLRLHLLSHRVAEPHID-NLWGTFEWLKKAVLLGFGPCDLELLEAGRLRIRGYYDKV   91 (271)
T ss_pred             CCCCEEEEEECCC-CCCHHHHHHHHHHHHCCEEEECCCCC-CCHHHHHHHCEEEEECCCCCCHHHHHHCCCCCCCCEEEC
T ss_conf             6553036775077-74122688998753045353155534-411244232116995467750577752433435641321


Q ss_pred             HHHHCCCCCCCCCEECCCCCCCC-CCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCC
Q ss_conf             34424751025431035640066-514620-1030235336772015661232204730686881232112100577656
Q gi|254780781|r  103 DFEKHNFRIIPGTIVRHSAYIGP-KAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG  180 (285)
Q Consensus       103 ~f~~~g~rv~P~a~vr~ga~Ig~-g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~  180 (285)
                      +++..-.|        .-.|.-+ |+-+-| +.|..||||++||.+.+.+.|.-.|.++..+.+-..+..|+        
T Consensus        92 ~~~~~~~~--------~~d~~~~~g~RI~p~a~VR~ga~i~~gtvvM~~sfVNigA~~~~gtMVd~~as~G~--------  155 (271)
T COG2171          92 DSVDKAPR--------MLDYFVPEGVRIVPGAIVRLGAYIAKGTVVMPESFVNIGAGTGEGTMVDGRASVGS--------  155 (271)
T ss_pred             CCCCCCCC--------HHHHCCCCCEEECCCCEEEECCEECCCCEECCCCEEEECCCCCCCEEEEEEEEEEC--------
T ss_conf             11145531--------34550557636367647760528779938755566877760275258961565513--------


Q ss_pred             CEEECCCCEEECCCEEEC--------CEEECCCCEEEEEEEECCCCEEEE---CCCCCEEEEECCCCC
Q ss_conf             448725847821857846--------888458856630046527833687---158814644549987
Q gi|254780781|r  181 PTIIEDNCFIGARSEIVE--------GCIIREGSVLGMGVFIGKSTKIID---RNTGEITYGEVPSYS  237 (285)
Q Consensus       181 pviIeD~v~IGa~s~I~~--------Gv~Ig~gavIgaG~vit~st~i~d---~~~~~~~~g~vP~~~  237 (285)
                      .++|++||+||+++.|..        .++||++|.|||++++.-++++.|   +..|-..-..+|.+-
T Consensus       156 ~a~VGkn~higgGa~I~GVLep~~a~Pv~IgdncliGAns~~veGV~vGdg~VV~aGv~I~~~tki~~  223 (271)
T COG2171         156 CAQVGKNSHIGGGASIGGVLEPLQANPVIIGDNCLIGANSEVVEGVIVGDGCVVAAGVFITQDTKIYD  223 (271)
T ss_pred             CEEECCCCCCCCCCEEEEEECCCCCCCEEECCCCEECCCCCEEEEEEECCCCEEECCEEEECCCCEEE
T ss_conf             17979984527863676773488878869877618624533486169678968854508937951477


No 75 
>cd03359 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is a major component of the activator complex that stimulates dynein-mediated vesicle transport. Dynactin is a heterocomplex of at least eight subunits, including a 150,000-MW protein called Glued, the actin-capping protein Arp1, and dynamatin. In vitro binding experiments show that dynactin enhances dynein-dependent motility, possibly through interaction with microtubules and vesicles. Subunit p25 is part of the pointed-end subcomplex in dynactin that also includes p26, p27, and Arp11. This subcomplex interacts with membranous cargoes. p25 and p27 contain imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), indicating a left-handed parallel beta helix (LbH) structural domain. Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=99.04  E-value=1.7e-09  Score=78.67  Aligned_cols=115  Identities=20%  Similarity=0.246  Sum_probs=68.7

Q ss_pred             CCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECC---EEEECCCCEEECCCEECC--EE--CCCCCCCEEECCCCE
Q ss_conf             35640066514620-10302353367720156612322---047306868812321121--00--577656448725847
Q gi|254780781|r  118 RHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGS---CAQIGKNVHISGGVGIGG--VL--EPIQTGPTIIEDNCF  189 (285)
Q Consensus       118 r~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~---~a~IG~~vhI~~g~~IGG--vl--ep~~a~pviIeD~v~  189 (285)
                      ..|-+|++.++|.+ .-|    .+|++|.|..+|.+-.   ...||++|.|..++.|.-  ..  ......|++|+|+|+
T Consensus         5 ~~gn~I~k~a~I~G~~nI----~IG~~ssI~~~avirGD~~~I~IG~~~~I~d~~~I~~~~~~~~~~~~~~p~~IGd~v~   80 (161)
T cd03359           5 ASGNKVSRKSVICGSQNI----VLNGKTIIQSDVIIRGDLATVSIGRYCILSEGCVIRPPFKKFSKGVAFFPLHIGDYVF   80 (161)
T ss_pred             CCCCEECCCCEEECCCCE----EECCCCEECCCCEEECCCCCEEECCCCEECCCCEEECCCCCCCCCCCCCCCEECCCEE
T ss_conf             899958776299788775----9999878999968967886549999858889989924644357788887728489879


Q ss_pred             EECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCC
Q ss_conf             8218578468884588566300465278336871588146445499878960564
Q gi|254780781|r  190 IGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY  244 (285)
Q Consensus       190 IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~  244 (285)
                      ||.+|.+ .++.||.++.||+|++|.....|.|-.       .|-++|||-|++.
T Consensus        81 Ig~~~~i-~~~~Ig~~v~IG~~~~I~~g~~Ig~~~-------~I~~gsvV~~~~~  127 (161)
T cd03359          81 IGENCVV-NAAQIGSYVHIGKNCVIGRRCIIKDCV-------KILDGTVVPPDTV  127 (161)
T ss_pred             ECCCEEE-ECCEECCCEEECCCCEECCCCEECCCC-------EECCCCEECCCCE
T ss_conf             8998288-488966771557981994997999998-------9988989889989


No 76 
>PRK12461 UDP-N-acetylglucosamine acyltransferase; Provisional
Probab=99.00  E-value=8.1e-10  Score=80.72  Aligned_cols=141  Identities=23%  Similarity=0.347  Sum_probs=97.8

Q ss_pred             CCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECC----CCCCC---
Q ss_conf             1025431035640066514620-103023533677201566123220473068688123211210057----76564---
Q gi|254780781|r  110 RIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP----IQTGP---  181 (285)
Q Consensus       110 rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep----~~a~p---  181 (285)
                      -+.|.|+|.++|.|++++.+.| ++|.-++.||++|.|..+++|+..+.||++|+|.+++.||.--..    .+...   
T Consensus         2 ~IHptAiI~~~A~Ig~~v~Igp~~vIg~~V~IG~~~~I~~~v~I~~~t~IG~~~~I~~~avIG~~pqd~~~~g~~~~v~I   81 (256)
T PRK12461          2 MIHPTAVIDPSAKLGEGVEIGPFAVIGADVEIGDGTWIMPHAVILGWTRIGKNNKIHQGAVVGDEPQDFGYKGEESHLII   81 (256)
T ss_pred             CCCCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCEEEEECCCCCCCCCCCCCCCCCCEEEE
T ss_conf             29998798998999999999999999999999999999498189199899974399754311763334441586206998


Q ss_pred             ---------------------EEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCC--CCEE---EEECCC
Q ss_conf             ---------------------48725847821857846888458856630046527833687158--8146---445499
Q gi|254780781|r  182 ---------------------TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNT--GEIT---YGEVPS  235 (285)
Q Consensus       182 ---------------------viIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~--~~~~---~g~vP~  235 (285)
                                           |.|+|+|++-+.+.|...+.||+++++.+++.+..++.|.|...  +...   .-+|-.
T Consensus        82 Gd~~~Ire~~tI~rgt~~~~~T~IG~~~~im~~vhIaHd~~IG~~~iian~~~laG~v~Igd~v~iGg~~~v~q~v~IG~  161 (256)
T PRK12461         82 GDNNVIREGVTIHRGTKGGTVTRIGNDNLLMANSHIAHDCQIGNNVILVNGALLAGHVTVGDRAIISGNCLVHQFCRIGR  161 (256)
T ss_pred             CCCCEECCCCCCCCCCCCCCCEEECCCCEEECCCCCCCCCCCCCCEEEECCEEECCCEEECCCCEECCCCEECCCCEECC
T ss_conf             99878798755678614898669887858743643346431367706722202324259999729957347717979999


Q ss_pred             CCEEECCCCCCCCCC
Q ss_conf             878960564455677
Q gi|254780781|r  236 YSVVVPGSYPSINLK  250 (285)
Q Consensus       236 ~~vvvpg~~~~~~~~  250 (285)
                      ++.+=.||...++-+
T Consensus       162 ~a~Ig~gS~V~kDVP  176 (256)
T PRK12461        162 LAMMAGGSRISKDVP  176 (256)
T ss_pred             CCEECCCCEEEEECC
T ss_conf             969987857775379


No 77 
>PRK05289 UDP-N-acetylglucosamine acyltransferase; Provisional
Probab=98.98  E-value=1.5e-09  Score=79.02  Aligned_cols=131  Identities=21%  Similarity=0.258  Sum_probs=65.8

Q ss_pred             CEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECC--------EE-CCCCC------
Q ss_conf             3103564006651462010302353367720156612322047306868812321121--------00-57765------
Q gi|254780781|r  115 TIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGG--------VL-EPIQT------  179 (285)
Q Consensus       115 a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGG--------vl-ep~~a------  179 (285)
                      +-|++.|.|.|++.|-+     ++.||.++.|+.++.||..+.|+.||+|..++.||-        ++ +++|.      
T Consensus         3 ~~IHptAiI~~~A~IG~-----~v~Igp~~vIg~~v~IG~~~~I~~~v~I~~~t~IG~~~~I~~~avIG~~pqd~~~~g~   77 (261)
T PRK05289          3 AKIHPTAIVEPGAEIGE-----NVEIGPFCVIGPDVVIGDGTEIGSHVVIDGHTTIGKNNRIFPFASIGEEPQDLKYKGE   77 (261)
T ss_pred             CCCCCCCEECCCCEECC-----CCEECCCCEECCCCEECCCCEECCCCEEECCCEECCCCEECCCCCCCCCCCCCCCCCC
T ss_conf             74089889899899999-----8999999999999999999999799689189888988345247533778766660698


Q ss_pred             -CCEEECCCCEEECCCEEECC-------------------------EEECCCCEEEEEEEECCCCEEEECC--CCCEE--
Q ss_conf             -64487258478218578468-------------------------8845885663004652783368715--88146--
Q gi|254780781|r  180 -GPTIIEDNCFIGARSEIVEG-------------------------CIIREGSVLGMGVFIGKSTKIIDRN--TGEIT--  229 (285)
Q Consensus       180 -~pviIeD~v~IGa~s~I~~G-------------------------v~Ig~gavIgaG~vit~st~i~d~~--~~~~~--  229 (285)
                       ..++|+|++.|+.+++|..|                         +.||+++++.+++.+..++.|.|..  .+...  
T Consensus        78 ~~~v~IGd~~~Ire~vtI~rgT~~~~g~T~IG~~~~im~~vhIaHd~~IG~~~iian~~~laG~v~Igd~v~iGg~~~v~  157 (261)
T PRK05289         78 PTRLVIGDNNTIREFVTINRGTVQGGGVTRIGDNNLLMAYVHVAHDCVVGNNVILANNATLAGHVEVGDYAIIGGLSGVH  157 (261)
T ss_pred             CCEEEECCCCEECCCCEECCCCCCCCCCEEECCCCEEECCCCCCCCCCCCCCCEECCCEEECCCEEECCCEEECCCCEEC
T ss_conf             53699899778985414436610588644988885440036434455127871654305664607988970997615664


Q ss_pred             -EEECCCCCEEECCCCCCCCCC
Q ss_conf             -445499878960564455677
Q gi|254780781|r  230 -YGEVPSYSVVVPGSYPSINLK  250 (285)
Q Consensus       230 -~g~vP~~~vvvpg~~~~~~~~  250 (285)
                       .=+|-.++++=.||...++-+
T Consensus       158 q~v~IG~~a~vgagS~V~kDVp  179 (261)
T PRK05289        158 QFVRIGAHAMVGGMSAVVQDVP  179 (261)
T ss_pred             CCCEECCCEEECCCCEECCCCC
T ss_conf             8839898719997636542479


No 78 
>cd03351 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc. It is the first enzyme in the lipid A biosynthetic pathway and is also referred to as LpxA. Lipid A is essential for the growth of Escherichia coli and related bacteria. It is also essential for maintaining the integrity of the outer membrane. UDP-GlcNAc acyltransferase is a homotrimer of left-handed parallel beta helix (LbH) subunits. Each subunit contains an N-terminal LbH region with 9 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), and a C-terminal alpha-helical region.
Probab=98.95  E-value=1.5e-09  Score=79.11  Aligned_cols=140  Identities=24%  Similarity=0.315  Sum_probs=93.1

Q ss_pred             CCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCC------------
Q ss_conf             025431035640066514620-1030235336772015661232204730686881232112100577------------
Q gi|254780781|r  111 IIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPI------------  177 (285)
Q Consensus       111 v~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~------------  177 (285)
                      +.|.|+|.++|.|++++.+.| ++|.-++.||++|.|.+++.|..++.||++|.|.+++.||+.-...            
T Consensus         2 IHptAiI~~~A~IG~~v~Igp~~vIg~~V~IG~~~~I~~~v~I~~~t~IG~~~~I~~~avIG~~pqd~~~~g~~~~v~IG   81 (254)
T cd03351           2 IHPTAIVDPGAKIGENVEIGPFCVIGPNVEIGDGTVIGSHVVIDGPTTIGKNNRIFPFASIGEAPQDLKYKGEPTRLEIG   81 (254)
T ss_pred             CCCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCCEECCCEEECCCCCCCCCCCCCCCCCCCCEEEEC
T ss_conf             18977969989999979999998999999999999997996891997977652560575347787676737986769979


Q ss_pred             -----------------CCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCC--CCE-E--EEECCC
Q ss_conf             -----------------656448725847821857846888458856630046527833687158--814-6--445499
Q gi|254780781|r  178 -----------------QTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNT--GEI-T--YGEVPS  235 (285)
Q Consensus       178 -----------------~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~--~~~-~--~g~vP~  235 (285)
                                       ..+.|+|+|+|+|-+++.|...+.||+++++..++.+..++.|.|...  +.. .  .-+|-.
T Consensus        82 ~~~~Ire~vtI~rgt~~~~~~T~IG~~~~im~~~HIaHdc~IG~~~iian~~~laGhv~Igd~a~IGg~~~v~q~v~IG~  161 (254)
T cd03351          82 DNNTIREFVTIHRGTAQGGGVTRIGNNNLLMAYVHVAHDCVIGNNVILANNATLAGHVEIGDYAIIGGLSAVHQFCRIGR  161 (254)
T ss_pred             CCCEECCCCCCCCCCCCCCCCEEECCCCEEEECCCCCCCCCCCCCEEEECCCCCCCCEEECCCCEECCCCEECCCCEECC
T ss_conf             97789953302367437887559788857820254456773379759933445568569899848988367759819996


Q ss_pred             CCEEECCCCCCCCCC
Q ss_conf             878960564455677
Q gi|254780781|r  236 YSVVVPGSYPSINLK  250 (285)
Q Consensus       236 ~~vvvpg~~~~~~~~  250 (285)
                      ++.+=.||...++-+
T Consensus       162 ~a~Igags~V~kDVp  176 (254)
T cd03351         162 HAMVGGGSGVVQDVP  176 (254)
T ss_pred             CEEECCCCEEECCCC
T ss_conf             619976745611369


No 79 
>cd03357 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively at the C6 position of the nonreducing end glucosyl moiety. GAT specifically acetylates galactopyranosides. Furthermore, MAT shows higher affinity toward artificial substrates containing an alkyl or hydrophobic chain as well as a glucosyl unit. Active MAT and GAT are homotrimers, with each subunit consisting of an N-terminal alpha-helical region and a C-terminal left-handed parallel alpha-helix (LbH) subdomain with 6 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X).
Probab=98.90  E-value=9.8e-09  Score=74.07  Aligned_cols=97  Identities=26%  Similarity=0.344  Sum_probs=65.0

Q ss_pred             CCCCCCCCCCCC--CEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEEC-----------------
Q ss_conf             533677201566--1232204730686881232112100577656448725847821857846-----------------
Q gi|254780781|r  138 AYIGEGSMIDTW--STVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVE-----------------  198 (285)
Q Consensus       138 A~Ig~gt~I~~~--a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~-----------------  198 (285)
                      +.+|+++.|.+-  +.-|....||+||.|..++.|-      ...++.|+|||+||.|+.+..                 
T Consensus        43 ~~~g~~~~I~~pf~~dyG~ni~iG~~~~in~n~~il------d~~~I~IG~~v~igp~v~i~t~~H~~d~~~r~~~~~~~  116 (169)
T cd03357          43 GSVGENVYIEPPFHCDYGYNIHIGDNFYANFNCTIL------DVAPVTIGDNVLIGPNVQIYTAGHPLDPEERNRGLEYA  116 (169)
T ss_pred             CCCCCCCEEECCEEEECCCCEEECCEEEECCCCEEE------ECCCEEECCCEEECCCCEEECCCCCCCHHHHHCCCCCC
T ss_conf             868999589788898343677988844887884897------06887999980787985897689999978963466524


Q ss_pred             -CEEECCCCEEEEEEEECCCCEEEE---CCCCCEEEEECCCCCEEE
Q ss_conf             -888458856630046527833687---158814644549987896
Q gi|254780781|r  199 -GCIIREGSVLGMGVFIGKSTKIID---RNTGEITYGEVPSYSVVV  240 (285)
Q Consensus       199 -Gv~Ig~gavIgaG~vit~st~i~d---~~~~~~~~g~vP~~~vvv  240 (285)
                       +++||+++-||+|++|.+++.|.+   +..|.+...+||++++++
T Consensus       117 ~PI~Igd~vWIG~~~~IlpGVtIG~~~vIgAGsVVtkdip~~~v~~  162 (169)
T cd03357         117 KPITIGDNVWIGGGVIILPGVTIGDNSVIGAGSVVTKDIPANVVAA  162 (169)
T ss_pred             CCEEECCCCEECCCCEEECCCEECCCCEECCCCEECCCCCCCEEEE
T ss_conf             5569897436289978909979999999988987974659991999


No 80 
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function; InterPro: IPR012728    This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide. This domain is roughly 700 amino acids in size and is found in polypeptides roughly twice that size..
Probab=98.89  E-value=2.3e-09  Score=77.96  Aligned_cols=92  Identities=26%  Similarity=0.439  Sum_probs=54.4

Q ss_pred             CCCEEECCEEEC-CCCCCCCCCCCCCC-EECCEEEECCCCEEECCCEECCEE-CC--CCCCCEEECCCCEEECCCEEECC
Q ss_conf             651462010302-35336772015661-232204730686881232112100-57--76564487258478218578468
Q gi|254780781|r  125 PKAVLMPSFVNM-GAYIGEGSMIDTWS-TVGSCAQIGKNVHISGGVGIGGVL-EP--IQTGPTIIEDNCFIGARSEIVEG  199 (285)
Q Consensus       125 ~g~vimp~~Vni-GA~Ig~gt~I~~~a-~IG~~a~IG~~vhI~~g~~IGGvl-ep--~~a~pviIeD~v~IGa~s~I~~G  199 (285)
                      .||=.||.+-+. |++||.++++|+.- +=-+||.||+.+.+..|+.|.--| |.  .....|+|+|.|.+|.+|.|..+
T Consensus       608 ~GTP~l~~~lr~LG~kiGr~v~~d~~~ltE~dLv~IG~d~tlN~G~~~QtHlfeDRv~k~D~v~igdgatlG~~aiVlY~  687 (719)
T TIGR02353       608 RGTPFLPAVLRLLGVKIGRGVYIDTTDLTERDLVTIGDDSTLNEGSVIQTHLFEDRVMKSDTVTIGDGATLGPGAIVLYG  687 (719)
T ss_pred             CCCCHHHHHHHHCCCEECCCCEECCCCCCCHHHEEECCCCEECCCCCEECCCCCCCEEEECEEEEECEEEECCCCEECCC
T ss_conf             88634799997278245553222675675222036568612468751111400067567452897240388886358573


Q ss_pred             EEECCCCEEEEEEEECC
Q ss_conf             88458856630046527
Q gi|254780781|r  200 CIIREGSVLGMGVFIGK  216 (285)
Q Consensus       200 v~Ig~gavIgaG~vit~  216 (285)
                      +.||++|++|..++|=|
T Consensus       688 ~~~G~~a~lgp~SlVMk  704 (719)
T TIGR02353       688 AVVGEDAVLGPDSLVMK  704 (719)
T ss_pred             EEECCCCEECCCCEEEC
T ss_conf             15568643468432503


No 81 
>KOG1461 consensus
Probab=98.87  E-value=4.6e-09  Score=76.08  Aligned_cols=165  Identities=20%  Similarity=0.267  Sum_probs=93.0

Q ss_pred             HHHHHHH--HHHHCCCEEEEEECCC------CCEEEEHHHHHHHHH---EEECCCCEEEECCCCCCCHHHCCCCCCCCCC
Q ss_conf             9999999--9730793799887599------968860788623222---0642674476247764201101775323652
Q gi|254780781|r   32 DAVQSTL--DLLDRGIIRIASRDDN------GHWNTHQWIKKAILL---SFQINPTKIISDGNGYSTWWDKIPAKFDDWK  100 (285)
Q Consensus        32 ~aI~~~I--~~LD~G~iRVAEk~~n------G~W~VNeWvKKAILL---~Fri~~~~~i~~g~~~~~~~DKvp~Kf~~~~  100 (285)
                      +-|..+|  +.|+ =+|-+++-.+.      -.|++-.-+-|-||-   |+.+-++....  ...+.+     .++.-|.
T Consensus       247 DfV~GvL~~dilg-~kI~~~~~~~~~yA~rv~n~~syd~vSkDiI~RW~YP~Vpd~~~~~--~q~~~~-----~r~~IYk  318 (673)
T KOG1461         247 DFVRGVLVDDILG-YKIHVHVLSSIDYAARVENLRSYDLVSKDIIQRWTYPLVPDINFSG--NQTFSL-----ERRNIYK  318 (673)
T ss_pred             HHHHHHHHHHHCC-CEEEEEECCHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCCCCC--CCEEEE-----CCCCCCC
T ss_conf             4665433665427-7689997573544431343188888889999751456556666778--742431-----1244014


Q ss_pred             HHHHH-HCCCCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCC
Q ss_conf             02344-24751025431035640066514620103023533677201566123220473068688123211210057765
Q gi|254780781|r  101 TKDFE-KHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQT  179 (285)
Q Consensus       101 ~~~f~-~~g~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a  179 (285)
                      ..+-. .+.+.+.-+-.+..|..||.|+.|+.|+|      |.||-|++.++|-+ +.|+++|.|+.|+.|.        
T Consensus       319 ~~dv~~~~~~~v~~~~~ig~gT~Ig~g~~I~NSVI------G~~c~IgsN~~I~~-S~iw~~v~Igdnc~I~--------  383 (673)
T KOG1461         319 SPDVVLSHSVIVGANVVIGAGTKIGSGSKISNSVI------GANCRIGSNVRIKN-SFIWNNVTIGDNCRID--------  383 (673)
T ss_pred             CCCCEEHHHCCCCCEEEECCCCCCCCCCEEECCEE------CCCCEECCCEEEEE-EEEECCCEECCCCEEE--------
T ss_conf             74010001201244079514541267985552266------58977457458851-3662583887886573--------


Q ss_pred             CCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEE
Q ss_conf             64487258478218578468884588566300465278336
Q gi|254780781|r  180 GPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKI  220 (285)
Q Consensus       180 ~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i  220 (285)
                       ..+|.|+|-|+++|.+-+|+++|.+.|+|.+-++-+.++|
T Consensus       384 -~aii~d~v~i~~~~~l~~g~vl~~~VVv~~~~~l~~ns~~  423 (673)
T KOG1461         384 -HAIICDDVKIGEGAILKPGSVLGFGVVVGRNFVLPKNSKV  423 (673)
T ss_pred             -EEEEECCCEECCCCCCCCCCEEEEEEEECCCCCCCCCCCC
T ss_conf             -4686058376788440788577521686798312454433


No 82 
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional
Probab=98.83  E-value=1.8e-08  Score=72.48  Aligned_cols=34  Identities=24%  Similarity=0.299  Sum_probs=19.6

Q ss_pred             CEEECCCEEECCEEECCCCEEEEEEEECCCCEEEE
Q ss_conf             47821857846888458856630046527833687
Q gi|254780781|r  188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIID  222 (285)
Q Consensus       188 v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d  222 (285)
                      |-||.||.|. +++|++++.||+|+.|.....+-+
T Consensus       367 v~IG~~~~i~-~aIidk~~~Ig~~~~I~~~~~~~~  400 (429)
T PRK02862        367 VGIGEGTTIK-RAIIDKNARIGNNVTIVNKDNVEE  400 (429)
T ss_pred             CCCCCCCEEE-CCEECCCCEECCCCEECCCCCCCC
T ss_conf             6799899997-589878989999998978987764


No 83 
>PRK10092 maltose O-acetyltransferase; Provisional
Probab=98.81  E-value=2.5e-08  Score=71.55  Aligned_cols=82  Identities=23%  Similarity=0.274  Sum_probs=61.9

Q ss_pred             CCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEEC------------------CEEECCCCEEEEEEEE
Q ss_conf             2204730686881232112100577656448725847821857846------------------8884588566300465
Q gi|254780781|r  153 GSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVE------------------GCIIREGSVLGMGVFI  214 (285)
Q Consensus       153 G~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~------------------Gv~Ig~gavIgaG~vi  214 (285)
                      |....||+||.+.-++.|-.      ..++.|+|||+||.|+.+..                  .++||+++-||++++|
T Consensus        71 G~ni~iG~~~~iN~~~~ilD------~~~I~IG~~v~iGpnv~i~t~~Hp~d~~~R~~~~~~~~pi~Ig~~vwig~~~~i  144 (183)
T PRK10092         71 GYNIFLGNNFYANFDCVMLD------VCPIHIGDNCMLAPGVHIYTATHPLDPVARNSGAELGKPVTIGNNVWIGGRAVI  144 (183)
T ss_pred             CCCEEECCCEEEECCEEEEE------CCCEEECCCEEECCCCEEECCCCCCCHHHHHCCCEECCCEEECCCCEECCCCEE
T ss_conf             77878678769927849994------787399998058499789859998898895258631687798998688899899


Q ss_pred             CCCCEEEE---CCCCCEEEEECCCCCEEE
Q ss_conf             27833687---158814644549987896
Q gi|254780781|r  215 GKSTKIID---RNTGEITYGEVPSYSVVV  240 (285)
Q Consensus       215 t~st~i~d---~~~~~~~~g~vP~~~vvv  240 (285)
                      .+++.|.|   +..|.+...+||++++++
T Consensus       145 ~pGv~IG~~~vigagsvV~~dip~~~v~~  173 (183)
T PRK10092        145 NPGVTIGDNVVVASGAVVTKDVPDNVVVG  173 (183)
T ss_pred             ECCCEECCCCEECCCCEEEEECCCCCEEE
T ss_conf             07989999989975988922779992999


