BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780781|ref|YP_003065194.1|
2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
[Candidatus Liberibacter asiaticus str. psy62]
         (285 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780781|ref|YP_003065194.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Candidatus Liberibacter asiaticus str. psy62]
 gi|254040458|gb|ACT57254.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Candidatus Liberibacter asiaticus str. psy62]
          Length = 285

 Score =  579 bits (1492), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 285/285 (100%), Positives = 285/285 (100%)

Query: 1   MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTH
Sbjct: 1   MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS
Sbjct: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG
Sbjct: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV
Sbjct: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS 285
           PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS
Sbjct: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS 285


>gi|315121998|ref|YP_004062487.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313495400|gb|ADR51999.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 286

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 227/281 (80%), Positives = 248/281 (88%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           V+TLE+IIDS F   +SKN S  ++VKDAVQSTL+LLD G IR+AS D +G W TH+WIK
Sbjct: 6   VTTLEKIIDSHFNRFDSKNSSFSKEVKDAVQSTLNLLDNGSIRVASCDSDGRWITHKWIK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KAILLSFQINPT+IIS GNG+S WWDKIPAKF  W  KDFEKHN R IPG I+RHSAYI 
Sbjct: 66  KAILLSFQINPTQIISGGNGHSIWWDKIPAKFAKWTKKDFEKHNLRTIPGAIIRHSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P+ VLMPSFVN+GAYI EG+M+DTWST+GSCAQIGKNVHISGGVGIGGVLEPIQTGPTII
Sbjct: 126 PRTVLMPSFVNIGAYIDEGTMVDTWSTIGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDR+TG ITYGEVP YSVVVPGSY
Sbjct: 186 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRSTGTITYGEVPPYSVVVPGSY 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS 285
           P  +LK +   P+LYCAVIIKKVDEKTRSKTSINTLLRDYS
Sbjct: 246 PGKDLKNNTVAPNLYCAVIIKKVDEKTRSKTSINTLLRDYS 286


>gi|239832651|ref|ZP_04680980.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ochrobactrum intermedium LMG 3301]
 gi|239824918|gb|EEQ96486.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ochrobactrum intermedium LMG 3301]
          Length = 284

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 185/279 (66%), Positives = 231/279 (82%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ ID  F+E +  N +   +V+DAV+ +L LLDRG  R+A +  +G+W+ +QW+K
Sbjct: 6   LASLEKTIDKAFDERDGINTATRGEVRDAVEQSLILLDRGEARVAEKQADGNWHVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  +VRHSAYI 
Sbjct: 66  KAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCVVRHSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAILMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+ 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P  N+ G+  GP LYCAVI+K+VDEKTRSKTSIN LLRD
Sbjct: 246 PGKNVPGENWGPSLYCAVIVKRVDEKTRSKTSINELLRD 284


>gi|153008685|ref|YP_001369900.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Ochrobactrum anthropi ATCC 49188]
 gi|166224216|sp|A6WYL7|DAPD_OCHA4 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|151560573|gb|ABS14071.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ochrobactrum anthropi ATCC 49188]
          Length = 284

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 185/279 (66%), Positives = 230/279 (82%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ ID  F+E +  N +   +V++AV+ +L LLDRG  R+A +  