No 84 
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional
Probab=98.80  E-value=2.8e-08  Score=71.26  Aligned_cols=98  Identities=24%  Similarity=0.204  Sum_probs=50.9

Q ss_pred             CCCCCCCCEECCCCCCCCCCEEECCEEE---CCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEE
Q ss_conf             7510254310356400665146201030---2353367720156612322047306868812321121005776564487
Q gi|254780781|r  108 NFRIIPGTIVRHSAYIGPKAVLMPSFVN---MGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII  184 (285)
Q Consensus       108 g~rv~P~a~vr~ga~Ig~g~vimp~~Vn---iGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviI  184 (285)
                      ..++.|++.+..+|.|.+.++.-+|+|.   ..+.|+.++.|+.+|+|.+| .|+.+|+|+.++.|.         ..||
T Consensus       276 ~~~~~~p~~i~~~~~I~~s~i~~gc~I~g~V~nSvIg~~v~Ig~ga~I~nS-iI~~~~~Ig~~~~I~---------nsIi  345 (381)
T PRK05293        276 VNPILPPQYIAENAKVKNSLVVEGCEVYGTVKHSVLFQGVQVGEGSIVKDS-VIMPGAKIGENVVIE---------RAII  345 (381)
T ss_pred             CCCCCCCEEECCCCEEECCEECCCCEEEEEEECCEECCCCEECCCCEEECC-EECCCCEECCCCEEE---------EEEE
T ss_conf             687789929879978968889079899626754898899899999999778-985969999899990---------1299


Q ss_pred             CCCCEEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             25847821857846888458856630046527
Q gi|254780781|r  185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       185 eD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                      +.+|.||.|+++.. .++++.+|||-|++|+.
T Consensus       346 ~~~~~Ig~~~~~~~-~~~~~~~vi~~~~~~~~  376 (381)
T PRK05293        346 GENAVIGDGVIGVI-SGIDEVVVIGEGEVVGV  376 (381)
T ss_pred             CCCCEECCCCEEEC-CEECCCEEECCCCEECC
T ss_conf             59799997968957-74268889899948897


No 85 
>PRK03282 consensus
Probab=98.77  E-value=6.4e-08  Score=69.09  Aligned_cols=88  Identities=19%  Similarity=0.302  Sum_probs=59.3

Q ss_pred             CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             35336772015661232204730686881232112100577656448725847821857846888458856630046527
Q gi|254780781|r  137 GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       137 GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                      .+.|+.||.|+. ++|.+ +.||.+|.|+.||.|-         ..||-++|.||.||.|. .++++++++||+|+.|+.
T Consensus       313 ~S~i~~G~vI~g-~~V~n-SvIg~~v~Ig~ga~I~---------~SIIm~~~~Ig~~a~l~-~~Iidk~v~Ig~g~~Ig~  380 (406)
T PRK03282        313 ESIVSAGSIISG-ASVRN-SVLSPNVVVDSGAIVE---------GSVLMPGVRIGRGAVVR-HAILDKNVVVPPGAMVGV  380 (406)
T ss_pred             CCEECCCCEEEC-CEEEC-CEECCCCEECCCCEEE---------CCEEECCCEECCCCEEE-CCEECCCCEECCCCEECC
T ss_conf             778648859859-98889-9978998999998997---------08890968999999997-319899999998989998


Q ss_pred             CCEEEECCCCCEEEEECCCCCEEEC
Q ss_conf             8336871588146445499878960
Q gi|254780781|r  217 STKIIDRNTGEITYGEVPSYSVVVP  241 (285)
Q Consensus       217 st~i~d~~~~~~~~g~vP~~~vvvp  241 (285)
                       .+-  +  .+--|-.-+.+-|||+
T Consensus       381 -~~~--~--~~~~~~~~~~g~v~~~  400 (406)
T PRK03282        381 -DPE--R--DRARFTVSAGGVVVVG  400 (406)
T ss_pred             -CCC--C--CCCCCEEECCEEEEEE
T ss_conf             -842--0--0007879378589992


No 86 
>COG1045 CysE Serine acetyltransferase [Amino acid transport and metabolism]
Probab=98.76  E-value=7.2e-09  Score=74.91  Aligned_cols=89  Identities=28%  Similarity=0.292  Sum_probs=65.1

Q ss_pred             HCCCCCCCCCEECCCCCCCCCCEEE---CCEEECCCCCCCCCCCCCCCEECC--------EEEECCCCEEECCCEECCEE
Q ss_conf             2475102543103564006651462---010302353367720156612322--------04730686881232112100
Q gi|254780781|r  106 KHNFRIIPGTIVRHSAYIGPKAVLM---PSFVNMGAYIGEGSMIDTWSTVGS--------CAQIGKNVHISGGVGIGGVL  174 (285)
Q Consensus       106 ~~g~rv~P~a~vr~ga~Ig~g~vim---p~~VniGA~Ig~gt~I~~~a~IG~--------~a~IG~~vhI~~g~~IGGvl  174 (285)
                      ..-.|..-+.-+.++|.||+|..+-   +-+|+--|.||+++.|-.+.|+|.        +-.||++|.|++|+.|=|  
T Consensus        59 ~~~~~~~~gieIhp~A~IG~g~fIdHg~GvVIgeta~IGddv~I~~gVTLGgtg~~~g~RhPtIg~~V~IGagAkILG--  136 (194)
T COG1045          59 SSLSRFLFGIEIHPGAKIGRGLFIDHGTGVVIGETAVIGDDVTIYHGVTLGGTGKESGKRHPTIGNGVYIGAGAKILG--  136 (194)
T ss_pred             HHHHHHHCCEEECCCCEECCCEEECCCCEEEECCEEEECCCEEEEECEEECCCCCCCCCCCCCCCCCEEECCCCEEEC--
T ss_conf             998886303134777727785687377558976424987972897061766887877877983178859899988971--


Q ss_pred             CCCCCCCEEECCCCEEECCCEEECCEEE
Q ss_conf             5776564487258478218578468884
Q gi|254780781|r  175 EPIQTGPTIIEDNCFIGARSEIVEGCII  202 (285)
Q Consensus       175 ep~~a~pviIeD~v~IGa~s~I~~Gv~I  202 (285)
                            +..|+||+.|||||+|+..|--
T Consensus       137 ------~I~IGd~a~IGA~sVVlkdVP~  158 (194)
T COG1045         137 ------NIEIGDNAKIGAGSVVLKDVPP  158 (194)
T ss_pred             ------CEEECCCCEECCCCEECCCCCC
T ss_conf             ------6688789788878668157899


No 87 
>cd03354 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine. This reaction represents a key metabolic point of regulation for the cysteine biosynthetic pathway due to its feedback inhibition by cysteine. The enzyme is a 175 kDa homohexamer, composed of a dimer of homotrimers. Each subunit contains an N-terminal alpha helical region and a C-terminal left-handed beta-helix (LbH) subdomain with 5 turns, each containing a hexapeptide repeat motif characteristic of the acyltransferase superfamily of enzymes. The trimer interface mainly involves the C-terminal LbH subdomain while the dimer (of trimers) interface is mediated by the N-terminal alpha helical subdomain.
Probab=98.74  E-value=2e-08  Score=72.17  Aligned_cols=84  Identities=30%  Similarity=0.376  Sum_probs=58.4

Q ss_pred             CEECCCCCCCCCCEEE-CC--EEECCCCCCCCCCCCCCCEECCEE--------EECCCCEEECCCEECCEECCCCCCCEE
Q ss_conf             3103564006651462-01--030235336772015661232204--------730686881232112100577656448
Q gi|254780781|r  115 TIVRHSAYIGPKAVLM-PS--FVNMGAYIGEGSMIDTWSTVGSCA--------QIGKNVHISGGVGIGGVLEPIQTGPTI  183 (285)
Q Consensus       115 a~vr~ga~Ig~g~vim-p~--~VniGA~Ig~gt~I~~~a~IG~~a--------~IG~~vhI~~g~~IGGvlep~~a~pvi  183 (285)
                      ..+.++|+|++++.++ ++  +++-++.||++++|.+++++|+..        .||++|.|++++.|-        ..+.
T Consensus         3 v~I~~~~~IG~~~~I~~~~~v~Ig~~~~Ig~~~~I~~~~~ig~~~~~~~~~~~~Ig~~v~IG~~~~I~--------~gv~   74 (101)
T cd03354           3 IDIHPGAKIGPGLFIDHGTGIVIGETAVIGDNCTIYQGVTLGGKGKGGGKRHPTIGDNVVIGAGAKIL--------GNIT   74 (101)
T ss_pred             CEECCCCEECCCEEECCCCCEEECCCCEECCCCEECCCCEECCCCCCCCCCCCCCCCCEEECCCCEEE--------CCCE
T ss_conf             29899999994929919987799999899999899888788663114687776148758635898892--------9879


Q ss_pred             ECCCCEEECCCEEECCEEECCCCEE
Q ss_conf             7258478218578468884588566
Q gi|254780781|r  184 IEDNCFIGARSEIVEGCIIREGSVL  208 (285)
Q Consensus       184 IeD~v~IGa~s~I~~Gv~Ig~gavI  208 (285)
                      |+|+|+|||+|.|...+  .+++++
T Consensus        75 IG~~~vIgagsvV~~dv--~~~si~   97 (101)
T cd03354          75 IGDNVKIGANAVVTKDV--PANSTV   97 (101)
T ss_pred             ECCCCEECCCCEECCCC--CCCCEE
T ss_conf             99987998798899685--999899


No 88 
>cd05825 LbH_wcaF_like wcaF-like: This group is composed of the protein product of the E. coli wcaF gene and similar proteins. WcaF is part of the gene cluster responsible for the biosynthesis of the extracellular polysaccharide colanic acid. The wcaF protein is predicted to contain a left-handed parallel beta-helix (LbH) domain encoded by imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity. Many are trimeric in their active forms.
Probab=98.74  E-value=5.2e-08  Score=69.64  Aligned_cols=60  Identities=17%  Similarity=0.381  Sum_probs=40.5

Q ss_pred             CEEECCCCEEECCCEE---------------ECCEEECCCCEEEEEEEECCCCEEEE---CCCCCEEEEECCCCCEEE
Q ss_conf             4487258478218578---------------46888458856630046527833687---158814644549987896
Q gi|254780781|r  181 PTIIEDNCFIGARSEI---------------VEGCIIREGSVLGMGVFIGKSTKIID---RNTGEITYGEVPSYSVVV  240 (285)
Q Consensus       181 pviIeD~v~IGa~s~I---------------~~Gv~Ig~gavIgaG~vit~st~i~d---~~~~~~~~g~vP~~~vvv  240 (285)
                      ++.|+|||.|+.++.|               ..+++||+++.||++++|.+.+.|.|   +..+.+..+++|++++++
T Consensus        23 ~i~IG~~~~i~~~v~I~~~~h~~~~~~~~~~~~~v~Ig~~v~IG~~~~I~~gv~Ig~~svVgagSvV~kdvp~~~i~~  100 (107)
T cd05825          23 PVTIGSDACISQGAYLCTGSHDYRSPAFPLITAPIVIGDGAWVAAEAFVGPGVTIGEGAVVGARSVVVRDLPAWTVYA  100 (107)
T ss_pred             CEEECCCCEECCCCEECCCCCCCCCCCCCEECCCEEECCCCEECCCCEEECCCEECCCCEEECCCEECCCCCCCCEEE
T ss_conf             579999739959959707888876766531639979938858749878969919189979948988903859997998


No 89 
>PRK03701 consensus
Probab=98.73  E-value=4.9e-08  Score=69.81  Aligned_cols=94  Identities=16%  Similarity=0.287  Sum_probs=66.4

Q ss_pred             CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             35336772015661232204730686881232112100577656448725847821857846888458856630046527
Q gi|254780781|r  137 GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       137 GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                      ++.|+.||+|+. +.|.+ +.|+.+|+|+.||.|-         ..||-++|.||.||.|. .++|.++++|++|++|+-
T Consensus       331 nSlia~GciI~G-~~V~n-SVl~r~v~I~~gA~V~---------nSIIm~~~~Ig~ga~l~-~~IiDk~v~I~~g~vIg~  398 (431)
T PRK03701        331 NSLVSGGCIISG-SVVVQ-SVLFPRVRVNSFCNID---------SAVLLPEVWVGRSCRLR-RCVIDRACVIPEGMVIGE  398 (431)
T ss_pred             CCEEECCEEEEC-CEEEC-CCCCCCCEECCCCEEE---------CCEECCCCEECCCCEEE-EEEECCCCEECCCCEECC
T ss_conf             789859989938-48880-9811888999998997---------26985969899999998-379899999997999896


Q ss_pred             CCEEEECCCCCEEEEECCCCCEEECCCCCCC
Q ss_conf             8336871588146445499878960564455
Q gi|254780781|r  217 STKIIDRNTGEITYGEVPSYSVVVPGSYPSI  247 (285)
Q Consensus       217 st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~  247 (285)
                           |.+.+.--+-..+.+-||||...-.+
T Consensus       399 -----~~~~d~~~~~~~~~givv~~~~~~~~  424 (431)
T PRK03701        399 -----NAEEDARRFYRSEEGIVLVTREMLRK  424 (431)
T ss_pred             -----CHHHHCCCEEEECCEEEEECHHHHHH
T ss_conf             -----83674208099079599989899987


No 90 
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY; InterPro: IPR011974    Members of this family are located next to other genes organised into apparent operons for phenylacetic acid degradation . PaaY is located near the end of these gene clusters and often next to PaaX, a transcriptional regulator..
Probab=98.72  E-value=2.6e-08  Score=71.47  Aligned_cols=99  Identities=23%  Similarity=0.483  Sum_probs=73.1

Q ss_pred             CCCCCCCCCCEEECC----EEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECC
Q ss_conf             356400665146201----0302353367720156612322047306868812321121005776564487258478218
Q gi|254780781|r  118 RHSAYIGPKAVLMPS----FVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGAR  193 (285)
Q Consensus       118 r~ga~Ig~g~vimp~----~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~  193 (285)
                      -+++||||.+-|-+-    .+.=||.|.+.|.....  =|.+..+++|=|++-||.+-|         .+|+.|++||-|
T Consensus        30 G~rcYvgPlASLRGDFGrIvl~eGAN~QD~CVMHGF--Pg~DTvVeenGHvGHgAiLHg---------C~vgrnaLvGMN   98 (193)
T TIGR02287        30 GKRCYVGPLASLRGDFGRIVLKEGANVQDTCVMHGF--PGQDTVVEENGHVGHGAILHG---------CRVGRNALVGMN   98 (193)
T ss_pred             CCCCEECCCCCCCCCCCCEEEECCCCCCCCCEECCC--CCCCEEEECCCCCCCCEEECC---------CEECCCCEECCC
T ss_conf             795246766313577572575348861464243672--998867606882332123515---------463252311165


Q ss_pred             CEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEE
Q ss_conf             57846888458856630046527833687158814644549987896
Q gi|254780781|r  194 SEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV  240 (285)
Q Consensus       194 s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvv  240 (285)
                      |+|.+|..||+.|+++|-+|+.+..             ++||.++|+
T Consensus        99 AVVMDgAvige~sIVaA~aFVKAg~-------------E~paq~Lv~  132 (193)
T TIGR02287        99 AVVMDGAVIGERSIVAASAFVKAGA-------------EIPAQVLVV  132 (193)
T ss_pred             EEEECCCEECCCCCEEHHHHHHCCC-------------CCCCCCEEE
T ss_conf             0661664667741200203343473-------------478461266


No 91 
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon). eIF2B is important for regenerating GTP-bound eIF2 during the initiation process. This event is obligatory for eIF2 to bind initiator methionyl-tRNA, forming the ternary initiation complex. The eIF-2B epsilon subunit contains an N-terminal domain that resembles a dinucleotide-binding Rossmann fold, a central LbH domain containing 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), and a C-terminal domain of unknown function that is present in eIF-4 gamma, eIF-5, and eIF-2B epsilon. The epsilon and gamma subunits form the catalytic subcomplex of eIF-2B, which binds eIF2 and catalyzes guanine nucleotide exchange.
Probab=98.71  E-value=4.6e-08  Score=69.94  Aligned_cols=77  Identities=30%  Similarity=0.434  Sum_probs=36.3

Q ss_pred             CCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCE
Q ss_conf             36772015661232204730686881232112100577656448725847821857846888458856630046527833
Q gi|254780781|r  140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTK  219 (285)
Q Consensus       140 Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~  219 (285)
                      ||++|.|+.+++|.. +.||+||+|++++.|-.-   .=...+.|+|+|.| .+|.|.+++.|++++.|..|++|+..+.
T Consensus         2 IG~~t~Ig~~~~I~~-svIG~nc~Ig~~~~I~~s---vi~d~~~Ig~~~~i-~~siI~~~~~Ig~~~~i~~g~vIg~~~~   76 (79)
T cd05787           2 IGRGTSIGEGTTIKN-SVIGRNCKIGKNVVIDNS---YIWDDVTIEDGCTI-HHSIVADGAVIGKGCTIPPGSLISFGVV   76 (79)
T ss_pred             CCCCCEECCCCEEEC-CEECCCCEECCCCEEECC---EEECCCEECCCCEE-CCCEECCCCEECCCCEECCCCEECCCCE
T ss_conf             999899999999959-998999999999889489---99197899999999-0899979899999999999999979979


Q ss_pred             EE
Q ss_conf             68
Q gi|254780781|r  220 II  221 (285)
Q Consensus       220 i~  221 (285)
                      |.
T Consensus        77 Ig   78 (79)
T cd05787          77 IG   78 (79)
T ss_pred             EC
T ss_conf             69


No 92 
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional
Probab=98.70  E-value=4.6e-08  Score=69.95  Aligned_cols=87  Identities=25%  Similarity=0.265  Sum_probs=54.5

Q ss_pred             CCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECC
Q ss_conf             43103564006651462010302353367720156612322047306868812321121005776564487258478218
Q gi|254780781|r  114 GTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGAR  193 (285)
Q Consensus       114 ~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~  193 (285)
                      ...+.+.+++++++.+-+      +.|++||.|+.  .|. .+.||++|.|+.|+.|-         ..+|.++|.||++
T Consensus       276 ~~~~~~p~~i~~~~~I~~------s~i~~gc~I~g--~V~-nSvIg~~v~Ig~ga~I~---------nSiI~~~~~Ig~~  337 (381)
T PRK05293        276 VNPILPPQYIAENAKVKN------SLVVEGCEVYG--TVK-HSVLFQGVQVGEGSIVK---------DSVIMPGAKIGEN  337 (381)
T ss_pred             CCCCCCCEEECCCCEEEC------CEECCCCEEEE--EEE-CCEECCCCEECCCCEEE---------CCEECCCCEECCC
T ss_conf             687789929879978968------88907989962--675-48988998999999997---------7898596999989


Q ss_pred             CEEECCEEECCCCEEEEEEEECCCCE
Q ss_conf             57846888458856630046527833
Q gi|254780781|r  194 SEIVEGCIIREGSVLGMGVFIGKSTK  219 (285)
Q Consensus       194 s~I~~Gv~Ig~gavIgaG~vit~st~  219 (285)
                      |.| +..+|+++++||.|+++..+++
T Consensus       338 ~~I-~nsIi~~~~~Ig~~~~~~~~~~  362 (381)
T PRK05293        338 VVI-ERAIIGENAVIGDGVIGVISGI  362 (381)
T ss_pred             CEE-EEEEECCCCEECCCCEEECCEE
T ss_conf             999-0129959799997968957742


No 93 
>cd04647 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins. MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates. MAT acetylates maltose and glucose exclusively while GAT specifically acetylates galactopyranosides. XAT catalyzes the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients. Members of this family contain a a left-handed parallel beta-helix (LbH) domain with at least 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). They are trimeric in their active form.
Probab=98.70  E-value=7.6e-08  Score=68.62  Aligned_cols=93  Identities=25%  Similarity=0.255  Sum_probs=61.7

Q ss_pred             CCCCCCCCCCCEEC--CEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCC
Q ss_conf             36772015661232--2047306868812321121005776564487258478218578468884588566300465278
Q gi|254780781|r  140 IGEGSMIDTWSTVG--SCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKS  217 (285)
Q Consensus       140 Ig~gt~I~~~a~IG--~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~s  217 (285)
                      ||+++.|+.++.+.  ....||++|.|+.++.|.+-       ...+.++...+.+..+..+++||+++.||++++|.+.
T Consensus         4 IG~~~~Ig~~~~I~~~~~i~IG~~~~I~~~~~i~~~-------~~~~~~~~~~~~~~~~~~~v~Ig~~v~IG~~~~I~~g   76 (109)
T cd04647           4 IGDNVYIGPGCVISAGGGITIGDNVLIGPNVTIYDH-------NHDIDDPERPIEQGVTSAPIVIGDDVWIGANVVILPG   76 (109)
T ss_pred             ECCCCEECCCCEEECCCCEEECCCCEECCEEEEEEE-------EEECCCCCEECCCCCEECCEEEECCCEECCCEEEEEC
T ss_conf             999989999999968988799998499350898330-------0132887525267637189799423578898399285


Q ss_pred             CEEEE---CCCCCEEEEECCCCCEE
Q ss_conf             33687---15881464454998789
Q gi|254780781|r  218 TKIID---RNTGEITYGEVPSYSVV  239 (285)
Q Consensus       218 t~i~d---~~~~~~~~g~vP~~~vv  239 (285)
                      ++|.+   +..+.+...++|+++++
T Consensus        77 v~Ig~~~iIga~SvV~k~i~~~~i~  101 (109)
T cd04647          77 VTIGDGAVVGAGSVVTKDVPPNSIV  101 (109)
T ss_pred             CEECCCCEECCCCEECCCCCCCCEE
T ss_conf             1308986993798891483999899


No 94 
>PRK04928 consensus
Probab=98.69  E-value=7.1e-08  Score=68.83  Aligned_cols=90  Identities=21%  Similarity=0.290  Sum_probs=58.5

Q ss_pred             CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             35336772015661232204730686881232112100577656448725847821857846888458856630046527
Q gi|254780781|r  137 GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       137 GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                      ++.|+.||.|+ ++.|.+ +.||.+|+|+.|+.|-         ..||-++|.||+||.|. +++|++++.||+|++|+.
T Consensus       311 ~s~I~~G~~I~-G~~I~~-SvIg~~~~Ig~ga~I~---------nSII~~~~~Ig~ga~i~-~sIidk~v~Ig~g~~I~~  378 (405)
T PRK04928        311 DSLISGGSYIR-GSRIEK-SVLGFRSNIASACDIS---------ESVLLGDVKIGEGCVLR-RVIIDKDVEIAPGTQIGE  378 (405)
T ss_pred             CCEECCCCEEE-CCEEEC-CEECCCCEECCCCEEE---------CCEEECCCEECCCCEEE-CCEECCCCEECCCCEECC
T ss_conf             66887887898-999876-8976998999994995---------58996929999999996-549889999999999983


Q ss_pred             CCEEEECCCCCEEEEECCCCCEEECCC
Q ss_conf             833687158814644549987896056
Q gi|254780781|r  217 STKIIDRNTGEITYGEVPSYSVVVPGS  243 (285)
Q Consensus       217 st~i~d~~~~~~~~g~vP~~~vvvpg~  243 (285)
                      . ..-|..  ..+  -.+.+-||||..
T Consensus       379 ~-~~~d~~--~~~--v~~~g~v~v~~~  400 (405)
T PRK04928        379 N-LEEDKK--RFH--VSDEGIVVIPKG  400 (405)
T ss_pred             C-HHHCCC--CCE--EECCEEEEECCC
T ss_conf             7-145166--618--956889998799


No 95 
>cd00208 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity, however, some subfamilies in this hierarchy also show activities related to ion transport or translation initiation. Many are trimeric in their active forms.
Probab=98.69  E-value=3e-08  Score=71.10  Aligned_cols=52  Identities=33%  Similarity=0.440  Sum_probs=34.3

Q ss_pred             CCCCCCCCCCCCCCEECC--------EEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEE
Q ss_conf             353367720156612322--------047306868812321121005776564487258478218578
Q gi|254780781|r  137 GAYIGEGSMIDTWSTVGS--------CAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEI  196 (285)
Q Consensus       137 GA~Ig~gt~I~~~a~IG~--------~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I  196 (285)
                      .++||++++|..+++++.        ...||++|+|++++.|.+        .+.|+|||+|||+|.|
T Consensus        18 ~v~IG~~~~I~~~~~I~~~~~~~~~~~~~Ig~~v~Ig~~a~I~~--------gv~IGdn~~IgagavV   77 (78)
T cd00208          18 PVVIGDNVNIGPGAVIGAATGPNEKNPTIIGDNVEIGANAVIHG--------GVKIGDNAVIGAGAVV   77 (78)
T ss_pred             CEEECCCCEECCCCEEEECCCCCCCCCCEECCCEEECCCCEEEC--------CEEECCCCEECCCCEE
T ss_conf             26999999899998996379886678989999969986898979--------8199999999988569


No 96 
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional
Probab=98.68  E-value=5.7e-08  Score=69.40  Aligned_cols=70  Identities=21%  Similarity=0.356  Sum_probs=52.7

Q ss_pred             CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             35336772015661232204730686881232112100577656448725847821857846888458856630046527
Q gi|254780781|r  137 GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       137 GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                      ++.|+.||.|+ +++|.+ +.||++|+|+.|+.|-         ..||-++|.||++|.|. .++|+++++||+|++|+.
T Consensus       315 ~s~I~~g~~I~-g~~V~n-SvIg~~v~Ig~ga~I~---------nSII~~~~~Ig~~a~I~-~sIidk~v~Ig~gt~I~~  382 (409)
T PRK00844        315 DSIVSAGSIIS-GGSVRN-SVLSPNVRVDSGAIVE---------GSVLMDGVRIGRGAVVR-RAILDKNVVVPPGTQIGV  382 (409)
T ss_pred             CCEECCCEEEE-CCEEEC-CEECCCCEECCCCEEE---------CCEEECCCEECCCCEEE-EEEECCCCEECCCCEECC
T ss_conf             58887970996-998888-8977998999998995---------18992949999999998-019899989899989897


Q ss_pred             CC
Q ss_conf             83
Q gi|254780781|r  217 ST  218 (285)
Q Consensus       217 st  218 (285)
                      .+
T Consensus       383 ~~  384 (409)
T PRK00844        383 DL  384 (409)
T ss_pred             CC
T ss_conf             80


No 97 
>PRK10191 putative colanic acid biosynthesis acetyltransferase WcaB; Provisional
Probab=98.64  E-value=5.9e-08  Score=69.31  Aligned_cols=88  Identities=19%  Similarity=0.307  Sum_probs=62.9

Q ss_pred             CCCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCE-------EEECCCCEEECCCEECCEECCCCCC
Q ss_conf             751025431035640066514620103023533677201566123220-------4730686881232112100577656
Q gi|254780781|r  108 NFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSC-------AQIGKNVHISGGVGIGGVLEPIQTG  180 (285)
Q Consensus       108 g~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~-------a~IG~~vhI~~g~~IGGvlep~~a~  180 (285)
                      |+.+-|+|.+-+|-+|.-+.   +-+++-.+.||++|.|-.++|+|..       -.||+||.|++|+.|-|        
T Consensus        41 GieI~p~a~IG~gl~I~H~~---GiVIg~~~~IG~n~~I~q~VTiG~~~~~~~~~P~Ig~~V~Igaga~IlG--------  109 (146)
T PRK10191         41 GYEIQAAATIGRRFTIHHGY---AVVINKNVVAGDDFTIRHGVTIGNRGADNMACPHIGNGVELGANVIILG--------  109 (146)
T ss_pred             EEEECCCCEECCCEEEECCE---EEEECCCEEECCCEEEECCEEECCCCCCCCCCCEECCCEEEECCCEEEC--------
T ss_conf             99508998878987983782---5899997198998099488788886787789898799959928999964--------


Q ss_pred             CEEECCCCEEECCCEEECCEEECCCCEE
Q ss_conf             4487258478218578468884588566
Q gi|254780781|r  181 PTIIEDNCFIGARSEIVEGCIIREGSVL  208 (285)
Q Consensus       181 pviIeD~v~IGa~s~I~~Gv~Ig~gavI  208 (285)
                      ++.|+|||.|||||.|...+  -.+++.
T Consensus       110 ~i~IG~~~~IGA~svV~~dv--p~~~~v  135 (146)
T PRK10191        110 DITLGNNVTVGAGSVVLDSV--PDNALV  135 (146)
T ss_pred             CCEECCCCEECCCCEECCCC--CCCCEE
T ss_conf             85999999999895897035--999999


No 98 
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase. It catalyzes the synthesis of GDP-mannose from GTP and mannose-1-phosphate, and is involved in the maintenance of cell wall integrity and glycosylation. Similar to ADP-glucose pyrophosphorylase, it contains an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH fold domain, presumably with 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=98.62  E-value=7.8e-08  Score=68.55  Aligned_cols=78  Identities=21%  Similarity=0.338  Sum_probs=43.7

Q ss_pred             CCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEE
Q ss_conf             02543103564006651462010302353367720156612322047306868812321121005776564487258478
Q gi|254780781|r  111 IIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI  190 (285)
Q Consensus       111 v~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~I  190 (285)
                      +-|+|.+.++|+|||++++-|     ++.||+|      +++.+ +.|.+++.|..++.|..         .+|+++|.|
T Consensus         2 Idpsa~Ig~~~~IGp~vvIG~-----nv~IG~g------v~I~~-~vI~~~~~I~~~s~i~~---------siIG~~~~i   60 (80)
T cd05824           2 IDPSAKIGKTAKIGPNVVIGP-----NVTIGDG------VRLQR-CVILSNSTVRDHSWVKS---------SIVGWNSTV   60 (80)
T ss_pred             CCCCCEECCCCEECCCCEECC-----CCEECCC------CEEEE-EEEECCCEECCCCEEEC---------CEECCCCCC
T ss_conf             378789899999999858999-----9999999------79973-08957899989869978---------998579704


Q ss_pred             ECCCEEECCEEECCCCEEE
Q ss_conf             2185784688845885663
Q gi|254780781|r  191 GARSEIVEGCIIREGSVLG  209 (285)
Q Consensus       191 Ga~s~I~~Gv~Ig~gavIg  209 (285)
                      |..+.+.+++.+|+++.|+
T Consensus        61 G~~~ri~~~~viGd~v~I~   79 (80)
T cd05824          61 GRWTRLENVTVLGDDVTIK   79 (80)
T ss_pred             CCCEEECCCCEECCCCEEC
T ss_conf             8940365862988986988


No 99 
>PRK09677 putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ; Provisional
Probab=98.62  E-value=1.9e-07  Score=66.14  Aligned_cols=91  Identities=21%  Similarity=0.238  Sum_probs=57.0

Q ss_pred             CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEEC------------------
Q ss_conf             35336772015661232204730686881232112100577656448725847821857846------------------
Q gi|254780781|r  137 GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVE------------------  198 (285)
Q Consensus       137 GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~------------------  198 (285)
                      +.++|.++.++.+..  .--.||+||+|+.++.|..      ...+.|+|||.||+++.|.+                  
T Consensus        49 ~~~~g~~~rl~~~~~--gkl~IGdNv~Ig~~~~I~~------~~~I~IG~nVlIa~~V~I~d~nH~~~~~~~~~~~~~~~  120 (192)
T PRK09677         49 GFTSGVGLRLDAFGR--GKLFFGDNVQVNDYVHIAC------IESITIGRDTLIASKVFITDHNHGSFKHSDDFSSPNLP  120 (192)
T ss_pred             CEEECCCEEEEEECC--CEEEECCCCEECCCCEEEE------CCCEEECCCCEECCCEEEECCCCCCCCCCCCCCCCCCC
T ss_conf             619668779997067--5089999848999858986------77679899868879889967888765554543456768


Q ss_pred             ---------CEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCC
Q ss_conf             ---------88845885663004652783368715881464454998789605644556
Q gi|254780781|r  199 ---------GCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSIN  248 (285)
Q Consensus       199 ---------Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~  248 (285)
                               +++||+++-||++++|.+++.|             ..++|+=+||...++
T Consensus       121 ~~~~~~~~~pv~Ig~~~wIg~~~~Il~Gv~I-------------g~~~vvgA~SvV~~d  166 (192)
T PRK09677        121 PDMRTLESSAVVIGQRVWIGENVTILPGVSI-------------GNGCIVGANSVVTKS  166 (192)
T ss_pred             CCCCCCCCCCEEECCCCEECCCCEEECCCEE-------------CCCCEECCCCEECCC
T ss_conf             2126677599898999899999999199699-------------999899169999858


No 100
>TIGR01852 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase; InterPro: IPR010137   This entry describes LpxA, an enzyme for the biosynthesis of lipid A, a component of lipopolysaccharide (LPS) in the outer membrane outer leaflet of most Gram-negative bacteria. Some differences are found between lipid A of different species, but this protein represents the first step (from UDP-N-acetyl-D-glucosamine) and appears to be conserved in function. Proteins from this family contain many copies of the bacterial transferase hexapeptide repeat.; GO: 0008780 acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase activity, 0008610 lipid biosynthetic process.
Probab=98.60  E-value=1.6e-07  Score=66.66  Aligned_cols=55  Identities=18%  Similarity=0.336  Sum_probs=26.3

Q ss_pred             CCCCCCCEECCEEEECCCCEEECCCEECCEEC-----------CCCCCCEEECCCCEEECCCEEECC
Q ss_conf             20156612322047306868812321121005-----------776564487258478218578468
Q gi|254780781|r  144 SMIDTWSTVGSCAQIGKNVHISGGVGIGGVLE-----------PIQTGPTIIEDNCFIGARSEIVEG  199 (285)
Q Consensus       144 t~I~~~a~IG~~a~IG~~vhI~~g~~IGGvle-----------p~~a~pviIeD~v~IGa~s~I~~G  199 (285)
                      +++-.++.|+|+|.||+||.++.+|.|+|-.+           .++ .=|.|+..||||..|-|...
T Consensus       108 nllMAysHvAHDC~vGn~vv~aN~a~LAGHV~vgD~a~iGG~~avH-QFvRIG~~aMigG~s~v~~D  173 (257)
T TIGR01852       108 NLLMAYSHVAHDCVVGNHVVLANNATLAGHVEVGDYAIIGGLVAVH-QFVRIGRYAMIGGLSAVSKD  173 (257)
T ss_pred             CEECCCCEEEECCEECCEEEEECCCEECEEEEECCEEEECCCCCEE-EEEEEHHHHHHHHHCCCCCC
T ss_conf             6572053561243688816981363122279988899977897211-01330002322120024678


No 101
>TIGR01172 cysE serine O-acetyltransferase; InterPro: IPR005881    The biosynthesis of L-cysteine is the predominant way by which inorganic sulphur is incorporated into organic compounds. In this process, the most abundant utilizable source of sulphur, inorganic sulphate, is taken up and reduced to sulphide. Sulphide is used to produce L-cysteine, which serves for protein synthesis or the production of other sulphur-containing organic compounds. Two routes for cysteine biosynthesis in nature have been documented. Serine transacetylase (2.3.1.30 from EC) catalyzes steps in pathway I, the activation of L-serine by acetyl-coenzyme A, yielding O-acetyl-L-serine.; GO: 0009001 serine O-acetyltransferase activity, 0006535 cysteine biosynthetic process from serine, 0005737 cytoplasm.
Probab=98.60  E-value=4.9e-08  Score=69.79  Aligned_cols=102  Identities=22%  Similarity=0.273  Sum_probs=75.3

Q ss_pred             CCCHHHCCCCCCCCCCHHHHHHCCCCCCCCCEECCCCCCCCCCEEE---CCEEECCCCCCCCCCCCCCCEECCE------
Q ss_conf             4201101775323652023442475102543103564006651462---0103023533677201566123220------
Q gi|254780781|r   85 YSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM---PSFVNMGAYIGEGSMIDTWSTVGSC------  155 (285)
Q Consensus        85 ~~~~~DKvp~Kf~~~~~~~f~~~g~rv~P~a~vr~ga~Ig~g~vim---p~~VniGA~Ig~gt~I~~~a~IG~~------  155 (285)
                      +.-|.++.+.-      ..|-..=.|+.-+=-|+++|.||+|+.|-   +-+|---|.||+++.|-+++|+|-.      
T Consensus        38 H~Ly~~~~k~l------Ar~~~~~~r~~tgidIHPgA~IG~g~fIDHg~GvVIGETa~iGddv~iyhGVTLGGtgk~~G~  111 (163)
T TIGR01172        38 HALYKRGFKFL------ARLISNFIRVLTGIDIHPGARIGRGVFIDHGTGVVIGETAEIGDDVTIYHGVTLGGTGKEKGV  111 (163)
T ss_pred             HHHHHCCHHHH------HHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCCEEEEEEEEECCCEEEEECEEECCCCCCCCC
T ss_conf             56762463179------999987665530232176430077307775603685003687388378632120678888788


Q ss_pred             ---EEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCE
Q ss_conf             ---473068688123211210057765644872584782185784688
Q gi|254780781|r  156 ---AQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGC  200 (285)
Q Consensus       156 ---a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv  200 (285)
                         =.||++|.|++||.|-|        |..|++|+-|||||+|+..|
T Consensus       112 kRHPt~~~gV~iGAGAKvLG--------~I~vG~~AkiGAnsVVl~dV  151 (163)
T TIGR01172       112 KRHPTIGEGVVIGAGAKVLG--------NIEVGENAKIGANSVVLKDV  151 (163)
T ss_pred             CCCCCCCCCEEEEECCEEEC--------CEEECCCCEECCCEEECCCC
T ss_conf             98882568717840782403--------76677997772332673537


No 102
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional
Probab=98.58  E-value=1.9e-07  Score=66.21  Aligned_cols=91  Identities=16%  Similarity=0.323  Sum_probs=64.6

Q ss_pred             CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             35336772015661232204730686881232112100577656448725847821857846888458856630046527
Q gi|254780781|r  137 GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       137 GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                      ++.|+.||.|+. ++|.+ +.|+.+|+|+.|+.|-         ..||-++|.||.||.|. .++|+++++|++|++|+.
T Consensus       331 nSli~~GcvI~G-~~Ven-SVI~r~v~Ig~gA~V~---------nSIIm~~~~IG~ga~l~-naIiDk~v~I~~G~~Ig~  398 (431)
T PRK00725        331 NSLVSGGCIISG-SVVVQ-SVLFTRVRVNSFSNID---------SAVLLPEVWVGRSCRLR-RCVIDRACVIPEGMVIGE  398 (431)
T ss_pred             CCEEECCEEEEC-CEEEE-CCCCCCCEECCCCEEE---------EEEECCCCEECCCCEEE-EEEECCCCEECCCCEECC
T ss_conf             679839989969-99982-9825998999998996---------13988989889999997-139899989898999896


Q ss_pred             CCEEEECCCCCEEEEECCCCCEEECCCC
Q ss_conf             8336871588146445499878960564
Q gi|254780781|r  217 STKIIDRNTGEITYGEVPSYSVVVPGSY  244 (285)
Q Consensus       217 st~i~d~~~~~~~~g~vP~~~vvvpg~~  244 (285)
                           |...+.-.+-..+.+-|||+--.
T Consensus       399 -----~~~~d~~~~~~~~~G~vvv~~~~  421 (431)
T PRK00725        399 -----NAEEDARRFRRSEEGIVLVTQEM  421 (431)
T ss_pred             -----CHHHHHHCEEEECCEEEEECHHH
T ss_conf             -----85787207499389899988999


No 103
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional
Probab=98.55  E-value=2.1e-07  Score=65.88  Aligned_cols=34  Identities=15%  Similarity=0.031  Sum_probs=20.0

Q ss_pred             EEECCCCEEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             48725847821857846888458856630046527
Q gi|254780781|r  182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       182 viIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                      +-||++|.|- +|+|..+++||.|++|+.+..+..
T Consensus       367 v~IG~~~~i~-~aIidk~~~Ig~~~~I~~~~~~~~  400 (429)
T PRK02862        367 VGIGEGTTIK-RAIIDKNARIGNNVTIVNKDNVEE  400 (429)
T ss_pred             CCCCCCCEEE-CCEECCCCEECCCCEECCCCCCCC
T ss_conf             6799899997-589878989999998978987764


No 104
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase. It catalyzes the first committed and rate-limiting step in starch biosynthesis in plants and glycogen biosynthesis in bacteria. It is the enzymatic site for regulation of storage polysaccharide accumulation in plants and bacteria. The enzyme is a homotetramer, with each subunit containing an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH fold domain with at 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). The LbH domain is involved in cooperative allosteric regulation and oligomerization.
Probab=98.55  E-value=2.6e-07  Score=65.36  Aligned_cols=97  Identities=27%  Similarity=0.369  Sum_probs=63.2

Q ss_pred             CCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEE
Q ss_conf             00665146201030235336772015661232204730686881232112100577656448725847821857846888
Q gi|254780781|r  122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCI  201 (285)
Q Consensus       122 ~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~  201 (285)
                      |+++.+.+-      .+.|++||.|+ .++|.+ +.||++|+|+.++.|-         ..+|.+++.||.+|.+. .++
T Consensus         3 ~~~~~~~v~------~S~Ig~Gc~I~-~~~V~~-SVIg~~~~Ig~~a~I~---------~svi~~~~~Ig~~~~l~-~~I   64 (104)
T cd04651           3 YIGRRGEVK------NSLVSEGCIIS-GGTVEN-SVLFRGVRVGSGSVVE---------DSVIMPNVGIGRNAVIR-RAI   64 (104)
T ss_pred             EECCCCEEE------ECEECCCCEEE-CCEEEC-CEECCCCEECCCCEEE---------CCEEECCCEECCCCEEE-EEE
T ss_conf             888994898------49988997995-999980-8972997999998996---------00996556899999998-619


Q ss_pred             ECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEEC
Q ss_conf             4588566300465278336871588146445499878960
Q gi|254780781|r  202 IREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP  241 (285)
Q Consensus       202 Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvp  241 (285)
                      |+++++|+.|+.|+.     |.+...-.+...+.+-+|+|
T Consensus        65 i~~~~~I~~g~~Ig~-----~~~~d~~~~~v~~~gi~Vi~   99 (104)
T cd04651          65 IDKNVVIPDGVVIGG-----DPEEDRARFYVTEDGIVVVG   99 (104)
T ss_pred             ECCCCEECCCCEECC-----CCHHHHHCCEECCCCEEEEC
T ss_conf             999999998999998-----93143217869279789979


No 105
>PRK09527 lacA galactoside O-acetyltransferase; Reviewed
Probab=98.54  E-value=2.6e-07  Score=65.34  Aligned_cols=79  Identities=27%  Similarity=0.315  Sum_probs=44.7

Q ss_pred             ECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEE------------------CCEEEECCCCEEECCCEECCEECCC
Q ss_conf             035640066514620-103023533677201566123------------------2204730686881232112100577
Q gi|254780781|r  117 VRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTV------------------GSCAQIGKNVHISGGVGIGGVLEPI  177 (285)
Q Consensus       117 vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~I------------------G~~a~IG~~vhI~~g~~IGGvlep~  177 (285)
                      +....||..|++++- +-|.|    |.+++|..++++                  +.-..||++|.|++++.|..     
T Consensus        78 iG~~~fiN~n~~ilD~~~I~I----Gd~v~iGPnV~i~t~~Hp~~~~~R~~~~~~~~pi~Ig~~vwIG~~~~I~p-----  148 (203)
T PRK09527         78 IGRNFYANFNLTIVDDYTVTI----GDNVLIAPNVTLSVTGHPVHHELRKNGEMYSFPITIGNNVWIGSHVVINP-----  148 (203)
T ss_pred             ECCCEEECCCCEEEECCCEEE----CCCEEECCCCEEECCCCCCCHHHHHCCCCCCCCEEECCEEEECCCCEECC-----
T ss_conf             779879868838995763799----89728869978936989889889733876688859998689899999909-----


Q ss_pred             CCCCEEECCCCEEECCCEEECCEEECCCCEEE
Q ss_conf             65644872584782185784688845885663
Q gi|254780781|r  178 QTGPTIIEDNCFIGARSEIVEGCIIREGSVLG  209 (285)
Q Consensus       178 ~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIg  209 (285)
                         .|.|+++|.|||+|+|...  |..+++++
T Consensus       149 ---Gv~IG~~~vigAgsvVtkd--ip~~~v~~  175 (203)
T PRK09527        149 ---GVTIGDNSVIGAGSVVTKD--IPPNVVAA  175 (203)
T ss_pred             ---CCEECCCCEECCCCEECCC--CCCCCEEE
T ss_conf             ---9299999799149888530--69982999


No 106
>cd05787 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon). eIF2B is important for regenerating GTP-bound eIF2 during the initiation process. This event is obligatory for eIF2 to bind initiator methionyl-tRNA, forming the ternary initiation complex. The eIF-2B epsilon subunit contains an N-terminal domain that resembles a dinucleotide-binding Rossmann fold, a central LbH domain containing 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X), and a C-terminal domain of unknown function that is present in eIF-4 gamma, eIF-5, and eIF-2B epsilon. The epsilon and gamma subunits form the catalytic subcomplex of eIF-2B, which binds eIF2 and catalyzes guanine nucleotide exchange.
Probab=98.49  E-value=3.7e-07  Score=64.40  Aligned_cols=77  Identities=27%  Similarity=0.417  Sum_probs=43.6

Q ss_pred             ECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEE
Q ss_conf             03564006651462010302353367720156612322047306868812321121005776564487258478218578
Q gi|254780781|r  117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEI  196 (285)
Q Consensus       117 vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I  196 (285)
                      +-+++.|++++.+..+      .||+++.|+.++.+.. +.|.++|+|+.++.|-+         .+|.++|.||.++.+
T Consensus         2 IG~~t~Ig~~~~I~~s------vIG~nc~Ig~~~~I~~-svi~d~~~Ig~~~~i~~---------siI~~~~~Ig~~~~i   65 (79)
T cd05787           2 IGRGTSIGEGTTIKNS------VIGRNCKIGKNVVIDN-SYIWDDVTIEDGCTIHH---------SIVADGAVIGKGCTI   65 (79)
T ss_pred             CCCCCEECCCCEEECC------EECCCCEECCCCEEEC-CEEECCCEECCCCEECC---------CEECCCCEECCCCEE
T ss_conf             9998999999999599------9899999999988948-99919789999999908---------999798999999999


Q ss_pred             ECCEEECCCCEEE
Q ss_conf             4688845885663
Q gi|254780781|r  197 VEGCIIREGSVLG  209 (285)
Q Consensus       197 ~~Gv~Ig~gavIg  209 (285)
                      .+|..||+++.||
T Consensus        66 ~~g~vIg~~~~Ig   78 (79)
T cd05787          66 PPGSLISFGVVIG   78 (79)
T ss_pred             CCCCEECCCCEEC
T ss_conf             9999997997969


No 107
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma. Most members of this family contains an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold, followed by a LbH fold domain with at least 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). eIF-2B epsilon contains an additional domain of unknown function at the C-terminus. Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=98.48  E-value=4.3e-07  Score=64.05  Aligned_cols=30  Identities=40%  Similarity=0.638  Sum_probs=14.0

Q ss_pred             CCCCCCCCCCCEECCEEEECCCCEEECCCEE
Q ss_conf             3677201566123220473068688123211
Q gi|254780781|r  140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGI  170 (285)
Q Consensus       140 Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~I  170 (285)
                      ||++|.|+.++.|++ +.||++|+|+.++.|
T Consensus         2 IG~~~~Ig~~~~I~~-svIG~~c~Ig~~~~I   31 (79)
T cd03356           2 IGESTVIGENAIIKN-SVIGDNVRIGDGVTI   31 (79)
T ss_pred             CCCCCEECCCCEEEC-CEECCCCEECCCCEE
T ss_conf             989799999999959-999999999999699


No 108
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon). eIF2B is important for regenerating GTP-bound eIF2 during the initiation process. This event is obligatory for eIF2 to bind initiator methionyl-tRNA, forming the ternary initiation complex. The eIF-2B gamma subunit contains an N-terminal domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH domain with 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). The epsilon and gamma subunits form the catalytic subcomplex of eIF-2B, which binds eIF2 and catalyzes guanine nucleotide exchange.
Probab=98.48  E-value=4.1e-07  Score=64.17  Aligned_cols=64  Identities=30%  Similarity=0.504  Sum_probs=33.2

Q ss_pred             CCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEE
Q ss_conf             367720156612322047306868812321121005776564487258478218578468884588566300465
Q gi|254780781|r  140 IGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFI  214 (285)
Q Consensus       140 Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vi  214 (285)
                      ||++|.|+..++|.+ +.||+||.|+.++.|-.         .+|-|+++||.+|.+ ++.+|++++.|+.++.|
T Consensus         2 IG~~~~Ig~~~~I~~-SvIG~nc~Ig~~~~i~~---------sii~~~v~I~~~~~i-~~sIIg~~~~Ig~~~~l   65 (81)
T cd04652           2 VGENTQVGEKTSIKR-SVIGANCKIGKRVKITN---------CVIMDNVTIEDGCTL-ENCIIGNGAVIGEKCKL   65 (81)
T ss_pred             CCCCCEECCCCEEEC-CEECCCCEECCCCEEEC---------CEEECCCEECCCCEE-ECCEEECCCEECCCCEE
T ss_conf             879889999998967-99979999999968968---------999698798999899-74999097999999999


No 109
>cd04649 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH. THP succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA. It is the committed step in the succinylase pathway by which bacteria synthesize L-lysine and meso-diaminopimelate, a component of peptidoglycan. The enzyme is trimeric and displays the left-handed parallel alpha-helix (LbH) structural motif encoded by the hexapeptide repeat motif.
Probab=98.46  E-value=4.6e-07  Score=63.87  Aligned_cols=88  Identities=19%  Similarity=0.334  Sum_probs=64.4

Q ss_pred             HHHCCCCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECC--------EEEECCCCEEECCCEECCEEC
Q ss_conf             442475102543103564006651462010302353367720156612322--------047306868812321121005
Q gi|254780781|r  104 FEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGS--------CAQIGKNVHISGGVGIGGVLE  175 (285)
Q Consensus       104 f~~~g~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~--------~a~IG~~vhI~~g~~IGGvle  175 (285)
                      |-..|..+.|.++|..+|+...++.+- ..|-.|+.||++|-+..+|.++.        -..||+||+|++++.||    
T Consensus        15 yl~~Gt~vM~egfVN~nAgt~g~~Mie-grissgv~VG~~~diggGasi~G~Ls~g~~~pi~Ig~ncliGAnsgiG----   89 (147)
T cd04649          15 YLAEGTTVMHEGFVNFNAGTLGNCMVE-GRISSGVIVGKGSDVGGGASIMGTLSGGGNNVISIGKRCLLGANSGIG----   89 (147)
T ss_pred             EECCCCEECCCCEEEECCCCCCCCEEE-EEEEECEEECCCCCCCCCCEEEEECCCCCCCCEEECCCEEECCCCCCC----
T ss_conf             887995986256798766306661687-678515698998332786178787167882356988750761465458----


Q ss_pred             CCCCCCEEECCCCEEECCCEEECCEEE
Q ss_conf             776564487258478218578468884
Q gi|254780781|r  176 PIQTGPTIIEDNCFIGARSEIVEGCII  202 (285)
Q Consensus       176 p~~a~pviIeD~v~IGa~s~I~~Gv~I  202 (285)
                            +.++|+|.|.++..|.++..|
T Consensus        90 ------i~lGd~cvv~aGlyi~~gTki  110 (147)
T cd04649          90 ------ISLGDNCIVEAGLYVTAGTKV  110 (147)
T ss_pred             ------EEECCCCEEECCEEECCCCEE
T ss_conf             ------486898688244598399789


No 110
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]
Probab=98.45  E-value=9.3e-07  Score=61.98  Aligned_cols=63  Identities=38%  Similarity=0.524  Sum_probs=31.7

Q ss_pred             CCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEE
Q ss_conf             5336772015661232204730686881232112100577656448725847821857846888458856630
Q gi|254780781|r  138 AYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGM  210 (285)
Q Consensus       138 A~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIga  210 (285)
                      +++|.++.|..++.|+..+.||++|.|+.++.|-         ..+|-|+|.||.++.|. +.+|++++.||+
T Consensus       262 ~~ig~~~~i~~~~~i~~~~~ig~~~~I~~~~~i~---------~Sii~~~~~i~~~~~i~-~sIi~~~~~ig~  324 (358)
T COG1208         262 VVIGPGAKIGPGALIGPYTVIGEGVTIGNGVEIK---------NSIIMDNVVIGHGSYIG-DSIIGENCKIGA  324 (358)
T ss_pred             EEECCCCEECCCCEECCCCEECCCCEECCCCEEE---------EEEEECCCEECCCCEEC-CEEECCCCEECC
T ss_conf             4982697898884868987899998889987787---------54887787988888882-069818859998


No 111
>cd03356 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) domain of a group of proteins with similarity to glucose-1-phosphate adenylyltransferase: Included in this family are glucose-1-phosphate adenylyltransferase, mannose-1-phosphate guanylyltransferase, and the eukaryotic translation initiation factor eIF-2B subunits, epsilon and gamma. Most members of this family contains an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold, followed by a LbH fold domain with at least 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). eIF-2B epsilon contains an additional domain of unknown function at the C-terminus. Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=98.43  E-value=7.6e-07  Score=62.51  Aligned_cols=77  Identities=31%  Similarity=0.444  Sum_probs=44.8

Q ss_pred             ECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEE
Q ss_conf             03564006651462010302353367720156612322047306868812321121005776564487258478218578
Q gi|254780781|r  117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEI  196 (285)
Q Consensus       117 vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I  196 (285)
                      +..++.|++++++-|++      ||+++.|..+++|-+ +.|-+++.|+.++.|.+         .+|++++.||.++.+
T Consensus         2 IG~~~~Ig~~~~I~~sv------IG~~c~Ig~~~~I~~-Sii~~~~~Ig~~~~i~~---------sII~~~~~Ig~~~~i   65 (79)
T cd03356           2 IGESTVIGENAIIKNSV------IGDNVRIGDGVTITN-SILMDNVTIGANSVIVD---------SIIGDNAVIGENVRV   65 (79)
T ss_pred             CCCCCEECCCCEEECCE------ECCCCEECCCCEEEE-EEEECCCEECCCCEEEC---------CEECCCCEECCCCEE
T ss_conf             98979999999995999------999999999969961-09979799999999969---------999498999999999


Q ss_pred             ECCEEECCCCEEE
Q ss_conf             4688845885663
Q gi|254780781|r  197 VEGCIIREGSVLG  209 (285)
Q Consensus       197 ~~Gv~Ig~gavIg  209 (285)
                      .++..+|++++|+
T Consensus        66 ~~~~viG~~~~I~   78 (79)
T cd03356          66 VNLCIIGDDVVVE   78 (79)
T ss_pred             ECCCEECCCCEEC
T ss_conf             2883997995988


No 112
>TIGR02353 NRPS_term_dom non-ribosomal peptide synthetase terminal domain of unknown function; InterPro: IPR012728    This domain is found exclusively in non-ribosomal peptide synthetases and always as the final domain in the polypeptide. This domain is roughly 700 amino acids in size and is found in polypeptides roughly twice that size..
Probab=98.42  E-value=3e-07  Score=64.96  Aligned_cols=100  Identities=29%  Similarity=0.391  Sum_probs=74.3

Q ss_pred             CCCCCCCCCCCCCCCEE--CCEEEECCCCEEECCCEECCE-EC--CCCCCCEEECCCCEEECCCEEECCEEECCCCEEEE
Q ss_conf             23533677201566123--220473068688123211210-05--77656448725847821857846888458856630
Q gi|254780781|r  136 MGAYIGEGSMIDTWSTV--GSCAQIGKNVHISGGVGIGGV-LE--PIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGM  210 (285)
Q Consensus       136 iGA~Ig~gt~I~~~a~I--G~~a~IG~~vhI~~g~~IGGv-le--p~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIga  210 (285)
                      .||+||++..|.+.+.+  -.=..||+|+-|...|.+-|. +|  -++-+++.|+||+|||++|++..+..||+++-++.
T Consensus       117 LGakiG~~v~i~s~~~p~~tDLl~iG~~~~v~~~v~l~g~r~~~g~l~~G~v~~g~~A~vG~~s~l~~~t~iG~~a~L~~  196 (719)
T TIGR02353       117 LGAKIGKGVDIGSKLPPVCTDLLTIGDGVIVEKEVMLLGYRVERGRLRIGPVRIGDDAFVGTRSVLDIDTAIGDRAQLGH  196 (719)
T ss_pred             CCCCCCCCEEECCCCCEEEEEEEECCCCEEEECCCCEEEEEEECCEEEEEEEEECCCEEEEEEEEECCCCCCCCHHCCCC
T ss_conf             24000685375465553663004507863640341011000215846863289837168720137478872365020355


Q ss_pred             EEEECCCCEEEECCCCCEEEEECCCCCEE
Q ss_conf             04652783368715881464454998789
Q gi|254780781|r  211 GVFIGKSTKIIDRNTGEITYGEVPSYSVV  239 (285)
Q Consensus       211 G~vit~st~i~d~~~~~~~~g~vP~~~vv  239 (285)
                      +|-+..+-.   +++|+..-| =||..+-
T Consensus       197 ~Sal~~gq~---iP~G~~W~G-SPA~~~g  221 (719)
T TIGR02353       197 GSALAGGQS---IPEGERWAG-SPAQKVG  221 (719)
T ss_pred             CCCCCCCCC---CCCCCCCCC-CCCCCCC
T ss_conf             464668845---388884378-9874446


No 113
>cd05824 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Mannose-1-phosphate guanylyltransferase is also known as GDP-mannose pyrophosphorylase. It catalyzes the synthesis of GDP-mannose from GTP and mannose-1-phosphate, and is involved in the maintenance of cell wall integrity and glycosylation. Similar to ADP-glucose pyrophosphorylase, it contains an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH fold domain, presumably with 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=98.41  E-value=6.9e-07  Score=62.76  Aligned_cols=74  Identities=19%  Similarity=0.258  Sum_probs=35.3

Q ss_pred             CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             35336772015661232204730686881232112100577656448725847821857846888458856630046527
Q gi|254780781|r  137 GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       137 GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                      .|.||+++.|+.+++||..+.||++|+|..-+..         ..+.|+|+++|. +|.|..++.+|+++.|-.+++++.
T Consensus         5 sa~Ig~~~~IGp~vvIG~nv~IG~gv~I~~~vI~---------~~~~I~~~s~i~-~siIG~~~~iG~~~ri~~~~viGd   74 (80)
T cd05824           5 SAKIGKTAKIGPNVVIGPNVTIGDGVRLQRCVIL---------SNSTVRDHSWVK-SSIVGWNSTVGRWTRLENVTVLGD   74 (80)
T ss_pred             CCEECCCCEECCCCEECCCCEECCCCEEEEEEEE---------CCCEECCCCEEE-CCEECCCCCCCCCEEECCCCEECC
T ss_conf             7898999999998589999999999799730895---------789998986997-899857970489403658629889


Q ss_pred             CCEE
Q ss_conf             8336
Q gi|254780781|r  217 STKI  220 (285)
Q Consensus       217 st~i  220 (285)
                      ++.|
T Consensus        75 ~v~I   78 (80)
T cd05824          75 DVTI   78 (80)
T ss_pred             CCEE
T ss_conf             8698


No 114
>PRK11830 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional
Probab=98.41  E-value=1.2e-06  Score=61.25  Aligned_cols=161  Identities=19%  Similarity=0.301  Sum_probs=83.3

Q ss_pred             HHHHHHHHHHHHHHH--------CCC--CCCHHHHHHHHHHHHHHHCCCE------EEEEECCC--CCEEEEHHHHHHHH
Q ss_conf             999999999750531--------682--4417899999999997307937------99887599--96886078862322
Q gi|254780781|r    7 TLEEIIDSFFEESNS--------KNE--SIPQDVKDAVQSTLDLLDRGII------RIASRDDN--GHWNTHQWIKKAIL   68 (285)
Q Consensus         7 ~L~~~Ie~awe~r~~--------l~~--~~~~~~~~aI~~~I~~LD~G~i------RVAEk~~n--G~W~VNeWvKKAIL   68 (285)
                      ++++.|+++-+.-|+        .+.  ..++=+++||.--..+-+.-.+      .--.|...  ..|-..+|-+    
T Consensus        19 evr~aI~e~I~lLD~G~iRVAEk~dg~W~VNqWvKKAILLsFrl~~~~~~~~Gp~~~~~DKVplKf~~w~~~~f~~----   94 (265)
T PRK11830         19 EVREAVEEVIDLLDSGELRVAEKIDGEWVVNQWVKKAILLSFRLNDNQVIEGGPESRFYDKVPSKFAGWDEARFKE----   94 (265)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEEECCCEEEEEHHHHHHHHHEEECCCCEEECCCCCCCCEECCCCCCCCCCHHHHHH----
T ss_conf             8999999999873388679878529988873999886652375257668626887500440454237999899976----


Q ss_pred             HEEECCCCEEEECCCCCCCHHHCCCCCCCCCCHHHHHHCCCCCCCCCEECCCCCCCCCCEEE-CCEEECCCCCCCCCCCC
Q ss_conf             20642674476247764201101775323652023442475102543103564006651462-01030235336772015
Q gi|254780781|r   69 LSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM-PSFVNMGAYIGEGSMID  147 (285)
Q Consensus        69 L~Fri~~~~~i~~g~~~~~~~DKvp~Kf~~~~~~~f~~~g~rv~P~a~vr~ga~Ig~g~vim-p~~VniGA~Ig~gt~I~  147 (285)
                      ..||+-+..+...|                    .|-..|+-+.| ++|--|||++.|+.+- -+.|...|.||+++.+.
T Consensus        95 ~gvRvVP~a~vR~G--------------------ayi~~~vVlMP-s~VNiGAyv~~gtmiDtwatvGScAqiGknvhls  153 (265)
T PRK11830         95 AGVRVVPGAVVRRG--------------------AYIAKNVVLMP-SYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLS  153 (265)
T ss_pred             CCEEECCCCEEEEC--------------------EEECCCCEEEE-EEEEEEEEECCCCEEECCCCEECHHEECCCEEEC
T ss_conf             79088788537603--------------------05459958864-1777603984895480476241153237833687


Q ss_pred             CCCEECC--------EEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCE
Q ss_conf             6612322--------0473068688123211210057765644872584782185784688
Q gi|254780781|r  148 TWSTVGS--------CAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGC  200 (285)
Q Consensus       148 ~~a~IG~--------~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv  200 (285)
                      .++.||-        -+.|.++|.|++.+.+-        .-|+|+.++.|+++..+.+.+
T Consensus       154 ~g~gigGvleP~~a~p~iied~~fiGa~~~v~--------eGv~v~~~avl~~gv~l~~st  206 (265)
T PRK11830        154 GGVGIGGVLEPLQANPVIIEDNCFIGARSEVV--------EGVIVEEGAVIGMGVFLGQST  206 (265)
T ss_pred             CCCEEEEEECCCCCCCEEEECCCEECCCCEEE--------EEEEEECCCEECCEEEECCCC
T ss_conf             87414265247667987983682873574796--------139994586972104760671


No 115
>PRK03282 consensus
Probab=98.39  E-value=1.2e-06  Score=61.24  Aligned_cols=65  Identities=12%  Similarity=0.258  Sum_probs=31.6

Q ss_pred             CCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEE
Q ss_conf             4006651462010302353367720156612322047306868812321121005776564487258478218578
Q gi|254780781|r  121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEI  196 (285)
Q Consensus       121 a~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I  196 (285)
                      |.|++|+++.++.|. ++.|+.++.|+.+|.|.+ +.|..+|+|+.|+.|.         .+||+.||.||+|+.|
T Consensus       314 S~i~~G~vI~g~~V~-nSvIg~~v~Ig~ga~I~~-SIIm~~~~Ig~~a~l~---------~~Iidk~v~Ig~g~~I  378 (406)
T PRK03282        314 SIVSAGSIISGASVR-NSVLSPNVVVDSGAIVEG-SVLMPGVRIGRGAVVR---------HAILDKNVVVPPGAMV  378 (406)
T ss_pred             CEECCCCEEECCEEE-CCEECCCCEECCCCEEEC-CEEECCCEECCCCEEE---------CCEECCCCEECCCCEE
T ss_conf             786488598599888-999789989999989970-8890968999999997---------3198999999989899


No 116
>COG0110 WbbJ Acetyltransferase (isoleucine patch superfamily) [General function prediction only]
Probab=98.39  E-value=3.4e-06  Score=58.56  Aligned_cols=60  Identities=27%  Similarity=0.272  Sum_probs=30.0

Q ss_pred             CEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEECCHHHH
Q ss_conf             88845885663004652783368715881464454998789605644556776657764467279896120246
Q gi|254780781|r  199 GCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTR  272 (285)
Q Consensus       199 Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~cavi~~~~d~~t~  272 (285)
                      .++||+++-||+|++|.+++.|.|-.       .|.++|||.- .+|...   -..|   ..|.++++++....
T Consensus       124 ~v~IG~~vwIG~~a~IlpGV~IG~ga-------vigagsVVtk-dvp~~~---iv~G---~Pa~vir~~~~~~~  183 (190)
T COG0110         124 PVTIGEDVWIGAGAVILPGVTIGEGA-------VIGAGSVVTK-DVPPYG---IVAG---NPARVIRKRDVVAK  183 (190)
T ss_pred             CCEECCCCEECCCCEECCCEEECCCE-------EEECCEEEEC-CCCCCE---EEEC---CCCEEEEECCHHHH
T ss_conf             97889985877897897985989981-------9978858957-779982---8979---99889874160555


No 117
>TIGR03308 phn_thr-fam phosphonate metabolim protein, transferase hexapeptide repeat family. This family of proteins contains copies of the Bacterial transferase hexapeptide repeat family (pfam00132) and is only found in operons encoding the phosphonate C-P lyase system (GenProp0232). Many C-P lyase operons, however, lack a homolog of this protein.
Probab=98.33  E-value=4.3e-06  Score=57.92  Aligned_cols=133  Identities=18%  Similarity=0.228  Sum_probs=64.7

Q ss_pred             CCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEE
Q ss_conf             02543103564006651462010302353367720156612322047306868812321121005776564487258478
Q gi|254780781|r  111 IIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI  190 (285)
Q Consensus       111 v~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~I  190 (285)
                      +.|...|+++|.|. ++.+ +.+    ..||++|.+.. ++||..+.|+.+|+|. ++.||-        -+.|..+|.|
T Consensus         5 l~~~p~Ihp~a~i~-~~~l-G~~----v~Ig~~~~i~n-s~IGDySyI~~~~~I~-n~~IGk--------fcsIa~~v~I   68 (204)
T TIGR03308         5 LSPEPTLHPTAELT-ESKL-GRY----TEIGERTRLRE-VALGDYSYVMRDCDII-YTTIGK--------FCSIAAMVRI   68 (204)
T ss_pred             CCCCCEECCCCEEC-CCCC-CCC----EEECCCCEEEC-CEECCCCEECCCCEEE-CCEECC--------CCEECCCCEE
T ss_conf             47997689998683-2783-783----39999958833-7999985888997598-886999--------8488898798


Q ss_pred             ECCCEE-------------------------------ECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEE
Q ss_conf             218578-------------------------------4688845885663004652783368715881464454998789
Q gi|254780781|r  191 GARSEI-------------------------------VEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVV  239 (285)
Q Consensus       191 Ga~s~I-------------------------------~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vv  239 (285)
                      |.+..-                               ...++||.++-||+|++|.++++|.|-.       -|-++|||
T Consensus        69 ~~~nHp~~~~s~~~f~y~~~~~~~~~~~~~~~~~~~~~~~~~Ig~dvwiG~~~~i~~gv~IG~ga-------vigagsvV  141 (204)
T TIGR03308        69 NATNHPMERPTLHHFTYRAAMYFDDASDDADFFAWRRAKRVTIGHDVWIGHGAVILPGVTIGNGA-------VIAAGAVV  141 (204)
T ss_pred             CCCCCCCCCCEECCEEEECCCCCCCCCCCHHHHCCCCCCCEEECCCCEECCCCEECCCCEECCCC-------EECCCCEE
T ss_conf             98778766726777755375334666661223213347870989976887998991997999998-------99779989


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCCEEEEEC-CHHHHH
Q ss_conf             6056445567766577644672798961-202466
Q gi|254780781|r  240 VPGSYPSINLKGDIAGPHLYCAVIIKKV-DEKTRS  273 (285)
Q Consensus       240 vpg~~~~~~~~~~~~~~~~~cavi~~~~-d~~t~~  273 (285)
                      . ...|.-.-   ..|   .+|-++|+| ++.+.+
T Consensus       142 t-kdv~~~~i---v~G---~PAk~ir~RF~~~~i~  169 (204)
T TIGR03308       142 T-KDVAPYTI---VAG---VPAKLIRRRFPPEIAA  169 (204)
T ss_pred             C-CCCCCCEE---EEE---CCCEEEECCCCHHHHH
T ss_conf             9-51799849---984---1885663109999999


No 118
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis]
Probab=98.33  E-value=1.6e-06  Score=60.48  Aligned_cols=65  Identities=37%  Similarity=0.478  Sum_probs=28.2

Q ss_pred             CCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCC
Q ss_conf             53367720156612322047306868812321121005776564487258478218578468884588566300465278
Q gi|254780781|r  138 AYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKS  217 (285)
Q Consensus       138 A~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~s  217 (285)
                      +.||++|.|...+.|.+ +.|.++|.|+.++.|++         .||+++|.||++. .     +|+ +++|.++.+.++
T Consensus       280 ~~ig~~~~I~~~~~i~~-Sii~~~~~i~~~~~i~~---------sIi~~~~~ig~~~-~-----i~d-~~~g~~~~i~~g  342 (358)
T COG1208         280 TVIGEGVTIGNGVEIKN-SIIMDNVVIGHGSYIGD---------SIIGENCKIGASL-I-----IGD-VVIGINSEILPG  342 (358)
T ss_pred             CEECCCCEECCCCEEEE-EEEECCCEECCCCEECC---------EEECCCCEECCCC-E-----EEE-EEECCCEEECCC
T ss_conf             78999988899877875-48877879888888820---------6981885999861-5-----701-586366086276


Q ss_pred             CE
Q ss_conf             33
Q gi|254780781|r  218 TK  219 (285)
Q Consensus       218 t~  219 (285)
                      ++
T Consensus       343 ~~  344 (358)
T COG1208         343 VV  344 (358)
T ss_pred             EE
T ss_conf             18


No 119
>cd04652 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left-handed parallel beta-Helix (LbH) domain: eIF-2B is a eukaryotic translation initiator, a guanine nucleotide exchange factor (GEF) composed of five different subunits (alpha, beta, gamma, delta and epsilon). eIF2B is important for regenerating GTP-bound eIF2 during the initiation process. This event is obligatory for eIF2 to bind initiator methionyl-tRNA, forming the ternary initiation complex. The eIF-2B gamma subunit contains an N-terminal domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH domain with 4 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). The epsilon and gamma subunits form the catalytic subcomplex of eIF-2B, which binds eIF2 and catalyzes guanine nucleotide exchange.
Probab=98.32  E-value=1.9e-06  Score=60.08  Aligned_cols=77  Identities=23%  Similarity=0.433  Sum_probs=34.8

Q ss_pred             CCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEE
Q ss_conf             35640066514620103023533677201566123220473068688123211210057765644872584782185784
Q gi|254780781|r  118 RHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIV  197 (285)
Q Consensus       118 r~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~  197 (285)
                      .+++.|++++.+-.+      .||.++.|+.++.+-. +.|.++++|..++.|-         ..+|++++.||.+|.+ 
T Consensus         3 G~~~~Ig~~~~I~~S------vIG~nc~Ig~~~~i~~-sii~~~v~I~~~~~i~---------~sIIg~~~~Ig~~~~l-   65 (81)
T cd04652           3 GENTQVGEKTSIKRS------VIGANCKIGKRVKITN-CVIMDNVTIEDGCTLE---------NCIIGNGAVIGEKCKL-   65 (81)
T ss_pred             CCCCEECCCCEEECC------EECCCCEECCCCEEEC-CEEECCCEECCCCEEE---------CCEEECCCEECCCCEE-
T ss_conf             798899999989679------9979999999968968-9996987989998997---------4999097999999999-


Q ss_pred             CCEEECCCCEEEEE
Q ss_conf             68884588566300
Q gi|254780781|r  198 EGCIIREGSVLGMG  211 (285)
Q Consensus       198 ~Gv~Ig~gavIgaG  211 (285)
                      .++.||++++|.+|
T Consensus        66 ~~~vig~~~~V~~g   79 (81)
T cd04652          66 KDCLVGSGYRVEAG   79 (81)
T ss_pred             ECCEECCCCEECCC
T ss_conf             37398899898989


No 120
>COG1043 LpxA Acyl-[acyl carrier protein]
Probab=98.31  E-value=2.9e-06  Score=58.97  Aligned_cols=110  Identities=20%  Similarity=0.290  Sum_probs=77.3

Q ss_pred             CCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCC
Q ss_conf             51025431035640066514620103023533677201566123220473068688123211210057765644872584
Q gi|254780781|r  109 FRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNC  188 (285)
Q Consensus       109 ~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v  188 (285)
                      +-+..++.+|.++.|-.|+.--...    ..||.+.++-.++.|.|+|.||+||.++.++.++|        .|.|+|.+
T Consensus        82 l~IG~~n~IRE~vTi~~GT~~g~g~----T~IGdnnl~May~HVAHDC~iGn~~ilaNnatLAG--------HV~igD~a  149 (260)
T COG1043          82 LIIGDNNTIREFVTIHRGTVQGGGV----TRIGDNNLIMAYAHVAHDCVIGNNCILANNATLAG--------HVEVGDYA  149 (260)
T ss_pred             EEECCCCEEEEEEEEECCCCCCCEE----EEECCCCEEEEEEEEECCCEECCCEEEECCCEEEC--------EEEECCEE
T ss_conf             9988997586688986154478615----99778878987310313444567179966866854--------07887789


Q ss_pred             EEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCC
Q ss_conf             7821857846888458856630046527833687158814644549987896056445
Q gi|254780781|r  189 FIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS  246 (285)
Q Consensus       189 ~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~  246 (285)
                      .||..+-|.+=++||+.|.||..+-+.+               +||||..+. |.+..
T Consensus       150 iiGG~saVHQF~rIG~~amiGg~S~v~~---------------DVpPy~~~~-Gn~a~  191 (260)
T COG1043         150 IIGGLSAVHQFVRIGAHAMIGGLSAVSQ---------------DVPPYVIAS-GNHAR  191 (260)
T ss_pred             EECCCCEEEEEEEECCHHEECCCHHHCC---------------CCCCEEEEC-CCCCC
T ss_conf             9747523777889740112344101036---------------779838852-87044


No 121
>cd03349 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class of hexapeptide acyltransferases is composed of a large number of microbial enzymes that catalyze the CoA-dependent acetylation of a variety of hydroxyl-bearing acceptors such as chloramphenicol and streptogramin, among others. Members of this class of enzymes include Enterococcus faecium streptogramin A acetyltransferase and Pseudomonas aeruginosa chloramphenicol acetyltransferase. They contain repeated copies of a six-residue hexapeptide repeat sequence motif (X-[STAV]-X-[LIV]-[GAED]-X) and adopt a left-handed parallel beta helix (LbH) structure. The active enzyme is a trimer with CoA and substrate binding sites at the interface of two separate LbH subunits. XATs are implicated in inactivating xenobiotics leading to xenobiotic resistance in patients.
Probab=98.31  E-value=3.9e-06  Score=58.16  Aligned_cols=65  Identities=20%  Similarity=0.232  Sum_probs=35.9

Q ss_pred             CCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEECCH--HHH-HH
Q ss_conf             688845885663004652783368715881464454998789605644556776657764467279896120--246-68
Q gi|254780781|r  198 EGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDE--KTR-SK  274 (285)
Q Consensus       198 ~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~cavi~~~~d~--~t~-~k  274 (285)
                      ..++||+++-||+|++|.++++|.             .++||=.||+..++-+.        -+++..---.  +.| .+
T Consensus        72 ~~i~Ig~~vwIG~n~~Il~GV~IG-------------~gavIgAgSvVtkdvp~--------~~i~~G~PAk~ik~Rf~~  130 (145)
T cd03349          72 GDVIIGNDVWIGHGATILPGVTIG-------------DGAVIAAGAVVTKDVPP--------YAIVGGNPAKVIRYRFDE  130 (145)
T ss_pred             CCEEECCCEEECCCCEEECCCEEC-------------CCCEEECCCEECCCCCC--------CCEEEEECCEEEECCCCH
T ss_conf             997988996999988895880967-------------88689289789704699--------949983388788155999


Q ss_pred             HHHHHHHHC
Q ss_conf             889987511
Q gi|254780781|r  275 TSINTLLRD  283 (285)
Q Consensus       275 ~~ln~~lR~  283 (285)
                      -.++.|||.
T Consensus       131 ~~~~~l~~~  139 (145)
T cd03349         131 ETIERLLAL  139 (145)
T ss_pred             HHHHHHHHC
T ss_conf             999999876


No 122
>PRK01884 consensus
Probab=98.27  E-value=2.4e-06  Score=59.41  Aligned_cols=94  Identities=17%  Similarity=0.269  Sum_probs=63.1

Q ss_pred             CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             35336772015661232204730686881232112100577656448725847821857846888458856630046527
Q gi|254780781|r  137 GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       137 GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                      ++.|+.||.|.. ++|.+ +.|+.+|+|..||.|-         ..||-++|.||.||.|. .++|.++++|++|++|+-
T Consensus       329 nSlIa~GcvI~~-g~V~n-SVL~r~v~I~~gA~V~---------nSIIm~~~~IG~ga~l~-~~IiDk~v~I~~g~~IG~  396 (435)
T PRK01884        329 NSLIAGGCVITD-ASISN-SVLFDRIKVDEFSKID---------HCVVLPQVKIGKNCVLK-RCIIDRHCVIPDGMQIGV  396 (435)
T ss_pred             CCEECCCEEEEC-CEEEC-CEEECCCEECCCCEEE---------ECEEECCCEECCCCEEE-EEEECCCCEECCCCEECC
T ss_conf             899819979939-89971-9820896999999998---------28880869899999996-269899999997999985


Q ss_pred             CCEEEECCCCCEEEEECCCCCEEECC-CCCCC
Q ss_conf             83368715881464454998789605-64455
Q gi|254780781|r  217 STKIIDRNTGEITYGEVPSYSVVVPG-SYPSI  247 (285)
Q Consensus       217 st~i~d~~~~~~~~g~vP~~~vvvpg-~~~~~  247 (285)
                           |.+.+.-.+--.+.+-|||.. -++..
T Consensus       397 -----~~~~d~~~~~v~~~givvv~~~~~~~~  423 (435)
T PRK01884        397 -----DPEEDKKRFRISSGGVVLVTPKMLKKL  423 (435)
T ss_pred             -----CHHHHCCCCEEECCEEEEECHHHHHHH
T ss_conf             -----845842477896899999878999762


No 123
>KOG3121 consensus
Probab=98.25  E-value=2.6e-06  Score=59.27  Aligned_cols=101  Identities=22%  Similarity=0.309  Sum_probs=61.4

Q ss_pred             CCCCCCCCCC-CCEECCEEEECCCCEEECCCEECCE----ECCCCCCCEEECCCCEEECCCEEEC-----CEEECCCCEE
Q ss_conf             3367720156-6123220473068688123211210----0577656448725847821857846-----8884588566
Q gi|254780781|r  139 YIGEGSMIDT-WSTVGSCAQIGKNVHISGGVGIGGV----LEPIQTGPTIIEDNCFIGARSEIVE-----GCIIREGSVL  208 (285)
Q Consensus       139 ~Ig~gt~I~~-~a~IG~~a~IG~~vhI~~g~~IGGv----lep~~a~pviIeD~v~IGa~s~I~~-----Gv~Ig~gavI  208 (285)
                      .|.+|++|.. .|    .++||+.|-+...+.|---    -..+-.-|+-|+|.+||+-.|++-.     =|.+|++|+|
T Consensus        41 Iv~~g~iIRGDLA----nVr~GryCV~ksrsvIRPp~K~FSKg~affp~hiGdhVFieE~cVVnAAqIgsyVh~Gknavi  116 (184)
T KOG3121          41 IVEEGVIIRGDLA----NVRIGRYCVLKSRSVIRPPMKIFSKGPAFFPVHIGDHVFIEEECVVNAAQIGSYVHLGKNAVI  116 (184)
T ss_pred             EEEECCEEECCCC----CCEECCEEEECCCCCCCCCHHHHCCCCEEEEEEECCEEEEECCEEEEHHHHEEEEEECCCEEE
T ss_conf             9860858951201----024733689646654377067756786245665245688704418626661203685464067


Q ss_pred             EEEEEECCCCEEEECC--CCCEEEEECCCCCEEECCCCCCCC
Q ss_conf             3004652783368715--881464454998789605644556
Q gi|254780781|r  209 GMGVFIGKSTKIIDRN--TGEITYGEVPSYSVVVPGSYPSIN  248 (285)
Q Consensus       209 gaG~vit~st~i~d~~--~~~~~~g~vP~~~vvvpg~~~~~~  248 (285)
                      |.++++..-.+|.|-.  ..|.   -+|||++.  |..|...
T Consensus       117 GrrCVlkdCc~ild~tVlPpet---~vppy~~~--~g~p~~~  153 (184)
T KOG3121         117 GRRCVLKDCCRILDDTVLPPET---LVPPYSTI--GGNPAQV  153 (184)
T ss_pred             CCCEEHHHHEECCCCCCCCCCC---CCCCCEEE--CCCCCEE
T ss_conf             3750833410415895258201---36971677--3887235


No 124
>PRK04928 consensus
Probab=98.24  E-value=3.9e-06  Score=58.19  Aligned_cols=67  Identities=19%  Similarity=0.229  Sum_probs=35.5

Q ss_pred             CCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEEC
Q ss_conf             400665146201030235336772015661232204730686881232112100577656448725847821857846
Q gi|254780781|r  121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVE  198 (285)
Q Consensus       121 a~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~  198 (285)
                      +.|+.|+++.++.|+ ++.||.+|.|+.+|.|-. +.|..+|+|+.|+.|..         +||+.||.||.|+.|.+
T Consensus       312 s~I~~G~~I~G~~I~-~SvIg~~~~Ig~ga~I~n-SII~~~~~Ig~ga~i~~---------sIidk~v~Ig~g~~I~~  378 (405)
T PRK04928        312 SLISGGSYIRGSRIE-KSVLGFRSNIASACDISE-SVLLGDVKIGEGCVLRR---------VIIDKDVEIAPGTQIGE  378 (405)
T ss_pred             CEECCCCEEECCEEE-CCEECCCCEECCCCEEEC-CEEECCCEECCCCEEEC---------CEECCCCEECCCCEECC
T ss_conf             688788789899987-689769989999949955-89969299999999965---------49889999999999983


No 125
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional
Probab=98.24  E-value=6e-06  Score=57.02  Aligned_cols=78  Identities=22%  Similarity=0.282  Sum_probs=37.8

Q ss_pred             CCCEEECCCEECC-EECCCCCCCEEECCCCEEECC-----CEEECCEEECCC-----CEEEEEEEECCCCEEE-ECCCCC
Q ss_conf             6868812321121-005776564487258478218-----578468884588-----5663004652783368-715881
Q gi|254780781|r  160 KNVHISGGVGIGG-VLEPIQTGPTIIEDNCFIGAR-----SEIVEGCIIREG-----SVLGMGVFIGKSTKII-DRNTGE  227 (285)
Q Consensus       160 ~~vhI~~g~~IGG-vlep~~a~pviIeD~v~IGa~-----s~I~~Gv~Ig~g-----avIgaG~vit~st~i~-d~~~~~  227 (285)
                      ++|.|++|+.|.| .+     ...+|+.+|.||.|     |+|.++++||+|     |+|+.+++|+.+|.|. |....+
T Consensus       314 ~~s~I~~g~~I~g~~V-----~nSvIg~~v~Ig~ga~I~nSII~~~~~Ig~~a~I~~sIidk~v~Ig~gt~I~~~~~~~~  388 (409)
T PRK00844        314 IDSIVSAGSIISGGSV-----RNSVLSPNVRVDSGAIVEGSVLMDGVRIGRGAVVRRAILDKNVVVPPGTQIGVDLEEDA  388 (409)
T ss_pred             ECCEECCCEEEECCEE-----ECCEECCCCEECCCCEEECCEEECCCEECCCCEEEEEEECCCCEECCCCEECCCCHHHC
T ss_conf             2588879709969988-----88897799899999899518992949999999998019899989899989897804735


Q ss_pred             EEEEECCCCCEEECC
Q ss_conf             464454998789605
Q gi|254780781|r  228 ITYGEVPSYSVVVPG  242 (285)
Q Consensus       228 ~~~g~vP~~~vvvpg  242 (285)
                      -.+-.+--+-||+|-
T Consensus       389 ~~~~~~~~~~~~~~~  403 (409)
T PRK00844        389 KRFTVSEGGIVVVGK  403 (409)
T ss_pred             CCCEEECCEEEEECC
T ss_conf             377880684899878


No 126
>PRK11132 cysE serine acetyltransferase; Provisional
Probab=98.21  E-value=2.2e-06  Score=59.66  Aligned_cols=83  Identities=22%  Similarity=0.227  Sum_probs=61.1

Q ss_pred             CCCCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCE--------EEECCCCEEECCCEECCEECCCC
Q ss_conf             4751025431035640066514620103023533677201566123220--------47306868812321121005776
Q gi|254780781|r  107 HNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSC--------AQIGKNVHISGGVGIGGVLEPIQ  178 (285)
Q Consensus       107 ~g~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~--------a~IG~~vhI~~g~~IGGvlep~~  178 (285)
                      -|+-|.|+|.+..|-+|.-++-   -+|.--|.||+++.|-.++|+|..        -+||++|.|++|+.|-|      
T Consensus       140 ~gvdIHP~A~iG~gi~iDH~~G---vVIGETavigd~vsi~~~VTLGgt~~~~g~RHP~i~~~v~igaga~iLG------  210 (273)
T PRK11132        140 FQVDIHPAAKIGRGIMLDHATG---IVVGETAVIENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILG------  210 (273)
T ss_pred             HCCCCCCCCEECCCEEEECCCC---EEECCEEEECCCEEEECCEEEECCCCCCCCCCCCCCCCEEECCCCEEEC------
T ss_conf             5125266651168568834763---5875646866854895123540355668898980488848754888971------


Q ss_pred             CCCEEECCCCEEECCCEEECCE
Q ss_conf             5644872584782185784688
Q gi|254780781|r  179 TGPTIIEDNCFIGARSEIVEGC  200 (285)
Q Consensus       179 a~pviIeD~v~IGa~s~I~~Gv  200 (285)
                        |+.|++++-|||||+|+..|
T Consensus       211 --~i~iG~~a~igA~svVl~dv  230 (273)
T PRK11132        211 --NIEVGRGAKIGAGSVVLQPV  230 (273)
T ss_pred             --CEEECCCCEECCCCEECCCC
T ss_conf             --85889998886786686437


No 127
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=98.10  E-value=9.6e-06  Score=55.77  Aligned_cols=79  Identities=27%  Similarity=0.388  Sum_probs=39.9

Q ss_pred             CCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCE
Q ss_conf             0066514620-103023533677201566123220473068688123211210057765644872584782185784688
Q gi|254780781|r  122 YIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGC  200 (285)
Q Consensus       122 ~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv  200 (285)
                      +|+++++++| ++++--++||+++.|.++|.|-..+.||++|+|+.  -|         ...+|++++.++--+-|.+ .
T Consensus        13 ~I~~~~~I~~~~~i~Gp~~IG~~~~I~p~a~Ir~~t~Ig~~~~IG~--Ei---------k~S~i~~~s~~~H~~YlGD-S   80 (101)
T cd05635          13 YIGKDAVIEPFAVIEGPVYIGPGSRVKMGARIYGNTTIGPTCKIGG--EV---------EDSIIEGYSNKQHDGFLGH-S   80 (101)
T ss_pred             EECCCCEECCCCEEECCEEECCCCEECCCCEEECCCEECCCCEECC--EE---------EEEEEECCCCCCCCCEEEE-E
T ss_conf             9879999999999976669999999999978638879999977614--08---------7618857875687758761-1


Q ss_pred             EECCCCEEEEEE
Q ss_conf             845885663004
Q gi|254780781|r  201 IIREGSVLGMGV  212 (285)
Q Consensus       201 ~Ig~gavIgaG~  212 (285)
                      .||+++-||||+
T Consensus        81 ~iG~~vNiGAGT   92 (101)
T cd05635          81 YLGSWCNLGAGT   92 (101)
T ss_pred             EECCCCEECCCC
T ss_conf             783875787785


No 128
>TIGR02287 PaaY phenylacetic acid degradation protein PaaY; InterPro: IPR011974    Members of this family are located next to other genes organised into apparent operons for phenylacetic acid degradation . PaaY is located near the end of these gene clusters and often next to PaaX, a transcriptional regulator..
Probab=98.03  E-value=8.3e-06  Score=56.14  Aligned_cols=122  Identities=20%  Similarity=0.412  Sum_probs=73.2

Q ss_pred             EECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEE---------CCEEEECCCCEEECCCEECCEECCCCCCCEEECC
Q ss_conf             1035640066514620103023533677201566123---------2204730686881232112100577656448725
Q gi|254780781|r  116 IVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTV---------GSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED  186 (285)
Q Consensus       116 ~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~I---------G~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD  186 (285)
                      +|.+.||+=|.+||.+-     .+||.++.|...|.+         ...|.|-++|-.++-=.          ..|++|.
T Consensus        10 VVhp~ayVHP~AVLiGD-----Vi~G~rcYvgPlASLRGDFGrIvl~eGAN~QD~CVMHGFPg----------~DTvVee   74 (193)
T TIGR02287        10 VVHPEAYVHPDAVLIGD-----VIVGKRCYVGPLASLRGDFGRIVLKEGANVQDTCVMHGFPG----------QDTVVEE   74 (193)
T ss_pred             CCCCCCCCCCCEEEEEE-----EEECCCCEECCCCCCCCCCCCEEEECCCCCCCCCEECCCCC----------CCEEEEC
T ss_conf             56987734686378621-----78879524676631357757257534886146424367299----------8867606


Q ss_pred             CCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCCCCCCCCCCCCCCCC-----CCC
Q ss_conf             847821857846888458856630046527833687158814644549987896056445567766577644-----672
Q gi|254780781|r  187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHL-----YCA  261 (285)
Q Consensus       187 ~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~-----~ca  261 (285)
                      |=+||=+|++ -|++||++|.||||+|+=-      .+       -|-++|+|-.-+..    |..+..|.-     .+|
T Consensus        75 nGHvGHgAiL-HgC~vgrnaLvGMNAVVMD------gA-------vige~sIVaA~aFV----KAg~E~paq~Lv~GsPA  136 (193)
T TIGR02287        75 NGHVGHGAIL-HGCRVGRNALVGMNAVVMD------GA-------VIGERSIVAASAFV----KAGAEIPAQVLVVGSPA  136 (193)
T ss_pred             CCCCCCCEEE-CCCEECCCCEECCCEEEEC------CC-------EECCCCCEEHHHHH----HCCCCCCCCCEEECCCC
T ss_conf             8823321235-1546325231116506616------64-------66774120020334----34734784612662873


Q ss_pred             EEEEECCHH
Q ss_conf             798961202
Q gi|254780781|r  262 VIIKKVDEK  270 (285)
Q Consensus       262 vi~~~~d~~  270 (285)
                      -++..+.||
T Consensus       137 kv~R~LseQ  145 (193)
T TIGR02287       137 KVVRELSEQ  145 (193)
T ss_pred             EEEECCHHH
T ss_conf             055331146


No 129
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]
Probab=97.98  E-value=6.5e-05  Score=50.68  Aligned_cols=164  Identities=22%  Similarity=0.320  Sum_probs=100.5

Q ss_pred             HHHHHH-HHHHCCCEEEEEECCCCCEEEEHHHHHHHHHEEECCCCEEEECCCCCCCHHHCCCCCCCCCCHHHHHHCCCCC
Q ss_conf             999999-9730793799887599968860788623222064267447624776420110177532365202344247510
Q gi|254780781|r   33 AVQSTL-DLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRI  111 (285)
Q Consensus        33 aI~~~I-~~LD~G~iRVAEk~~nG~W~VNeWvKKAILL~Fri~~~~~i~~g~~~~~~~DKvp~Kf~~~~~~~f~~~g~rv  111 (285)
                      --.++| .++..|++.+=+-  +|=|.-     =+=+-+|---.|.+.+-. +.+..||+      +|+---    ....
T Consensus       221 fgkdiIp~~~~~~~v~AY~f--~gYw~d-----VgTi~syy~aNmdLl~~~-~~~~lyd~------~w~IyT----~~~~  282 (393)
T COG0448         221 FGKDIIPKLLERGKVYAYEF--SGYWRD-----VGTIDSYYEANMDLLSPQ-PELNLYDR------NWPIYT----KNKN  282 (393)
T ss_pred             HHHHHHHHHHHCCCEEEEEC--CCHHHH-----CCCHHHHHHHHHHHCCCC-CCCCCCCC------CCCEEE----CCCC
T ss_conf             06778898875087778742--566652-----663999998438762899-75532489------981261----3788


Q ss_pred             CCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEE
Q ss_conf             25431035640066514620103023533677201566123220473068688123211210057765644872584782
Q gi|254780781|r  112 IPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIG  191 (285)
Q Consensus       112 ~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IG  191 (285)
                      .|+|....++.      +      ..+-|++||+|..  +|.+ +.++.+++|..|+.|-         ..+|=.+|.||
T Consensus       283 ~pPak~~~~s~------v------~nSLv~~GciI~G--~V~n-SVL~~~v~I~~gs~i~---------~svim~~~~IG  338 (393)
T COG0448         283 LPPAKFVNDSE------V------SNSLVAGGCIISG--TVEN-SVLFRGVRIGKGSVIE---------NSVIMPDVEIG  338 (393)
T ss_pred             CCCCEEECCCE------E------EEEEEECCEEEEE--EEEE-EEEECCEEECCCCEEE---------EEEEECCCEEC
T ss_conf             89816755855------7------6226607718963--8986-3875671977898887---------53872786888


Q ss_pred             CCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEEECCCC
Q ss_conf             18578468884588566300465278336871588146445499878960564
Q gi|254780781|r  192 ARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY  244 (285)
Q Consensus       192 a~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vvvpg~~  244 (285)
                      .+|.+. .++|.++++|+.|++|..+.+-.|+.. ...   + .+-||||-+.
T Consensus       339 ~~~~l~-~aIIDk~v~I~~g~~i~~~~~~~d~~~-~~~---~-~~ivVv~k~~  385 (393)
T COG0448         339 EGAVLR-RAIIDKNVVIGEGVVIGGDKPEEDRKR-FRS---E-EGIVVVPKGM  385 (393)
T ss_pred             CCCEEE-EEEECCCCEECCCCEECCCCCCCCCCC-CCC---C-CCCEEEECCC
T ss_conf             998899-989679968689828867730001112-234---5-8738993563


No 130
>cd04651 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase. It catalyzes the first committed and rate-limiting step in starch biosynthesis in plants and glycogen biosynthesis in bacteria. It is the enzymatic site for regulation of storage polysaccharide accumulation in plants and bacteria. The enzyme is a homotetramer, with each subunit containing an N-terminal catalytic domain that resembles a dinucleotide-binding Rossmann fold and a C-terminal LbH fold domain with at 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). The LbH domain is involved in cooperative allosteric regulation and oligomerization.
Probab=97.94  E-value=3e-05  Score=52.73  Aligned_cols=56  Identities=18%  Similarity=0.144  Sum_probs=23.5

Q ss_pred             CCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEE
Q ss_conf             25431035640066514620103023533677201566123220473068688123211
Q gi|254780781|r  112 IPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGI  170 (285)
Q Consensus       112 ~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~I  170 (285)
                      .+.|.++ .+.|+.|+++.++.|. .+.++.++.|+.+|.|.+ +.|..+|.|+.++.|
T Consensus         5 ~~~~~v~-~S~Ig~Gc~I~~~~V~-~SVIg~~~~Ig~~a~I~~-svi~~~~~Ig~~~~l   60 (104)
T cd04651           5 GRRGEVK-NSLVSEGCIISGGTVE-NSVLFRGVRVGSGSVVED-SVIMPNVGIGRNAVI   60 (104)
T ss_pred             CCCCEEE-ECEECCCCEEECCEEE-CCEECCCCEECCCCEEEC-CEEECCCEECCCCEE
T ss_conf             8994898-4998899799599998-089729979999989960-099655689999999


No 131
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]
Probab=97.93  E-value=6.1e-05  Score=50.84  Aligned_cols=69  Identities=25%  Similarity=0.364  Sum_probs=36.8

Q ss_pred             CCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEE
Q ss_conf             25431035640066514620103023533677201566123220473068688123211210057765644872584782
Q gi|254780781|r  112 IPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIG  191 (285)
Q Consensus       112 ~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IG  191 (285)
                      +-++.|..||.|.-  .+-.|.+-.|++|++|+.|+..... ..++||++|+|.               .+||..||.|+
T Consensus       294 v~nSLv~~GciI~G--~V~nSVL~~~v~I~~gs~i~~svim-~~~~IG~~~~l~---------------~aIIDk~v~I~  355 (393)
T COG0448         294 VSNSLVAGGCIISG--TVENSVLFRGVRIGKGSVIENSVIM-PDVEIGEGAVLR---------------RAIIDKNVVIG  355 (393)
T ss_pred             EEEEEEECCEEEEE--EEEEEEEECCEEECCCCEEEEEEEE-CCCEECCCCEEE---------------EEEECCCCEEC
T ss_conf             76226607718963--8986387567197789888753872-786888998899---------------98967996868


Q ss_pred             CCCEEEC
Q ss_conf             1857846
Q gi|254780781|r  192 ARSEIVE  198 (285)
Q Consensus       192 a~s~I~~  198 (285)
                      .|..|..
T Consensus       356 ~g~~i~~  362 (393)
T COG0448         356 EGVVIGG  362 (393)
T ss_pred             CCCEECC
T ss_conf             9828867


No 132
>cd05635 LbH_unknown Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes showing acyltransferase activity.
Probab=97.90  E-value=2.7e-05  Score=53.02  Aligned_cols=22  Identities=27%  Similarity=0.511  Sum_probs=8.8

Q ss_pred             CCCCCCCCEECCCCCCCCCCEE
Q ss_conf             7510254310356400665146
Q gi|254780781|r  108 NFRIIPGTIVRHSAYIGPKAVL  129 (285)
Q Consensus       108 g~rv~P~a~vr~ga~Ig~g~vi  129 (285)
                      +++|.|+++++-.+|||+++.+
T Consensus        17 ~~~I~~~~~i~Gp~~IG~~~~I   38 (101)
T cd05635          17 DAVIEPFAVIEGPVYIGPGSRV   38 (101)
T ss_pred             CCEECCCCEEECCEEECCCCEE
T ss_conf             9999999999766699999999


No 133
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase; InterPro: IPR011831    This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase. The plant form is an alpha2, beta2 heterodimer, allosterically regulated in plants. Both subunits are homologous and included in this entry. In bacteria, both homomeric forms of GlgC and more active heterodimers of GlgC and GlgD have been described. This entry describes the GlgC subunit only. This enzyme appears in variants of glycogen synthesis pathways that use ADP-glucose, rather than UDP-glucose as in animals.; GO: 0008878 glucose-1-phosphate adenylyltransferase activity.
Probab=97.79  E-value=6e-05  Score=50.88  Aligned_cols=160  Identities=19%  Similarity=0.242  Sum_probs=73.0

Q ss_pred             HHHHH-HHHHCC-CEEEEEECCC---CCEEEEHHHHHHHHHEEECCCCEEEECCC---CCCCHHHC-CCCCCCCCCHHHH
Q ss_conf             99999-973079-3799887599---96886078862322206426744762477---64201101-7753236520234
Q gi|254780781|r   34 VQSTL-DLLDRG-IIRIASRDDN---GHWNTHQWIKKAILLSFQINPTKIISDGN---GYSTWWDK-IPAKFDDWKTKDF  104 (285)
Q Consensus        34 I~~~I-~~LD~G-~iRVAEk~~n---G~W~VNeWvKKAILL~Fri~~~~~i~~g~---~~~~~~DK-vp~Kf~~~~~~~f  104 (285)
                      =+++| .+|+.| ++-+=.-..|   |.|.=-=|===+=|=+|=--.|.+++-.-   |.+..||+ =|.-    +... 
T Consensus       242 GkdiIP~~~~~g~~~~Ay~F~~s~v~g~~~e~YWrDVGTidsfweANmdL~~~~~PqvP~f~lYd~~WpI~----t~~~-  316 (421)
T TIGR02091       242 GKDIIPKLLEEGKSVQAYDFSQSCVPGEEKEGYWRDVGTIDSFWEANMDLVSEVKPQVPPFDLYDRKWPIY----TYNE-  316 (421)
T ss_pred             CHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCEEEECHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC----CCCC-
T ss_conf             43568898508971899804676056878887622300406566751876278888888777637778755----7888-


Q ss_pred             HHCCCCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECC----------EE
Q ss_conf             42475102543103564006651462010302353367720156612322047306868812321121----------00
Q gi|254780781|r  105 EKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGG----------VL  174 (285)
Q Consensus       105 ~~~g~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGG----------vl  174 (285)
                            ..|+|..=....=..|. +-.|.|.-|+.|..+|.-++  .+|..++|+++|.|..-+..+.          .|
T Consensus       317 ------~~pPa~f~~~~~~~~G~-v~~Slv~~Gc~i~g~~v~~S--vL~~~v~i~~~~~v~dsVim~~Dfy~~~~E~~~l  387 (421)
T TIGR02091       317 ------FLPPAKFVDSDEGRKGQ-VSDSLVAEGCIISGATVSHS--VLGSRVRIGSGSTVEDSVIMGDDFYENESEIDAL  387 (421)
T ss_pred             ------CCCCCEEECCCCCCCCE-EEEEEEECCCEECCCEEEEE--EEECCCEECCCCEEEEEEECCCCCCCCHHHHHHH
T ss_conf             ------88886045576778420-74407756718807678722--8526868546557988688798654785688888


Q ss_pred             CCCCCCCEEECCCCEEECCCEEECCEEECCCCEEE
Q ss_conf             57765644872584782185784688845885663
Q gi|254780781|r  175 EPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLG  209 (285)
Q Consensus       175 ep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIg  209 (285)
                      . -+.-|+.||+||.| .||+|.++++||+|..||
T Consensus       388 ~-~G~~a~~IG~~~~i-~~~IiD~~~~Ig~g~~Ig  420 (421)
T TIGR02091       388 K-DGKVAVGIGRGAVI-RNAIIDKNVRIGEGVQIG  420 (421)
T ss_pred             H-CCCCCEEECCCCEE-EEEECCCCCCCCCCCEEC
T ss_conf             6-49752231788888-663805877848955573


No 134
>PRK03701 consensus
Probab=97.78  E-value=6.3e-05  Score=50.77  Aligned_cols=68  Identities=15%  Similarity=0.228  Sum_probs=42.2

Q ss_pred             CCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEEC
Q ss_conf             6400665146201030235336772015661232204730686881232112100577656448725847821857846
Q gi|254780781|r  120 SAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVE  198 (285)
Q Consensus       120 ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~  198 (285)
                      .|.|+.|+++-++.|+ ++.++.++.|+.+|.|.. +.|-.+|+|+.||.|-         .+||..+|.||.|++|.+
T Consensus       331 nSlia~GciI~G~~V~-nSVl~r~v~I~~gA~V~n-SIIm~~~~Ig~ga~l~---------~~IiDk~v~I~~g~vIg~  398 (431)
T PRK03701        331 NSLVSGGCIISGSVVV-QSVLFPRVRVNSFCNIDS-AVLLPEVWVGRSCRLR---------RCVIDRACVIPEGMVIGE  398 (431)
T ss_pred             CCEEECCEEEECCEEE-CCCCCCCCEECCCCEEEC-CEECCCCEECCCCEEE---------EEEECCCCEECCCCEECC
T ss_conf             7898599899384888-098118889999989972-6985969899999998---------379899999997999896


No 135
>PRK01884 consensus
Probab=97.78  E-value=6.2e-05  Score=50.82  Aligned_cols=66  Identities=18%  Similarity=0.338  Sum_probs=36.0

Q ss_pred             CCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEE
Q ss_conf             64006651462010302353367720156612322047306868812321121005776564487258478218578
Q gi|254780781|r  120 SAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEI  196 (285)
Q Consensus       120 ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I  196 (285)
                      +|.|+.|+++-.+-|+ .+.++.++.|+.+|.|..| .|..+|+|+.|+.|-         .+||+.||.||.|++|
T Consensus       329 nSlIa~GcvI~~g~V~-nSVL~r~v~I~~gA~V~nS-IIm~~~~IG~ga~l~---------~~IiDk~v~I~~g~~I  394 (435)
T PRK01884        329 NSLIAGGCVITDASIS-NSVLFDRIKVDEFSKIDHC-VVLPQVKIGKNCVLK---------RCIIDRHCVIPDGMQI  394 (435)
T ss_pred             CCEECCCEEEECCEEE-CCEEECCCEECCCCEEEEC-EEECCCEECCCCEEE---------EEEECCCCEECCCCEE
T ss_conf             8998199799398997-1982089699999999828-880869899999996---------2698999999979999


No 136
>KOG4042 consensus
Probab=97.73  E-value=7.9e-05  Score=50.16  Aligned_cols=103  Identities=21%  Similarity=0.372  Sum_probs=68.9

Q ss_pred             CCCCCCCCCEE------CCCCCCCCCCEEECCEE---ECC-CCCCCCCCCCCCCEECCEE-------------EECCCCE
Q ss_conf             47510254310------35640066514620103---023-5336772015661232204-------------7306868
Q gi|254780781|r  107 HNFRIIPGTIV------RHSAYIGPKAVLMPSFV---NMG-AYIGEGSMIDTWSTVGSCA-------------QIGKNVH  163 (285)
Q Consensus       107 ~g~rv~P~a~v------r~ga~Ig~g~vimp~~V---niG-A~Ig~gt~I~~~a~IG~~a-------------~IG~~vh  163 (285)
                      ..+.+.|+|+|      |-...|++|+|+.|..+   ..| -|||++++|.-.|+|-+.-             .||.+-.
T Consensus         7 ~svkIap~AvVCvEs~irGdvti~~gcVvHP~a~~iA~aGPI~iGEnniiEEyA~i~n~~~~~~~~d~~~~pmiIGt~Nv   86 (190)
T KOG4042           7 TSVKIAPSAVVCVESDIRGDVTIKEGCVVHPFAVFIATAGPIYIGENNIIEEYAVIRNRLEPGAVWDSDGQPMIIGTWNV   86 (190)
T ss_pred             CEEEECCCEEEEEECCCCCCEEECCCCEECCEEEEECCCCCEEECCCCHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCE
T ss_conf             50464575189986021331486588385330799705698898667125667887700688875478997678723635


Q ss_pred             EECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCC
Q ss_conf             8123211210057765644872584782185784688845885663004652783
Q gi|254780781|r  164 ISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKST  218 (285)
Q Consensus       164 I~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st  218 (285)
                      .--|+         +...--++|+-.|++.|.+.+|+++..||++||++.+-.+-
T Consensus        87 FeVgc---------~s~A~kvGd~NVieskayvg~gv~vssgC~vGA~c~v~~~q  132 (190)
T KOG4042          87 FEVGC---------KSSAKKVGDRNVIESKAYVGDGVSVSSGCSVGAKCTVFSHQ  132 (190)
T ss_pred             EEEEC---------HHHHHHHCCCCEEEEEEEECCCCEECCCCEECCCEEEECCC
T ss_conf             88612---------33455516765476666864994872796541405771103


No 137
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional
Probab=97.59  E-value=0.00015  Score=48.50  Aligned_cols=67  Identities=15%  Similarity=0.226  Sum_probs=39.1

Q ss_pred             CCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEE
Q ss_conf             640066514620103023533677201566123220473068688123211210057765644872584782185784
Q gi|254780781|r  120 SAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIV  197 (285)
Q Consensus       120 ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~  197 (285)
                      +|.|+.|+++-++.|+ ++.|+.++.|+.+|.|.. +.|..+|.|+.|+.|.         .+||+.+|.||.|++|.
T Consensus       331 nSli~~GcvI~G~~Ve-nSVI~r~v~Ig~gA~V~n-SIIm~~~~IG~ga~l~---------naIiDk~v~I~~G~~Ig  397 (431)
T PRK00725        331 NSLVSGGCIISGSVVV-QSVLFTRVRVNSFSNIDS-AVLLPEVWVGRSCRLR---------RCVIDRACVIPEGMVIG  397 (431)
T ss_pred             CCEEECCEEEECCEEE-ECCCCCCCEECCCCEEEE-EEECCCCEECCCCEEE---------EEEECCCCEECCCCEEC
T ss_conf             6798399899699998-298259989999989961-3988989889999997---------13989998989899989


No 138
>KOG1462 consensus
Probab=97.56  E-value=0.00012  Score=49.00  Aligned_cols=64  Identities=31%  Similarity=0.636  Sum_probs=29.1

Q ss_pred             CEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCC-----EEECCEEECCC-----CEEEEEEEECCCCE
Q ss_conf             123220473068688123211210057765644872584782185-----78468884588-----56630046527833
Q gi|254780781|r  150 STVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARS-----EIVEGCIIREG-----SVLGMGVFIGKSTK  219 (285)
Q Consensus       150 a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s-----~I~~Gv~Ig~g-----avIgaG~vit~st~  219 (285)
                      +.+|..+.+|+++.|+..+.|-         .-+||+||-||.++     .+.++|+||+|     |+||.|+.|+...+
T Consensus       329 ~l~g~d~iv~~~t~i~~~s~ik---------~SviG~nC~Ig~~~~v~nSilm~nV~vg~G~~IensIIg~gA~Ig~gs~  399 (433)
T KOG1462         329 ALVGADSIVGDNTQIGENSNIK---------RSVIGSNCDIGERVKVANSILMDNVVVGDGVNIENSIIGMGAQIGSGSK  399 (433)
T ss_pred             ECCCHHHCCCCCCEECCCCEEE---------EEEECCCCCCCCCCEEEEEEEECCCEECCCCCEECCEECCCCEECCCCE
T ss_conf             1023231017885525554022---------0012577611687277711766583755884020426626656547970


Q ss_pred             EEE
Q ss_conf             687
Q gi|254780781|r  220 IID  222 (285)
Q Consensus       220 i~d  222 (285)
                      +.+
T Consensus       400 L~n  402 (433)
T KOG1462         400 LKN  402 (433)
T ss_pred             EEE
T ss_conf             333


No 139
>KOG4750 consensus
Probab=97.53  E-value=0.00013  Score=48.76  Aligned_cols=93  Identities=25%  Similarity=0.334  Sum_probs=40.6

Q ss_pred             EEECCCEEC-CEECCCCCCCEEECCCCEEECCCEEECCEE--------------ECCCCEEEEEEEECCCCEEEECCCCC
Q ss_conf             881232112-100577656448725847821857846888--------------45885663004652783368715881
Q gi|254780781|r  163 HISGGVGIG-GVLEPIQTGPTIIEDNCFIGARSEIVEGCI--------------IREGSVLGMGVFIGKSTKIIDRNTGE  227 (285)
Q Consensus       163 hI~~g~~IG-Gvlep~~a~pviIeD~v~IGa~s~I~~Gv~--------------Ig~gavIgaG~vit~st~i~d~~~~~  227 (285)
                      .|.+++.|| |.| --++.-++|++-+.||-|+.+..+|+              ||+|+.||||+.|-..+.|       
T Consensus       150 dihpaa~ig~gil-ldhatgvvigeTAvvg~~vSilH~Vtlggtgk~~gdrhP~Igd~vliGaGvtILgnV~I-------  221 (269)
T KOG4750         150 DIHPAAKIGKGIL-LDHATGVVIGETAVVGDNVSILHPVTLGGTGKGSGDRHPKIGDNVLIGAGVTILGNVTI-------  221 (269)
T ss_pred             CCCCHHHCCCCEE-ECCCCCEEECCEEEECCCEEEECCEEECCCCCCCCCCCCCCCCCEEECCCCEEECCEEE-------
T ss_conf             2462010265312-21333235310247426446644431146546655568855677087554178578167-------


Q ss_pred             EEEEECCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEEECCHH
Q ss_conf             4644549987896056445567766577644672798961202
Q gi|254780781|r  228 ITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEK  270 (285)
Q Consensus       228 ~~~g~vP~~~vvvpg~~~~~~~~~~~~~~~~~cavi~~~~d~~  270 (285)
                            -++||+-.||+..|+-+......- .+|-.+.+.||+
T Consensus       222 ------GegavIaAGsvV~kDVP~~~~AvG-nPAklIg~~~e~  257 (269)
T KOG4750         222 ------GEGAVIAAGSVVLKDVPPNTLAVG-NPAKLIGKIDEK  257 (269)
T ss_pred             ------CCCCEEECCCEEEECCCCCCEECC-CCHHHCCCCCCC
T ss_conf             ------788677305069721698753048-823323434554


No 140
>TIGR03536 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (DapD) is involved in the succinylated branch of the "lysine biosynthesis via diaminopimelate (DAP)" pathway (GenProp0125). This model represents a clade of DapD sequences most closely related to the actinobacterial DapD family represented by the TIGR03535 model. All of the genes evaluated for the seed of this model are found in genomes where the downstream desuccinylase is present, but known DapD genes are absent. Additionally, many of the genes identified by this model are found proximal to genes involved in this lysine biosynthesis pathway.
Probab=97.49  E-value=0.00018  Score=48.01  Aligned_cols=152  Identities=20%  Similarity=0.314  Sum_probs=75.0

Q ss_pred             EEHHHHHHHHHEEECC-CCEEEECC----CCCCCHHHCCCCCCCCCCHHHHH--HCCCCCCCCCE---ECCCCCCCC-CC
Q ss_conf             6078862322206426-74476247----76420110177532365202344--24751025431---035640066-51
Q gi|254780781|r   59 THQWIKKAILLSFQIN-PTKIISDG----NGYSTWWDKIPAKFDDWKTKDFE--KHNFRIIPGTI---VRHSAYIGP-KA  127 (285)
Q Consensus        59 VNeWvKKAILL~Fri~-~~~~i~~g----~~~~~~~DKvp~Kf~~~~~~~f~--~~g~rv~P~a~---vr~ga~Ig~-g~  127 (285)
                      ...|+|- =|||.|+- ++.+--.|    -+..-|-++=|.-.+.+.+.+.+  ..|-.+.-.++   =|---|+-| |+
T Consensus       101 ~~ayLkL-hlLS~rlv~P~~~nL~g~F~~L~nvaWTn~gp~~~~~~~~~~~~~~~~g~~~~v~~vDkfPrm~dyvvP~gv  179 (341)
T TIGR03536       101 PEGYLKL-QLISHRLVKPHGVNLDGIFGLLPNVAWTNQGAIDLDELAERQLEARLNGEVLEVDCVDKFPKMTDYVVPKGV  179 (341)
T ss_pred             HHHHHHH-HHHHHCCCCCCCCCHHHHHHHCCHHEECCCCCCCHHHHHHHHHHHHCCCCCEEEEEECCCCCHHHEECCCCC
T ss_conf             9999999-987606646670256777765404305178874788999999986247995599982457414314567883


Q ss_pred             EEE-CCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEEC--------
Q ss_conf             462-01030235336772015661232204730686881232112100577656448725847821857846--------
Q gi|254780781|r  128 VLM-PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVE--------  198 (285)
Q Consensus       128 vim-p~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~--------  198 (285)
                      -|. .+.|..|||.++||-|.+-..|.-+|          |..=-...|.-=..-|+|+|+.-||.+|.+..        
T Consensus       180 RIad~~rVRLGA~L~~GTtvmhegfvnfNA----------GTlG~~mvEGRiS~GVvVg~gsDiGGgaSimGtLSGGg~~  249 (341)
T TIGR03536       180 RIADTARVRLGAYVGEGTTVMHEGFINFNA----------GTEGPSMVEGRISAGVMVGKGSDLGGGCSTMGTLSGGGNI  249 (341)
T ss_pred             EECCCCCEEEEEEECCCEEEECCCEEECCC----------CCCCCCEEEEEEECCEEECCCCCCCCCEEEEEEECCCCCE
T ss_conf             761566344300775881770221475047----------7766424530440346966787667750247763589823


Q ss_pred             CEEECCCCEEEEEEEECCCCEEEEC
Q ss_conf             8884588566300465278336871
Q gi|254780781|r  199 GCIIREGSVLGMGVFIGKSTKIIDR  223 (285)
Q Consensus       199 Gv~Ig~gavIgaG~vit~st~i~d~  223 (285)
                      -+.||++|.+||++.++  ++..|.
T Consensus       250 ~isiG~~cLlGANsg~G--I~LGD~  272 (341)
T TIGR03536       250 VISVGEGCLLGANAGIG--IPLGDR  272 (341)
T ss_pred             EEEECCCCCCCCCCCCC--CCCCCC
T ss_conf             68887322014445557--424898


No 141
>KOG1322 consensus
Probab=97.49  E-value=0.00032  Score=46.41  Aligned_cols=27  Identities=15%  Similarity=0.161  Sum_probs=12.8

Q ss_pred             CCCEEEEEECCCCCEEEEHHHHHHHHH
Q ss_conf             793799887599968860788623222
Q gi|254780781|r   43 RGIIRIASRDDNGHWNTHQWIKKAILL   69 (285)
Q Consensus        43 ~G~iRVAEk~~nG~W~VNeWvKKAILL   69 (285)
                      +.+-=++.|.+.|-.+.|--+-.-|||
T Consensus       173 KPkd~vsnkinaGiYi~~~~vL~ri~~  199 (371)
T KOG1322         173 KPKDLVSNKINAGIYILNPEVLDRILL  199 (371)
T ss_pred             CCHHHHHCCCCCEEEEECHHHHHHHHH
T ss_conf             756565331241589977999867650


No 142
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase; InterPro: IPR011831    This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase. The plant form is an alpha2, beta2 heterodimer, allosterically regulated in plants. Both subunits are homologous and included in this entry. In bacteria, both homomeric forms of GlgC and more active heterodimers of GlgC and GlgD have been described. This entry describes the GlgC subunit only. This enzyme appears in variants of glycogen synthesis pathways that use ADP-glucose, rather than UDP-glucose as in animals.; GO: 0008878 glucose-1-phosphate adenylyltransferase activity.
Probab=97.43  E-value=0.00024  Score=47.21  Aligned_cols=27  Identities=37%  Similarity=0.465  Sum_probs=12.8

Q ss_pred             CEEECCCEEECCEEECCCCEEEEEEEEC
Q ss_conf             4782185784688845885663004652
Q gi|254780781|r  188 CFIGARSEIVEGCIIREGSVLGMGVFIG  215 (285)
Q Consensus       188 v~IGa~s~I~~Gv~Ig~gavIgaG~vit  215 (285)
                      +-||.||.|. .++|.+||+||-|+.|+
T Consensus       394 ~~IG~~~~i~-~~IiD~~~~Ig~g~~Ig  420 (421)
T TIGR02091       394 VGIGRGAVIR-NAIIDKNVRIGEGVQIG  420 (421)
T ss_pred             EEECCCCEEE-EEECCCCCCCCCCCEEC
T ss_conf             2317888886-63805877848955573


No 143
>KOG1460 consensus
Probab=97.39  E-value=0.00033  Score=46.33  Aligned_cols=68  Identities=26%  Similarity=0.320  Sum_probs=42.3

Q ss_pred             CCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEE
Q ss_conf             720156612322047306868812321121005776564487258478218578468884588566300465
Q gi|254780781|r  143 GSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFI  214 (285)
Q Consensus       143 gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vi  214 (285)
                      ..+|+..|.+...|+||.||.|++++.+|-   ++.....||-|+|.|-.|++|.. .+||-+|.||.=+-+
T Consensus       288 dVyIhPsakvhptAkiGPNVSIga~vrvg~---GvRl~~sIIl~d~ei~enavVl~-sIigw~s~iGrWaRV  355 (407)
T KOG1460         288 DVYIHPSAKVHPTAKIGPNVSIGANVRVGP---GVRLRESIILDDAEIEENAVVLH-SIIGWKSSIGRWARV  355 (407)
T ss_pred             EEEECCCCEECCCCCCCCCCEECCCCEECC---CCEEEEEEECCCCEEECCCEEEE-EEECCCCCCCCEEEE
T ss_conf             247767540477662089714468825468---82665456026737621636776-541144322542430


No 144
>TIGR03535 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase. Alternate name: tetrahydrodipicolinate N-succinyltransferase.
Probab=97.33  E-value=0.00035  Score=46.19  Aligned_cols=151  Identities=21%  Similarity=0.244  Sum_probs=77.4

Q ss_pred             EEHHHHHHHHHEEECCCCEEEEC-C----CCCCCHHHCCCCCCCCCCHHHHH--HCCCCCCCCCE---ECCCCCCCC-CC
Q ss_conf             60788623222064267447624-7----76420110177532365202344--24751025431---035640066-51
Q gi|254780781|r   59 THQWIKKAILLSFQINPTKIISD-G----NGYSTWWDKIPAKFDDWKTKDFE--KHNFRIIPGTI---VRHSAYIGP-KA  127 (285)
Q Consensus        59 VNeWvKKAILL~Fri~~~~~i~~-g----~~~~~~~DKvp~Kf~~~~~~~f~--~~g~rv~P~a~---vr~ga~Ig~-g~  127 (285)
                      ...|+|- =|||-|+-+-..+.- |    -+..-|-++=|.-.+.+.+.+.+  ..|- +.=.++   =|---|+-| ||
T Consensus        77 ~daYLkL-hLLShrlvkP~~lnLdgiF~~L~nvaWTn~Gp~~~~~~~~~~~~~~~~g~-~~v~~vDKfPrm~dyvvP~gV  154 (319)
T TIGR03535        77 YDAYLRL-HLLSHRLVKPHTINLDGIFGLLPNVVWTNHGPCAVDGFELTRARLRARGP-VTVYSVDKFPRMVDYVVPTGV  154 (319)
T ss_pred             HHHHHHH-HHHHHCCCCCCCCCHHHHHHHCCHHHCCCCCCCCHHHHHHHHHHHHHCCC-EEEEEECCCCCHHCEECCCCC
T ss_conf             8989999-98760564677015666776540543236777178899999999986798-799972447513304567884


Q ss_pred             EEE-CCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEEC--------
Q ss_conf             462-01030235336772015661232204730686881232112100577656448725847821857846--------
Q gi|254780781|r  128 VLM-PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVE--------  198 (285)
Q Consensus       128 vim-p~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~--------  198 (285)
                      -|. .+.|..|||.++||-|.+--.|.-.|          |..=-...|.--..-|+|+|+.-||.+|.+..        
T Consensus       155 RIada~rVRLGAyl~~GTtVmheGfvnfNa----------GTlG~~mvEGRiS~gvvvg~gsDiGGgaS~mGtLSGGg~~  224 (319)
T TIGR03535       155 RIGDADRVRLGAHLAEGTTVMHEGFVNFNA----------GTLGASMVEGRISAGVVVGDGSDIGGGASIMGTLSGGGKE  224 (319)
T ss_pred             EECCCCCEEEEEEECCCCEEEECCEEEECC----------CCCCCCEEEEEEECCEEECCCCCCCCCCEEEEEECCCCCE
T ss_conf             770455255400765980771001376047----------6766534631440346966787667750114530489822


Q ss_pred             CEEECCCCEEEEEEEECCCCEEEEC
Q ss_conf             8884588566300465278336871
Q gi|254780781|r  199 GCIIREGSVLGMGVFIGKSTKIIDR  223 (285)
Q Consensus       199 Gv~Ig~gavIgaG~vit~st~i~d~  223 (285)
                      -+.||++|.+||++-++  ++..|.
T Consensus       225 ~isiG~~cLlGANsGiG--I~LGD~  247 (319)
T TIGR03535       225 VISIGERCLLGANSGIG--ISLGDD  247 (319)
T ss_pred             EEEECCCCEECCCCCCC--CCCCCC
T ss_conf             47886532004545557--435897


No 145
>KOG1462 consensus
Probab=97.32  E-value=0.00066  Score=44.50  Aligned_cols=68  Identities=29%  Similarity=0.509  Sum_probs=40.4

Q ss_pred             CCCCCCCCCCCCCEECC-----EEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEE
Q ss_conf             53367720156612322-----0473068688123211210057765644872584782185784688845885663004
Q gi|254780781|r  138 AYIGEGSMIDTWSTVGS-----CAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGV  212 (285)
Q Consensus       138 A~Ig~gt~I~~~a~IG~-----~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~  212 (285)
                      +-+|..++|+..+.|+.     ...||.||.|+..+.+.+         -++=||+.||-++.| ++.+||.||.||+|+
T Consensus       329 ~l~g~d~iv~~~t~i~~~s~ik~SviG~nC~Ig~~~~v~n---------Silm~nV~vg~G~~I-ensIIg~gA~Ig~gs  398 (433)
T KOG1462         329 ALVGADSIVGDNTQIGENSNIKRSVIGSNCDIGERVKVAN---------SILMDNVVVGDGVNI-ENSIIGMGAQIGSGS  398 (433)
T ss_pred             ECCCHHHCCCCCCEECCCCEEEEEEECCCCCCCCCCEEEE---------EEEECCCEECCCCCE-ECCEECCCCEECCCC
T ss_conf             1023231017885525554022001257761168727771---------176658375588402-042662665654797


Q ss_pred             EEC
Q ss_conf             652
Q gi|254780781|r  213 FIG  215 (285)
Q Consensus       213 vit  215 (285)
                      .++
T Consensus       399 ~L~  401 (433)
T KOG1462         399 KLK  401 (433)
T ss_pred             EEE
T ss_conf             033


No 146
>KOG3121 consensus
Probab=97.25  E-value=0.00029  Score=46.70  Aligned_cols=59  Identities=31%  Similarity=0.466  Sum_probs=27.7

Q ss_pred             CCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCC
Q ss_conf             33677201566123220473068688123211210057765644872584782185784688845885663004652783
Q gi|254780781|r  139 YIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKST  218 (285)
Q Consensus       139 ~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st  218 (285)
                      +||+..+|...|.+. .||||..||++.                    ||.||-+|++-+-.+|-.++|+-+-+++..-+
T Consensus        86 hiGdhVFieE~cVVn-AAqIgsyVh~Gk--------------------naviGrrCVlkdCc~ild~tVlPpet~vppy~  144 (184)
T KOG3121          86 HIGDHVFIEEECVVN-AAQIGSYVHLGK--------------------NAVIGRRCVLKDCCRILDDTVLPPETLVPPYS  144 (184)
T ss_pred             EECCEEEEECCEEEE-HHHHEEEEEECC--------------------CEEECCCEEHHHHEECCCCCCCCCCCCCCCCE
T ss_conf             524568870441862-666120368546--------------------40673750833410415895258201369716


No 147
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832    This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis.; GO: 0005978 glycogen biosynthetic process.
Probab=96.57  E-value=0.012  Score=36.80  Aligned_cols=144  Identities=13%  Similarity=0.170  Sum_probs=89.3

Q ss_pred             HHHHHHHH-HHHHCCCEEEEEECCCCCEEEEHHHHHHHHHEEECCCCEEEECCCCCCCHHHCCC-CCCCCCCHHHHHHCC
Q ss_conf             99999999-9730793799887599968860788623222064267447624776420110177-532365202344247
Q gi|254780781|r   31 KDAVQSTL-DLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIP-AKFDDWKTKDFEKHN  108 (285)
Q Consensus        31 ~~aI~~~I-~~LD~G~iRVAEk~~nG~W~VNeWvKKAILL~Fri~~~~~i~~g~~~~~~~DKvp-~Kf~~~~~~~f~~~g  108 (285)
                      ...+.+.| +.|++=.++.=|.++= .=.+|.     |==||. ..|.+++.     ..|+-+- ++-.   -+=  =..
T Consensus       224 ~~~l~~~~~~~l~~~~~~aYEY~GY-l~~I~s-----~~sYY~-aNM~lL~~-----~~f~~LF~~~~~---rpI--YTK  286 (383)
T TIGR02092       224 KTSLEELIRENLKELNINAYEYKGY-LANINS-----VKSYYK-ANMDLLEP-----KIFQSLFYISQS---RPI--YTK  286 (383)
T ss_pred             HHHHHHHHHHHHHHCCCCCCEEEEE-EEEECC-----HHHHHH-HHHHHHHH-----HHHHHHHCCCCC---CEE--EEE
T ss_conf             6799999999998647543303422-111101-----678988-72886316-----876887077888---714--787


Q ss_pred             CCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCCCEEECCCC
Q ss_conf             51025431035640066514620103023533677201566123220473068688123211210057765644872584
Q gi|254780781|r  109 FRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNC  188 (285)
Q Consensus       109 ~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~pviIeD~v  188 (285)
                      ++=.|++.-..+|.+.            .+-++.||+|+.  .|.+ +.|+++|||..++.|         ...||=.+|
T Consensus       287 vKdE~PT~y~~~S~V~------------nSl~anGc~IEG--~V~N-Sil~R~V~v~kd~~~---------kn~iimq~~  342 (383)
T TIGR02092       287 VKDEPPTYYAETSKVE------------NSLVANGCIIEG--KVEN-SILSRGVYVGKDALI---------KNSIIMQRT  342 (383)
T ss_pred             ECCCCCCCCCCCCEEE------------EEEEECCCEECC--EEEE-EEEECCEEECCCCEE---------EEEEECCCC
T ss_conf             3588887446787676------------666762635614--8855-798554187278678---------754775887


Q ss_pred             EEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             7821857846888458856630046527
Q gi|254780781|r  189 FIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       189 ~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                      .||.+|.+- -|++-++++|+.+..+..
T Consensus       343 ~Ig~ga~L~-~vI~DK~~~I~~n~~~~G  369 (383)
T TIGR02092       343 VIGEGAHLE-NVIIDKDVVIEPNEKIAG  369 (383)
T ss_pred             EECCCCEEE-EEEECCCCEECCCEEEEE
T ss_conf             778786561-588657628788706852


No 148
>KOG1460 consensus
Probab=96.37  E-value=0.013  Score=36.54  Aligned_cols=21  Identities=33%  Similarity=0.512  Sum_probs=13.1

Q ss_pred             CCCCCCCEECCCCCCCCCCEE
Q ss_conf             510254310356400665146
Q gi|254780781|r  109 FRIIPGTIVRHSAYIGPKAVL  129 (285)
Q Consensus       109 ~rv~P~a~vr~ga~Ig~g~vi  129 (285)
                      +-+.|+|.|+++|.|||||-+
T Consensus       289 VyIhPsakvhptAkiGPNVSI  309 (407)
T KOG1460         289 VYIHPSAKVHPTAKIGPNVSI  309 (407)
T ss_pred             EEECCCCEECCCCCCCCCCEE
T ss_conf             477675404776620897144


No 149
>KOG1322 consensus
Probab=96.22  E-value=0.0034  Score=40.16  Aligned_cols=85  Identities=25%  Similarity=0.296  Sum_probs=36.2

Q ss_pred             CCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECC-E-EC-CCCCCCEEECCCCEEECCCEEECCEEECCCCEEEEEEE
Q ss_conf             353367720156612322047306868812321121-0-05-77656448725847821857846888458856630046
Q gi|254780781|r  137 GAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGG-V-LE-PIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVF  213 (285)
Q Consensus       137 GA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGG-v-le-p~~a~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~v  213 (285)
                      |+.+-.+.++|+-+.+|..|.||.|+.|+.++.|+. | |+ -.-.+...++++++| +.+.+.-.++||.++.|..+++
T Consensus       258 ~~~i~~nvlvd~~~~iG~~C~Ig~~vvIG~r~~i~~gV~l~~s~il~~~~~~~~s~i-~s~ivg~~~~IG~~~~id~~a~  336 (371)
T KOG1322         258 GSKIVGNVLVDSIASIGENCSIGPNVVIGPRVRIEDGVRLQDSTILGADYYETHSEI-SSSIVGWNVPIGIWARIDKNAV  336 (371)
T ss_pred             CCCCCCCEEECCCCCCCCCCEECCCCEECCCCEECCCEEEEEEEEECCCEECHHHHH-HHHHCCCCCCCCCCEEEECCCE
T ss_conf             755124376214001388637888736778728627628874279725121016888-7643256520057469712537


Q ss_pred             ECCCCEEEE
Q ss_conf             527833687
Q gi|254780781|r  214 IGKSTKIID  222 (285)
Q Consensus       214 it~st~i~d  222 (285)
                      |++.+.|.|
T Consensus       337 lG~nV~V~d  345 (371)
T KOG1322         337 LGKNVIVAD  345 (371)
T ss_pred             ECCCEEEEC
T ss_conf             536259942


No 150
>TIGR00965 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; InterPro: IPR005664   Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway. Additionally, several important metabolic intermediates are produced by these reactions, such as diaminopimelic acid, an essential component of bacterial cell wall biosynthesis, and dipicolinic acid, which is involved in sporulation in Gram-positive bacteria. Members of the animal kingdom do not posses this pathway and must therefore acquire these essential amino acids through their diet. Research into improving the metabolic flux through this pathway has the potential to increase the yield of the essential amino acids in important crops, thus improving their nutritional value. Additionally, since the enzymes are not present in animals, inhibitors of them are promising targets for the development of novel antibiotics and herbicides. For more information see .   The lysine/diaminopimelic acid branch of the aspartate pathway produces the essential amino acid lysine via the intermediate meso-diaminopimelic acid (meso-DAP), which is also a vital cell wall component in Gram-negative bacteria . The production of dihydropicolinate from aspartate-semialdehyde controls flux into the lysine/diaminopimelic acid pathway. Three variants of this pathway exist, differing in how tetrahydropicolinate (formed by reduction of dihydropicolinate) is metabolised to meso-DAP. One variant, the most commonly found one in archaea and bacteria, uses primarily succinyl intermediates, while a second variant, found only in Bacillus, utilises primarily acetyl intermediates. In the third variant, found in some Gram-positive bacteria, a dehydrogenase converts tetrahydropicolinate directly to meso-DAP. In all variants meso-DAP is subsequently converted to lysine by a decarboxylase, or, in Gram-negative bacteria, assimilated into the cell wall. Evidence exists that a fourth, currently unknown, variant of this pathway may function in plants .    2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase (also known as tetrahydrodipicolinate N-succinyltransferase or DapD) is part of the succinyl route of of lysine/DAP biosynthesis. The DapD protein is a homotrimer is a trimeric enzyme with each monomer composed of three domain: an N-terminal helical domain, a distinctive left-handed parallel beta-helix (LBH) domain, and a predominantly beta C-terminal domain , . The LBH structure is encoded by an imperfect tandem-repeated hexapeptide sequence. Each trimer contains three independent active sites, always occuring at the boundary of two subunits, and formed by residues from one N-terminal domain, one C-terminal domain and two adjacent LBH domains.; GO: 0016757 transferase activity transferring glycosyl groups, 0009089 lysine biosynthetic process via diaminopimelate.
Probab=95.98  E-value=0.014  Score=36.40  Aligned_cols=92  Identities=25%  Similarity=0.380  Sum_probs=57.3

Q ss_pred             HHHCCCCCCCCCEECCCCCCCCCCEEEC-CEEECCCCCCCCCCCCCCCEECC--------EEEECCCCEEECCCEE-CCE
Q ss_conf             4424751025431035640066514620-10302353367720156612322--------0473068688123211-210
Q gi|254780781|r  104 FEKHNFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGS--------CAQIGKNVHISGGVGI-GGV  173 (285)
Q Consensus       104 f~~~g~rv~P~a~vr~ga~Ig~g~vimp-~~VniGA~Ig~gt~I~~~a~IG~--------~a~IG~~vhI~~g~~I-GGv  173 (285)
                      |-+.++-+ =+++|--|||+..|+.+-- +.|-..|.||.++.+-.++-||-        =..|-+||.|++-+-| -||
T Consensus       117 fiAkNvVl-MPSyvNIGAYvDEGtMvDTWATvGSCAQIGKNvHlSGG~GIGGVLEPLQA~P~IIEDNCFiGARSEi~EGV  195 (275)
T TIGR00965       117 FIAKNVVL-MPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAKPTIIEDNCFIGARSEIVEGV  195 (275)
T ss_pred             EEEEEEEE-CCCEEECCCEEECCCEECCHHHHCCHHHHCCCEEEECCCCCCCCCCCCCCCCEEEECCCEECCCEEEEEEE
T ss_conf             57752377-55521013675168601001223003220662575178331652463357875882476004611356207


Q ss_pred             ECCCCCCCEEECCCCEEECCCEEECC
Q ss_conf             05776564487258478218578468
Q gi|254780781|r  174 LEPIQTGPTIIEDNCFIGARSEIVEG  199 (285)
Q Consensus       174 lep~~a~pviIeD~v~IGa~s~I~~G  199 (285)
                      .  ++-+ -+|-=.+|||.-+.|+.-
T Consensus       196 I--VEEG-SVISMGVfIG~STkI~~R  218 (275)
T TIGR00965       196 I--VEEG-SVISMGVFIGQSTKIVDR  218 (275)
T ss_pred             E--ECCC-CEEEEEEEECCCCEEEEC
T ss_conf             9--7168-588840685560168853


No 151
>KOG4042 consensus
Probab=95.83  E-value=0.018  Score=35.69  Aligned_cols=114  Identities=25%  Similarity=0.332  Sum_probs=77.0

Q ss_pred             CCCCCCCCCEEE-CCEEECCCCCCCCCCCCCCCEECCE---EEECCCCEEECCCEECCEECCCC-----CCCEEECCCCE
Q ss_conf             564006651462-0103023533677201566123220---47306868812321121005776-----56448725847
Q gi|254780781|r  119 HSAYIGPKAVLM-PSFVNMGAYIGEGSMIDTWSTVGSC---AQIGKNVHISGGVGIGGVLEPIQ-----TGPTIIEDNCF  189 (285)
Q Consensus       119 ~ga~Ig~g~vim-p~~VniGA~Ig~gt~I~~~a~IG~~---a~IG~~vhI~~g~~IGGvlep~~-----a~pviIeD~v~  189 (285)
                      .+..|+|++|+. .|-+.=...+++||.|...|++-..   ..||+||.|---+.|--.|||.-     ..|-+|+++-.
T Consensus         7 ~svkIap~AvVCvEs~irGdvti~~gcVvHP~a~~iA~aGPI~iGEnniiEEyA~i~n~~~~~~~~d~~~~pmiIGt~Nv   86 (190)
T KOG4042           7 TSVKIAPSAVVCVESDIRGDVTIKEGCVVHPFAVFIATAGPIYIGENNIIEEYAVIRNRLEPGAVWDSDGQPMIIGTWNV   86 (190)
T ss_pred             CEEEECCCEEEEEECCCCCCEEECCCCEECCEEEEECCCCCEEECCCCHHHHHHHHHHHCCCCCCCCCCCCEEEEECCCE
T ss_conf             50464575189986021331486588385330799705698898667125667887700688875478997678723635


Q ss_pred             -----------EECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEEEECCCCCEE
Q ss_conf             -----------82185784688845885663004652783368715881464454998789
Q gi|254780781|r  190 -----------IGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVV  239 (285)
Q Consensus       190 -----------IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~g~vP~~~vv  239 (285)
                                 +|.+-++-....+|.|+.+..|+.+++.+++.--.       .+|+..+|
T Consensus        87 FeVgc~s~A~kvGd~NVieskayvg~gv~vssgC~vGA~c~v~~~q-------~lpent~v  140 (190)
T KOG4042          87 FEVGCKSSAKKVGDRNVIESKAYVGDGVSVSSGCSVGAKCTVFSHQ-------NLPENTSV  140 (190)
T ss_pred             EEEECHHHHHHHCCCCEEEEEEEECCCCEECCCCEECCCEEEECCC-------CCCCCCEE
T ss_conf             8861233455516765476666864994872796541405771103-------46975168


No 152
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908    Synonym: dTDP-D-glucose synthase     This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2.7.7.24 from EC). It is well characterised in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme.  dTTP + alpha-D-glucose 1-phosphate = diphosphate + dTDP-glucose     The family of known and putative glucose-1-phosphate thymidyltransferases shows a deep split into a short form (see IPR005907 from INTERPRO) and a long form described by this model. The homotetrameric short form is found in numerous bacterial species that incorporate dTDP-L-rhamnose, which it helps synthesize, into the cell wall. It is subject to feedback inhibition. The long form, in contrast, is found in many species for which it serves as a sugar-activating enzyme for antibiotic biosynthesis and or other, unknown pathways, and in which dTDP-L-rhamnose is not necessarily produced. .
Probab=95.82  E-value=0.015  Score=36.16  Aligned_cols=29  Identities=24%  Similarity=0.413  Sum_probs=15.5

Q ss_pred             HHHHHHHHCCCCCCH--HHHHHHHHHHHHHHCCC
Q ss_conf             997505316824417--89999999999730793
Q gi|254780781|r   14 SFFEESNSKNESIPQ--DVKDAVQSTLDLLDRGI   45 (285)
Q Consensus        14 ~awe~r~~l~~~~~~--~~~~aI~~~I~~LD~G~   45 (285)
                      ..||--+.+.|+.-.  |+-+||...   .|+|.
T Consensus       181 ~if~~~~~~kPSwRGElEITD~IQ~l---Ie~Gy  211 (361)
T TIGR01208       181 LIFEAIKNIKPSWRGELEITDAIQYL---IEKGY  211 (361)
T ss_pred             HHHHHHHCCCCCCCCCHHHHHHHHHH---HHCCC
T ss_conf             98889852888776621577577565---31583


No 153
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832    This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis.; GO: 0005978 glycogen biosynthetic process.
Probab=95.00  E-value=0.038  Score=33.75  Aligned_cols=144  Identities=20%  Similarity=0.353  Sum_probs=66.7

Q ss_pred             HHHHHHHHHHHHHHC------CCEEEEEECCCCCEEEEHHHHHHHHHEEECCCCEE-EECC-CCCCCHHHCCCCCCCCCC
Q ss_conf             899999999997307------93799887599968860788623222064267447-6247-764201101775323652
Q gi|254780781|r   29 DVKDAVQSTLDLLDR------GIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKI-ISDG-NGYSTWWDKIPAKFDDWK  100 (285)
Q Consensus        29 ~~~~aI~~~I~~LD~------G~iRVAEk~~nG~W~VNeWvKKAILL~Fri~~~~~-i~~g-~~~~~~~DKvp~Kf~~~~  100 (285)
                      .++..+.+.+..|+-      |=+-+-.-.. .=...|-     -||-=+...--. +..+ |-||.=-|-.|-+|..  
T Consensus       226 ~l~~~~~~~l~~~~~~aYEY~GYl~~I~s~~-sYY~aNM-----~lL~~~~f~~LF~~~~~rpIYTKvKdE~PT~y~~--  297 (383)
T TIGR02092       226 SLEELIRENLKELNINAYEYKGYLANINSVK-SYYKANM-----DLLEPKIFQSLFYISQSRPIYTKVKDEPPTYYAE--  297 (383)
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEEEEEECCHH-HHHHHHH-----HHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCC--
T ss_conf             9999999999864754330342211110167-8988728-----8631687688707788871478735888874467--


Q ss_pred             HHHHHHCCCCCCCCCEECCCCCCCCCCEEECCEEECCCCCCCCCCCCCCCEECCEEEECCCCEEECCCEECCEECCCCCC
Q ss_conf             02344247510254310356400665146201030235336772015661232204730686881232112100577656
Q gi|254780781|r  101 TKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG  180 (285)
Q Consensus       101 ~~~f~~~g~rv~P~a~vr~ga~Ig~g~vimp~~VniGA~Ig~gt~I~~~a~IG~~a~IG~~vhI~~g~~IGGvlep~~a~  180 (285)
                           .+.   |-++.+..||+|+= .|= .|.+-=|++|+.++.|.. |.|=..|+||++||+-               
T Consensus       298 -----~S~---V~nSl~anGc~IEG-~V~-NSil~R~V~v~kd~~~kn-~iimq~~~Ig~ga~L~---------------  351 (383)
T TIGR02092       298 -----TSK---VENSLVANGCIIEG-KVE-NSILSRGVYVGKDALIKN-SIIMQRTVIGEGAHLE---------------  351 (383)
T ss_pred             -----CCE---EEEEEEECCCEECC-EEE-EEEEECCEEECCCCEEEE-EEECCCCEECCCCEEE---------------
T ss_conf             -----876---76666762635614-885-579855418727867875-4775887778786561---------------


Q ss_pred             CEEECCCCEEECCCEEEC----CEEECCCC
Q ss_conf             448725847821857846----88845885
Q gi|254780781|r  181 PTIIEDNCFIGARSEIVE----GCIIREGS  206 (285)
Q Consensus       181 pviIeD~v~IGa~s~I~~----Gv~Ig~ga  206 (285)
                      .||+..++.|+.|..+..    ++.|.+|.
T Consensus       352 ~vI~DK~~~I~~n~~~~G~~e~PlVi~Kg~  381 (383)
T TIGR02092       352 NVIIDKDVVIEPNEKIAGTSEQPLVISKGK  381 (383)
T ss_pred             EEEECCCCEECCCEEEEECCCCCEEECCCC
T ss_conf             588657628788706852478862644876


No 154
>COG4801 Predicted acyltransferase [General function prediction only]
Probab=94.71  E-value=0.088  Score=31.50  Aligned_cols=45  Identities=18%  Similarity=0.293  Sum_probs=24.5

Q ss_pred             EEECCCCEEECCCEEECCEEECCCC---EEEEEEE-------ECCCCEEEECCCC
Q ss_conf             4872584782185784688845885---6630046-------5278336871588
Q gi|254780781|r  182 TIIEDNCFIGARSEIVEGCIIREGS---VLGMGVF-------IGKSTKIIDRNTG  226 (285)
Q Consensus       182 viIeD~v~IGa~s~I~~Gv~Ig~ga---vIgaG~v-------it~st~i~d~~~~  226 (285)
                      +-++|++|+|.+|.+...+.-+..+   ..+-|+.       ++..+||++-.++
T Consensus       167 i~vg~da~Vg~~c~l~Gnvka~~i~g~~~~~~gSirgrn~i~vg~n~~i~g~v~~  221 (277)
T COG4801         167 IKVGDDAFVGTVCRLEGNVKAGVISGCGYYGFGSIRGRNDILVGNNEPIHGPVAN  221 (277)
T ss_pred             EEECCCCEECCEEEEECCEEEEEEECCEEEEEEEEECCCCEEEECCCCCCCCCCC
T ss_conf             8706884613205997450321440532588888870287687148641365456


No 155
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908    Synonym: dTDP-D-glucose synthase     This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2.7.7.24 from EC). It is well characterised in several species as the first of four enzymes involved in the biosynthesis of dTDP-L-rhamnose, a cell wall constituent and a feedback inhibitor of the enzyme.  dTTP + alpha-D-glucose 1-phosphate = diphosphate + dTDP-glucose     The family of known and putative glucose-1-phosphate thymidyltransferases shows a deep split into a short form (see IPR005907 from INTERPRO) and a long form described by this model. The homotetrameric short form is found in numerous bacterial species that incorporate dTDP-L-rhamnose, which it helps synthesize, into the cell wall. It is subject to feedback inhibition. The long form, in contrast, is found in many species for which it serves as a sugar-activating enzyme for antibiotic biosynthesis and or other, unknown pathways, and in which dTDP-L-rhamnose is not necessarily produced. .
Probab=93.96  E-value=0.13  Score=30.48  Aligned_cols=27  Identities=37%  Similarity=0.500  Sum_probs=12.2

Q ss_pred             CCCCCCCCCCCCCEECCEEEECCCCEE
Q ss_conf             533677201566123220473068688
Q gi|254780781|r  138 AYIGEGSMIDTWSTVGSCAQIGKNVHI  164 (285)
Q Consensus       138 A~Ig~gt~I~~~a~IG~~a~IG~~vhI  164 (285)
                      ..|++++.||..++|--=|.||+||+|
T Consensus       261 V~v~~gakid~ns~i~GPa~IG~d~~I  287 (361)
T TIGR01208       261 VEVGEGAKIDVNSVIRGPAVIGEDCII  287 (361)
T ss_pred             EEECCCCEECCCCEEECCEEECCCCEE
T ss_conf             790897884237778706087795278


No 156
>COG4801 Predicted acyltransferase [General function prediction only]
Probab=92.67  E-value=0.36  Score=27.73  Aligned_cols=45  Identities=20%  Similarity=0.228  Sum_probs=27.4

Q ss_pred             CCEEECCCCEEECCCEEECCEEECCCCEEEEEEEECCCCEEEECCCCCEEE
Q ss_conf             644872584782185784688845885663004652783368715881464
Q gi|254780781|r  180 GPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITY  230 (285)
Q Consensus       180 ~pviIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~st~i~d~~~~~~~~  230 (285)
                      +|-+|..+..+-     .+-+.+|..|++|..+++-...+--+.. |+.++
T Consensus       152 ~pl~Ip~~~~vs-----deri~vg~da~Vg~~c~l~Gnvka~~i~-g~~~~  196 (277)
T COG4801         152 GPLIIPADYIVS-----DERIKVGDDAFVGTVCRLEGNVKAGVIS-GCGYY  196 (277)
T ss_pred             CCEEECCCCEEC-----HHHEEECCCCEECCEEEEECCEEEEEEE-CCEEE
T ss_conf             964510665615-----4318706884613205997450321440-53258


No 157
>pfam07959 Fucokinase L-fucokinase. In the salvage pathway of GDP-L-fucose, free cytosolic fucose is phosphorylated by L-fucokinase to form L-fucose-L-phosphate, which is then further converted to GDP-L-fucose in the reaction catalysed by GDP-L-fucose pyrophosphorylase.
Probab=91.29  E-value=0.21  Score=29.19  Aligned_cols=34  Identities=15%  Similarity=0.260  Sum_probs=20.0

Q ss_pred             EEECCCCEEECCCEEECCEEECCCCEEEEEEEECC
Q ss_conf             48725847821857846888458856630046527
Q gi|254780781|r  182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGK  216 (285)
Q Consensus       182 viIeD~v~IGa~s~I~~Gv~Ig~gavIgaG~vit~  216 (285)
                      .+++..|.+|.+|. ++...++.+..||.+++|+.
T Consensus       285 S~l~~~~svg~~sv-Ve~c~l~~~~~Ig~~cIlsg  318 (414)
T pfam07959       285 SLLDSGVSVGPGSV-VEYSHLGGPVRIGSNCIVSG  318 (414)
T ss_pred             EEECCCCCCCCCEE-EEEEECCCCCEECCCCEEEC
T ss_conf             24148711379838-99536389838878855856


No 158
>PHA02090 hypothetical protein
Probab=59.09  E-value=6.5  Score=20.09  Aligned_cols=27  Identities=26%  Similarity=0.617  Sum_probs=21.2

Q ss_pred             HCCCEEEEEECCCCCEEEEHHHHHHHHHEEEC
Q ss_conf             07937998875999688607886232220642
Q gi|254780781|r   42 DRGIIRIASRDDNGHWNTHQWIKKAILLSFQI   73 (285)
Q Consensus        42 D~G~iRVAEk~~nG~W~VNeWvKKAILL~Fri   73 (285)
                      .+|++||-|--.+|.|.+|.     -.|.+-+
T Consensus        35 k~g~lrv~e~m~dg~~ktna-----~flgy~i   61 (79)
T PHA02090         35 KEGDLRVIEVMEDGGWKTNA-----EFLGYAI   61 (79)
T ss_pred             CCCCEEEEEECCCCCCCCCC-----EEEEEEE
T ss_conf             57856899962688712142-----2451246


No 159
>COG2930 Uncharacterized conserved protein [Function unknown]
Probab=53.44  E-value=8.2  Score=19.44  Aligned_cols=23  Identities=26%  Similarity=0.622  Sum_probs=14.9

Q ss_pred             CCCCEEECCEEECC----CCCCCCCCC
Q ss_conf             66514620103023----533677201
Q gi|254780781|r  124 GPKAVLMPSFVNMG----AYIGEGSMI  146 (285)
Q Consensus       124 g~g~vimp~~VniG----A~Ig~gt~I  146 (285)
                      ++|.++||++.+.|    -..|+|.|+
T Consensus        53 AkGi~Iip~vLkaGFvigGr~GqGvl~   79 (227)
T COG2930          53 AKGIVIIPSVLKAGFVIGGRYGQGVLV   79 (227)
T ss_pred             CCEEEEEHHHCEEEEEEECCCCCEEEE
T ss_conf             571799510103007885343534787


No 160
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional
Probab=52.42  E-value=20  Score=17.12  Aligned_cols=80  Identities=14%  Similarity=0.250  Sum_probs=51.8

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH----C-----------------CCEEEEEECCCCCEEEEHHH
Q ss_conf             89999999999750531682441789999999999730----7-----------------93799887599968860788
Q gi|254780781|r    5 VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLD----R-----------------GIIRIASRDDNGHWNTHQWI   63 (285)
Q Consensus         5 m~~L~~~Ie~awe~r~~l~~~~~~~~~~aI~~~I~~LD----~-----------------G~iRVAEk~~nG~W~VNeWv   63 (285)
                      +..-++.+++.++.-..-+|. +.|-.+|+.|+++.|.    +                 =..||.=..|+|+++||.  
T Consensus        22 ~~~~~~~~~~~~~~~~~r~p~-e~ef~qav~ev~~sl~p~~~~~p~y~~ilerl~ePeR~i~frVpw~~D~G~v~v~~--   98 (469)
T PTZ00079         22 EGLPDQEMNELYERVKQRDGN-QTEFLQAFEEVLYSLKPLFMREPKYLPIIERLSEPERVIQFRVPWMDDAGRQRKNR--   98 (469)
T ss_pred             CCCCHHHHHHHHHHHHHCCCC-CHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHCCCCEEEEEEEEEEECCCCEEEEE--
T ss_conf             565088899999999840899-77999999999998899997394899999986488559999988997799688862--


Q ss_pred             HHHHHHEEECCCCEEEECCCCCCCHHHCCC
Q ss_conf             623222064267447624776420110177
Q gi|254780781|r   64 KKAILLSFQINPTKIISDGNGYSTWWDKIP   93 (285)
Q Consensus        64 KKAILL~Fri~~~~~i~~g~~~~~~~DKvp   93 (285)
                            .||++-|..+.---|...|+--|.
T Consensus        99 ------GyRVQ~n~alGPyKGGlRfhp~V~  122 (469)
T PTZ00079         99 ------GFRVQYNSALGPYKGGLRFHPSVN  122 (469)
T ss_pred             ------EEEEEECCCCCCCCCCEECCCCCC
T ss_conf             ------457775387788878742289889


No 161
>TIGR01980 sufB FeS assembly protein SufB; InterPro: IPR010231   Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron. These functions depend on the various FeS cluster prosthetic groups, the most common being [2Fe-2S] and [4Fe-4S] . FeS cluster assembly is a complex process involving the mobilisation of Fe and S atoms from storage sources, their assembly into [Fe-S] form, their transport to specific cellular locations, and their transfer to recipient apoproteins. So far, three FeS assembly machineries have been identified, which are capable of synthesising all types of [Fe-S] clusters: ISC (iron-sulphur cluster), SUF (sulphur assimilation), and NIF (nitrogen fixation) systems.   The ISC system is conserved in eubacteria and eukaryotes (mitochondria), and has broad specificity, targeting general FeS proteins , . It is encoded by the isc operon (iscRSUA-hscBA-fdx-iscX). IscS is a cysteine desulphurase, which obtains S from cysteine (converting it to alanine) and serves as a S donor for FeS cluster assembly. IscU and IscA act as scaffolds to accept S and Fe atoms, assembling clusters and transfering them to recipient apoproteins. HscA is a molecular chaperone and HscB is a co-chaperone. Fdx is a [2Fe-2S]-type ferredoxin. IscR is a transcription factor that regulates expression of the isc operon. IscX (also known as YfhJ) appears to interact with IscS and may function as an Fe donor during cluster assembly .   The SUF system is an alternative pathway to the ISC system that operates under iron starvation and oxidative stress. It is found in eubacteria, archaea and eukaryotes (plastids). The SUF system is encoded by the suf operon (sufABCDSE), and the six encoded proteins are arranged into two complexes (SufSE and SufBCD) and one protein (SufA). SufS is a pyridoxal-phosphate (PLP) protein displaying cysteine desulphurase activity. SufE acts as a scaffold protein that accepts S from SufS and donates it to SufA . SufC is an ATPase with an unorthodox ATP-binding cassette (ABC)-like component. No specific functions have been assigned to SufB and SufD. SufA is homologous to IscA , acting as a scaffold protein in which Fe and S atoms are assembled into [FeS] cluster forms, which can then easily be transferred to apoproteins targets.   In the NIF system, NifS and NifU are required for the formation of metalloclusters of nitrogenase in Azotobacter vinelandii, and other organisms, as well as in the maturation of other FeS proteins. Nitrogenase catalyses the fixation of nitrogen. It contains a complex cluster, the FeMo cofactor, which contains molybdenum, Fe and S. NifS is a cysteine desulphurase. NifU binds one Fe atom at its N-terminal, assembling an FeS cluster that is transferred to nitrogenase apoproteins . Nif proteins involved in the formation of FeS clusters can also be found in organisms that do not fix nitrogen .   This entry represents SufB, which is part of the SUF system and forms a complex with SufBCD.; GO: 0005515 protein binding, 0016226 iron-sulfur cluster assembly.
Probab=48.42  E-value=23  Score=16.73  Aligned_cols=99  Identities=15%  Similarity=0.262  Sum_probs=49.5

Q ss_pred             CCCHHHHHHHHHH-----HHHHHCCCEEEEEECCCCCEEE----EHHHHHHHHHEEECCCCEEEECCCCCCCHHHCC--C
Q ss_conf             4417899999999-----9973079379988759996886----078862322206426744762477642011017--7
Q gi|254780781|r   25 SIPQDVKDAVQST-----LDLLDRGIIRIASRDDNGHWNT----HQWIKKAILLSFQINPTKIISDGNGYSTWWDKI--P   93 (285)
Q Consensus        25 ~~~~~~~~aI~~~-----I~~LD~G~iRVAEk~~nG~W~V----NeWvKKAILL~Fri~~~~~i~~g~~~~~~~DKv--p   93 (285)
                      ..++++|++++..     =+..=+|-.=.|..+.  +-+=    -+|-||+|.-  .=.+..+-+...-.-.||=++  |
T Consensus        97 evP~eIk~TFEkLGIPeaE~k~LaGvav~AQYdS--EviY~~~Ke~L~~~GVIF--~d~d~Al~~YPdLVKeYF~~v~VP  172 (469)
T TIGR01980        97 EVPDEIKDTFEKLGIPEAERKALAGVAVGAQYDS--EVIYHNIKEDLEEKGVIF--CDMDTALKEYPDLVKEYFGKVCVP  172 (469)
T ss_pred             CCCHHHHHHHHHCCCCHHHHHHHCCCEEEEEEEE--EEEECCCHHHHHHCCEEE--CCHHHHHHHCHHHHHHHCCCCCCC
T ss_conf             4678999876444861799987425357788620--446222046756298786--385998651725678662700258


Q ss_pred             CCCCCCCHHHHHHCCCCCCCCCEECCCCCCC--CCC-EEEC--CEEECC
Q ss_conf             5323652023442475102543103564006--651-4620--103023
Q gi|254780781|r   94 AKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG--PKA-VLMP--SFVNMG  137 (285)
Q Consensus        94 ~Kf~~~~~~~f~~~g~rv~P~a~vr~ga~Ig--~g~-vimp--~~VniG  137 (285)
                      .-     +..|.+     .-+|+=+-|+||=  +|| |=||  +|=.|+
T Consensus       173 p~-----DnKFAA-----Ln~AVWSGGsFvYVPkGV~v~~PLqtYFRIN  211 (469)
T TIGR01980       173 PS-----DNKFAA-----LNGAVWSGGSFVYVPKGVRVDMPLQTYFRIN  211 (469)
T ss_pred             CC-----CCHHHH-----HHHHEEECCEEEEECCCCEECCCCCCCEECC
T ss_conf             76-----341466-----4021102785798478986666300000028


No 162
>TIGR01779 TonB-B12 TonB-dependent vitamin B12 receptor; InterPro: IPR010101   The outer membrane is an essential component of Gram-negative bacteria, providing them with increased resistance to antibiotics, digestive enzymes, detergents and immune surveillance . The outer membrane is permeable to small hydrophilic molecules because of the presence of aqueous diffusion channels (e.g. porins). Small molecules present at high concentration diffuse down their concentration gradients into the periplasmic space. Porins are inadequate for the efficient acquisition of iron siderophores, cobalamins (Cbl), and other molecules that are present at very low concentrations and that are too bulky to pass through the lumen of the porin. Another class of outer membrane proteins binds these substrates with high specificity and carries out active transport across the outer membrane. This active transport process requires an energy source and a second protein, TonB. Outer membrane active-transport proteins interact with the transperiplasmic protein TonB through a conserved sequence, the "Ton-box". Interaction with TonB couples the energy of the proton motive force of the inner membrane to drive an outer membrane transport cycle .    To date, crystal structures of four TonB-dependent transporters have been solved. Three of these are iron-siderophore transporters: ferrichrome transporter FhuA , ; ferric enterobactin transporter FepA ; and ferric dicitrate transporter FecA . The fourth structure is the cobalamin transporter BtuB . All of these structures are composed of two domains, a conserved N-terminal globular domain (hatch) and a 22-stranded beta-barrel (barrel). The hatch domain resides within the barrel and occludes the large pore of the large barrel domain. The hatch domains are composed of a central core of four beta-strands connected by loops. The conserved Ton-box is located near the periplasmic opening of the barrel and precedes the conserved hatch core. The barrels have large extracellular loops and short periplasmic turns connecting the beta-strands. TonB-dependent transporters bind their cognate substrates using residues from hatch loops, from the interior surfaces of beta-strands in the barrel wall, and from extracellular loops of the barrel .    This entry represents the TonB-dependent outer membrane receptor found in gamma-proteobacteria responsible for translocating the cobalt-containing vitamin B12 (cobalamin). ; GO: 0004872 receptor activity, 0015889 cobalamin transport, 0016020 membrane.
Probab=44.75  E-value=21  Score=16.95  Aligned_cols=17  Identities=35%  Similarity=0.685  Sum_probs=11.7

Q ss_pred             CCCCEEECCCEECCEEC
Q ss_conf             06868812321121005
Q gi|254780781|r  159 GKNVHISGGVGIGGVLE  175 (285)
Q Consensus       159 G~~vhI~~g~~IGGvle  175 (285)
                      |.+.-|.+-=.||||+.
T Consensus       140 GprssLYGSeAiGGVv~  156 (644)
T TIGR01779       140 GPRSSLYGSEAIGGVVN  156 (644)
T ss_pred             CCCHHHHHHHHCCCEEE
T ss_conf             66113311122076278


No 163
>KOG0479 consensus
Probab=41.43  E-value=9  Score=19.21  Aligned_cols=12  Identities=58%  Similarity=0.966  Sum_probs=7.2

Q ss_pred             EHHHHHHHHHEE
Q ss_conf             078862322206
Q gi|254780781|r   60 HQWIKKAILLSF   71 (285)
Q Consensus        60 NeWvKKAILL~F   71 (285)
                      |+|+||||||-.
T Consensus       306 H~~vKkAillLL  317 (818)
T KOG0479         306 HDYVKKAILLLL  317 (818)
T ss_pred             HHHHHHHHHHHH
T ss_conf             799999999998


No 164
>TIGR00185 rRNA_methyl_2 RNA methyltransferase, TrmH family, group 2; InterPro: IPR004440 The RNA methyltransferase, TrmH family, group 2 are part of the trmH (spoU) family of rRNA methylases that are involved in tRNA and rRNA base modification.; GO: 0008173 RNA methyltransferase activity, 0009451 RNA modification.
Probab=38.55  E-value=16  Score=17.62  Aligned_cols=34  Identities=15%  Similarity=0.519  Sum_probs=25.3

Q ss_pred             HEEECCCCEEEECCCCCCCHHHCCCCCCCCCCHHHHHH
Q ss_conf             20642674476247764201101775323652023442
Q gi|254780781|r   69 LSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEK  106 (285)
Q Consensus        69 L~Fri~~~~~i~~g~~~~~~~DKvp~Kf~~~~~~~f~~  106 (285)
                      |.|.+.|-.+--+|   +.|||+|.++.++ +-+.|-+
T Consensus        35 lGF~~~DK~L~RAG---Ldyw~fv~~~~H~-s~E~fle   68 (161)
T TIGR00185        35 LGFELDDKRLKRAG---LDYWEFVQLFYHK-SWEEFLE   68 (161)
T ss_pred             CCCCCCCCEEEECC---CCCCCCEEEEECC-CHHHHHH
T ss_conf             78620781423147---8744523235625-5688886


No 165
>TIGR00600 rad2 DNA excision repair protein (rad2); InterPro: IPR001044   Xeroderma pigmentosum (XP)  is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. People's skin cells with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-G is one of the most rare and phenotypically heterogeneous of XP, showing anything from slight to extreme dysfunction in DNA excision repair , . XP-G can be corrected by a 133 Kd nuclear protein, XPGC . XPGC is an acidic protein that confers normal UV resistance in expressing cells . It is a magnesium-dependent, single-strand DNA endonuclease that makes structure-specific endonucleolytic incisions in a DNA substrate containing a duplex region and single-stranded arms , . XPGC cleaves one strand of the duplex at the border with the single-stranded region .   XPG belongs to a family of proteins that includes RAD2 from Saccharomyces cerevisiae (Baker's yeast) and rad13 from Schizosaccharomyces pombe (Fission yeast), which are single-stranded DNA endonucleases , ; mouse and human FEN-1, a structure-specific endonuclease; RAD2 from fission yeast and RAD27 from budding yeast; fission yeast exo1, a 5'-3' double-stranded DNA exonuclease that may act in a pathway that corrects mismatched base pairs; yeast DHS1, and yeast DIN7. Sequence alignment of this family of proteins reveals that similarities are largely confined to two regions. The first is located at the N-terminal extremity (N-region) and corresponds to the first 95 to 105 amino acids. The second region is internal (I-region) and found towards the C-terminus; it spans about 140 residues and contains a highly conserved core of 27 amino acids that includes a conserved pentapeptide (E-A-[DE]-A-[QS]). It is possible that the conserved acidic residues are involved in the catalytic mechanism of DNA excision repair in XPG. The amino acids linking the N- and I-regions are not conserved.   This entry represents XPGC, an acidic protein that confers normal UV resistance in expressing cells, can correct XP-G. It is a magnesium-dependent, single-strand DNA endonuclease that makes structure-specific endonucleolytic incisions in a DNA substrate containing a duplex region and single-stranded arms. XPGC cleaves one strand of the duplex at the border with the single-stranded region , .; GO: 0003697 single-stranded DNA binding, 0004519 endonuclease activity, 0006289 nucleotide-excision repair, 0005634 nucleus.
Probab=36.54  E-value=15  Score=17.83  Aligned_cols=45  Identities=20%  Similarity=0.175  Sum_probs=22.6

Q ss_pred             CHHHHHHHHHHHHHHHC---CCEEEEEECCCCCEEEEHHHHHHHHHEEECC
Q ss_conf             17899999999997307---9379988759996886078862322206426
Q gi|254780781|r   27 PQDVKDAVQSTLDLLDR---GIIRIASRDDNGHWNTHQWIKKAILLSFQIN   74 (285)
Q Consensus        27 ~~~~~~aI~~~I~~LD~---G~iRVAEk~~nG~W~VNeWvKKAILL~Fri~   74 (285)
                      ....+.+|.+.++.=..   -+..|..+.+   =+.+---|.-.||.=++.
T Consensus       426 ~~~t~~~~~~~l~~~~~Gesnk~~~~~~~~---~~~~~~~~t~~~~~S~~~  473 (1127)
T TIGR00600       426 SPRTLQAIEQALDDDEDGESNKKKVSASSD---DQTGGEKKTKMLLISRIE  473 (1127)
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCEEEECCCH---HHCCCCCCCCEEEECCCC
T ss_conf             677899999986321035301033211403---223887544157631786


No 166
>TIGR01394 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298   This bacterial (and Arabidopsis) protein, termed TypA or BipA, is a GTP-binding protein. It is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways, but the precise function is unknown.; GO: 0005525 GTP binding, 0005622 intracellular.
Probab=36.41  E-value=20  Score=17.03  Aligned_cols=40  Identities=33%  Similarity=0.469  Sum_probs=25.9

Q ss_pred             CCEEECCCEEECCEEECCCCEEEE-EEEECCCCEEEE-CCCC
Q ss_conf             847821857846888458856630-046527833687-1588
Q gi|254780781|r  187 NCFIGARSEIVEGCIIREGSVLGM-GVFIGKSTKIID-RNTG  226 (285)
Q Consensus       187 ~v~IGa~s~I~~Gv~Ig~gavIga-G~vit~st~i~d-~~~~  226 (285)
                      .-||+++..|++|-+||+++-=.- .+=++|.-+.-+ |.+|
T Consensus       519 ~~Fv~pG~~VY~GMIiGEhsR~~DL~VN~~K~K~LTN~RsSg  560 (609)
T TIGR01394       519 RLFVSPGTEVYEGMIIGEHSRENDLDVNVCKAKKLTNVRSSG  560 (609)
T ss_pred             CEEECCCCCEECCEEEEECCCCCCCEECCCCCCCCCEEEECC
T ss_conf             433078862633478872388666602751676421034037


No 167
>pfam04185 Phosphoesterase Phosphoesterase family. This family includes both bacterial phospholipase C enzymes EC:3.1.4.3, but also eukaryotic acid phosphatases EC:3.1.3.2.
Probab=32.21  E-value=23  Score=16.69  Aligned_cols=12  Identities=42%  Similarity=0.844  Sum_probs=5.7

Q ss_pred             EECCCCCEEECC
Q ss_conf             454998789605
Q gi|254780781|r  231 GEVPSYSVVVPG  242 (285)
Q Consensus       231 g~vP~~~vvvpg  242 (285)
                      |..|+.|.+.|.
T Consensus       240 g~LP~vS~I~p~  251 (357)
T pfam04185       240 GKLPQVSWVIPN  251 (357)
T ss_pred             CCCCEEEEEECC
T ss_conf             999816998268


No 168
>KOG4410 consensus
Probab=28.87  E-value=29  Score=16.06  Aligned_cols=42  Identities=26%  Similarity=0.325  Sum_probs=24.1

Q ss_pred             CCCCEEECCCEEECCEEECCCC---------EEEEEEEECCCCEEEECCCCC
Q ss_conf             2584782185784688845885---------663004652783368715881
Q gi|254780781|r  185 EDNCFIGARSEIVEGCIIREGS---------VLGMGVFIGKSTKIIDRNTGE  227 (285)
Q Consensus       185 eD~v~IGa~s~I~~Gv~Ig~ga---------vIgaG~vit~st~i~d~~~~~  227 (285)
                      =|-+.||+-++-.+|.+||+|-         .|.+|+ |+++|+|+-.....
T Consensus       158 vDlvViGSVavs~~G~RiGkGeGfAdLeygmli~mGA-i~~~TpvVTiVHDc  208 (396)
T KOG4410         158 VDLVVIGSVAVSREGYRIGKGEGFADLEYGMLIEMGA-ITPKTPVVTIVHDC  208 (396)
T ss_pred             EEEEEEEEEEECCCCEEECCCCCHHHHHHHHHHHHCC-CCCCCCEEEEEECC
T ss_conf             7799984577513330103677603446678887526-68888559997413


No 169
>PRK13494 chemoreceptor glutamine deamidase CheD; Provisional
Probab=28.75  E-value=33  Score=15.74  Aligned_cols=14  Identities=21%  Similarity=0.427  Sum_probs=9.0

Q ss_pred             HHHHHCCCCCCCCC
Q ss_conf             23442475102543
Q gi|254780781|r  102 KDFEKHNFRIIPGT  115 (285)
Q Consensus       102 ~~f~~~g~rv~P~a  115 (285)
                      ++|+..-+.+.|+-
T Consensus         7 ~~~~~~~v~i~pGe   20 (163)
T PRK13494          7 FKLKRDVTIIVPGE   20 (163)
T ss_pred             HHCCCCEEEECCCE
T ss_conf             32176479982981


No 170
>TIGR00038 efp translation elongation factor P; InterPro: IPR011768   Members of this family possess translation elongation factor activity. They have been shown to stimulate efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro, possibly indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase (by similarity) . This family does not include members of IPR011897 from INTERPRO, an EFP-like protein of certain gammaproteobacteria.; GO: 0003746 translation elongation factor activity, 0006414 translational elongation, 0005737 cytoplasm.
Probab=28.70  E-value=42  Score=15.09  Aligned_cols=21  Identities=38%  Similarity=0.517  Sum_probs=9.3

Q ss_pred             CCCCCCCCCCEEE-CCEEECCC
Q ss_conf             3564006651462-01030235
Q gi|254780781|r  118 RHSAYIGPKAVLM-PSFVNMGA  138 (285)
Q Consensus       118 r~ga~Ig~g~vim-p~~VniGA  138 (285)
                      ++-|.+.-|.+++ |=|||.|=
T Consensus       156 ~KpA~L~TG~vV~VPlFv~~Gd  177 (194)
T TIGR00038       156 TKPATLETGAVVKVPLFVNEGD  177 (194)
T ss_pred             CCCEEECCCCEEECCEEEEECC
T ss_conf             0455861686882540542088


No 171
>TIGR01717 AMP-nucleosdse AMP nucleosidase; InterPro: IPR011271   This entry represents the AMP nucleosidase from proteobacteria but also including sequences from Corynebacterium, a Gram-positive organism. The Escherichia coli protein is the most well studied ..
Probab=26.63  E-value=30  Score=16.02  Aligned_cols=87  Identities=26%  Similarity=0.550  Sum_probs=51.0

Q ss_pred             CCCCHHHCCCCCCCCCCHHHHHHCCCC----CCC-CCEECCCCCCCCC--CE--------EECCE------------EEC
Q ss_conf             642011017753236520234424751----025-4310356400665--14--------62010------------302
Q gi|254780781|r   84 GYSTWWDKIPAKFDDWKTKDFEKHNFR----IIP-GTIVRHSAYIGPK--AV--------LMPSF------------VNM  136 (285)
Q Consensus        84 ~~~~~~DKvp~Kf~~~~~~~f~~~g~r----v~P-~a~vr~ga~Ig~g--~v--------imp~~------------Vni  136 (285)
                      +|..|.|.    |..|.-++..+.+-|    +.| |-++..|.--+.+  ++        .||+|            |||
T Consensus       202 NY~~Yvde----Fv~~a~~~l~~~D~~Yv~l~~Pgg~vi~~e~~~~~~na~~~~~~~~~~QMPaYhLi~~~G~GITlvNI  277 (486)
T TIGR01717       202 NYARYVDE----FVRWALSELTDEDSRYVELSLPGGVVIDRETDEPEENATVTLVLWKRFQMPAYHLITADGDGITLVNI  277 (486)
T ss_pred             CCHHHHHH----HHHHHHHHHCCCCCCEEEEECCCCCEEECCCCCCCHHHHHHHHHHHCCCCCHHHHHHCCCCCEEEEEC
T ss_conf             20456899----99999987227998768888788826753656861246666678744899726998506993289960


Q ss_pred             CCCC-CCCCCCCC--------CCEECCEE------EECCCCEEECCCEECCEE
Q ss_conf             3533-67720156--------61232204------730686881232112100
Q gi|254780781|r  137 GAYI-GEGSMIDT--------WSTVGSCA------QIGKNVHISGGVGIGGVL  174 (285)
Q Consensus       137 GA~I-g~gt~I~~--------~a~IG~~a------~IG~~vhI~~g~~IGGvl  174 (285)
                      |.-= ..-|+-|+        |..||||+      .||+-|.=.+-..==+||
T Consensus       278 GVGPSNAKtITDHLAVLRP~~WlMiGHCaGLr~sq~iGDyvLAhAY~R~DHvL  330 (486)
T TIGR01717       278 GVGPSNAKTITDHLAVLRPHAWLMIGHCAGLRESQRIGDYVLAHAYLREDHVL  330 (486)
T ss_pred             CCCCCCHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHHHHHHHHCCCCCCC
T ss_conf             74886212354102211887428722230412323431255520000235653


No 172
>COG3514 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.78  E-value=31  Score=15.92  Aligned_cols=12  Identities=50%  Similarity=0.697  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHCC
Q ss_conf             688899875115
Q gi|254780781|r  273 SKTSINTLLRDY  284 (285)
Q Consensus       273 ~k~~ln~~lR~~  284 (285)
                      =.|.||++||+|
T Consensus        77 wQtRiN~aLR~~   88 (93)
T COG3514          77 WQTRINAALRQY   88 (93)
T ss_pred             HHHHHHHHHHHH
T ss_conf             889999999999


No 173
>pfam05428 CRF-BP Corticotropin-releasing factor binding protein (CRF-BP). This family consists of several eukaryotic corticotropin-releasing factor binding proteins (CRF-BP or CRH-BP). Corticotropin-releasing hormone (CRH) plays multiple roles in vertebrate species. In mammals, it is the major hypothalamic releasing factor for pituitary adrenocorticotropin secretion, and is a neurotransmitter or neuromodulator at other sites in the central nervous system. In non-mammalian vertebrates, CRH not only acts as a neurotransmitter and hypophysiotropin, it also acts as a potent thyrotropin-releasing factor, allowing CRH to regulate both the adrenal and thyroid axes, especially in development. CRH-BP is thought to play an inhibitory role in which it binds CRH and other CRH-like ligands and prevents the activation of CRH receptors. There is however evidence that CRH-BP may also exhibit diverse extra and intracellular roles in a cell specific fashion and at specific times in development.
Probab=24.38  E-value=56  Score=14.32  Aligned_cols=16  Identities=38%  Similarity=0.825  Sum_probs=6.9

Q ss_pred             EEEECCCCEEECCCEE
Q ss_conf             0473068688123211
Q gi|254780781|r  155 CAQIGKNVHISGGVGI  170 (285)
Q Consensus       155 ~a~IG~~vhI~~g~~I  170 (285)
                      |...|+.+.|.+|+++
T Consensus       238 C~~~gD~vEl~Gg~GL  253 (311)
T pfam05428       238 CQGAGDFVELLGGSGL  253 (311)
T ss_pred             CCCCCCEEEECCCCCC
T ss_conf             5765657896486788


No 174
>cd00862 ProRS_anticodon_zinc ProRS Prolyl-anticodon binding domain, long version found predominantly in eukaryotes and archaea. ProRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only, and an additional C-terminal zinc-binding domain specific to this subfamily of aaRSs.
Probab=24.08  E-value=57  Score=14.28  Aligned_cols=80  Identities=23%  Similarity=0.441  Sum_probs=49.1

Q ss_pred             HHHHHHHHHHHHHHHCCCEEEEEEC-CC--CCEEEEHHHHHHHHHEEECCCCEEEECCC--------------CCCCHHH
Q ss_conf             7899999999997307937998875-99--96886078862322206426744762477--------------6420110
Q gi|254780781|r   28 QDVKDAVQSTLDLLDRGIIRIASRD-DN--GHWNTHQWIKKAILLSFQINPTKIISDGN--------------GYSTWWD   90 (285)
Q Consensus        28 ~~~~~aI~~~I~~LD~G~iRVAEk~-~n--G~W~VNeWvKKAILL~Fri~~~~~i~~g~--------------~~~~~~D   90 (285)
                      .++.+..++.-+.|.+-.+||---. ++  ..|.-|+|.+|+|=|-.-+++..+ +.+.              +...+-+
T Consensus        26 ~~v~~~~~~i~~~L~~~~iRv~iD~rd~~~pG~K~~~wE~kGVPiRIEIGprDl-e~~~v~v~rRD~~~K~~v~~~el~~  104 (202)
T cd00862          26 EEVLEAADELAERLKAAGIRVHVDDRDNYTPGWKFNDWELKGVPLRIEIGPRDL-EKNTVVIVRRDTGEKKTVPLAELVE  104 (202)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECCCCCCHHHHHHHHHHHCCCEEEEECHHHH-HCCCEEEEEECCCCEEEEEHHHHHH
T ss_conf             999999999999998679889997787868888889999808977999871586-3791899991799578978899999


Q ss_pred             CCCCCCCCCCHHHHHHCC
Q ss_conf             177532365202344247
Q gi|254780781|r   91 KIPAKFDDWKTKDFEKHN  108 (285)
Q Consensus        91 Kvp~Kf~~~~~~~f~~~g  108 (285)
                      +++..++.....-|.+|.
T Consensus       105 ~i~~~L~~iq~~L~~kA~  122 (202)
T cd00862         105 KVPELLDEIQEDLYERAL  122 (202)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999


No 175
>KOG3216 consensus
Probab=23.18  E-value=27  Score=16.28  Aligned_cols=17  Identities=35%  Similarity=0.763  Sum_probs=9.0

Q ss_pred             EEEEHHHHHHHHHEEEC
Q ss_conf             88607886232220642
Q gi|254780781|r   57 WNTHQWIKKAILLSFQI   73 (285)
Q Consensus        57 W~VNeWvKKAILL~Fri   73 (285)
                      |+|-+|=+.||+||=+.
T Consensus       123 w~vldwN~rAi~lY~k~  139 (163)
T KOG3216         123 WVVLDWNHRAILLYEKV  139 (163)
T ss_pred             EEEECCCHHHHHHHHHH
T ss_conf             99812461689999985


No 176
>PRK04542 elongation factor P; Provisional
Probab=22.86  E-value=58  Score=14.22  Aligned_cols=22  Identities=23%  Similarity=0.391  Sum_probs=11.9

Q ss_pred             CEEECCCCEEEEEEEECCCCEE
Q ss_conf             8884588566300465278336
Q gi|254780781|r  199 GCIIREGSVLGMGVFIGKSTKI  220 (285)
Q Consensus       199 Gv~Ig~gavIgaG~vit~st~i  220 (285)
                      .+++..|+.|-.=.+|..+-+|
T Consensus       154 ~AtletG~~I~VPlFI~~Gd~I  175 (189)
T PRK04542        154 PATLSTGLVIQVPEYISTGEKI  175 (189)
T ss_pred             EEEECCCCEEEECCCCCCCCEE
T ss_conf             0998289999828840399999


No 177
>cd05794 S1_EF-P_repeat_2 S1_EF-P_repeat_2: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with N-formylmethionyl-tRNA and puromycine in vitro. EF-P binds to both the 30S and 50S ribosomal subunits. EF-P binds near the streptomycine binding site of the 16S rRNA in the 30S subunit. EF-P interacts with domains 2 and 5 of the 23S rRNA. The L16 ribosomal protein of the 50S or its N-terminal fragment are required for EF-P mediated peptide bond synthesis, whereas L11, L15, and L7/L12 are not required in this reaction, suggesting that EF-P may function at a different ribosomal site than most other translation factors. EF-P is essential for cell viability and is required for protein synthesis. EF-P is mainly present in bacteria. The EF-P homologs in archaea and eukaryotes are the initiation factors aIF5A and eIF5A, respectively. EF-P 
Probab=22.34  E-value=40  Score=15.22  Aligned_cols=24  Identities=25%  Similarity=0.324  Sum_probs=18.3

Q ss_pred             ECCCCCCCCCCEEE-CCEEECCCCC
Q ss_conf             03564006651462-0103023533
Q gi|254780781|r  117 VRHSAYIGPKAVLM-PSFVNMGAYI  140 (285)
Q Consensus       117 vr~ga~Ig~g~vim-p~~VniGA~I  140 (285)
                      ..+-|.+..|..+| |.||+.|-.|
T Consensus        20 ~~K~A~letG~~i~VP~FI~~Gd~I   44 (56)
T cd05794          20 GTKPATLETGAEVQVPLFIKEGEKI   44 (56)
T ss_pred             CCCEEEECCCCEEECCCCCCCCCEE
T ss_conf             7452897389999848740489999


No 178
>PRK13493 chemoreceptor glutamine deamidase CheD; Provisional
Probab=21.77  E-value=51  Score=14.58  Aligned_cols=21  Identities=24%  Similarity=0.599  Sum_probs=13.0

Q ss_pred             CCCCHHHCCCCCCCCCCHHHHHHCCCCCCCCC
Q ss_conf             64201101775323652023442475102543
Q gi|254780781|r   84 GYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGT  115 (285)
Q Consensus        84 ~~~~~~DKvp~Kf~~~~~~~f~~~g~rv~P~a  115 (285)
                      -|..|||+           .|...-+.|.||-
T Consensus        17 ~y~Ry~d~-----------~~~~~avkilPGE   37 (214)
T PRK13493         17 YYSRFFNE-----------QRGLHMIKVLPGG   37 (214)
T ss_pred             CCHHCCCC-----------CCCCEEEEECCCE
T ss_conf             00000366-----------4684189985976


No 179
>cd03108 AdSS Adenylosuccinate synthetase (AdSS) catalyzes the first step in the de novo biosynthesis of AMP. IMP and L-aspartate are conjugated in a two-step reaction accompanied by the hydrolysis of GTP to GDP in the presence of Mg2+. In the first step, the r-phosphate group of GTP is transferred to the 6-oxygen atom of IMP. An aspartate then displaces this 6-phosphate group to form the product adenylosuccinate. Because of its critical role in purine biosynthesis, AdSS is a target of antibiotics, herbicides and antitumor drugs.
Probab=21.29  E-value=46  Score=14.88  Aligned_cols=24  Identities=25%  Similarity=0.559  Sum_probs=14.9

Q ss_pred             CCCCCCCCEECCC--CCCCCCCEEEC
Q ss_conf             7510254310356--40066514620
Q gi|254780781|r  108 NFRIIPGTIVRHS--AYIGPKAVLMP  131 (285)
Q Consensus       108 g~rv~P~a~vr~g--a~Ig~g~vimp  131 (285)
                      .++..|+.+++++  ++||+|+|+-|
T Consensus        49 ~lh~lPSG~~~~~~~~~Ig~G~vidp   74 (363)
T cd03108          49 KLHLLPSGILNPGVTCVIGNGVVIDP   74 (363)
T ss_pred             EEEECCCEECCCCCEEEECCCEEECH
T ss_conf             99727836326995177679779869


No 180
>cd01900 YchF YchF subfamily.  YchF is a member of the Obg family, which includes four other subfamilies of GTPases: Obg, DRG, Ygr210, and NOG1.  Obg is an essential gene that is involved in DNA replication in C. crescentus and Streptomyces griseus and is associated with the ribosome.  Several members of the family, including YchF, possess the TGS domain related to the RNA-binding proteins.  Experimental data and genomic analysis suggest that YchF may be part of a nucleoprotein complex and may function as a GTP-dependent translational factor.
Probab=21.09  E-value=66  Score=13.92  Aligned_cols=61  Identities=16%  Similarity=0.239  Sum_probs=32.9

Q ss_pred             HHHHHHHHHHHHHHHHHHC---CCCCCHHHHHHHHHHHHHHHCCC-EEEEEECCCCCEEEEHH--HHHHHHHEE
Q ss_conf             6899999999997505316---82441789999999999730793-79988759996886078--862322206
Q gi|254780781|r    4 IVSTLEEIIDSFFEESNSK---NESIPQDVKDAVQSTLDLLDRGI-IRIASRDDNGHWNTHQW--IKKAILLSF   71 (285)
Q Consensus         4 ~m~~L~~~Ie~awe~r~~l---~~~~~~~~~~aI~~~I~~LD~G~-iRVAEk~~nG~W~VNeW--vKKAILL~F   71 (285)
                      ++++|+ .+|+.+++....   .....+...+..+.+++.|++|+ +|-      .+|--.+.  +|.-=||+.
T Consensus       129 iLaDLe-~vEKrlekl~K~~k~~dk~~~~e~~~L~ki~~~Le~g~~~r~------~~~~~ee~~~i~~l~LLT~  195 (274)
T cd01900         129 ILADLE-TVEKRLERLEKKAKSGDKEAKAELELLEKIKEHLEEGKPARS------LELTEEEIEILNSLQLLTA  195 (274)
T ss_pred             HHHHHH-HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCHHC------CCCCHHHHHHHHHHHHHHC
T ss_conf             999999-999999998877504777789999999999999867981020------5689889999986316533


Done!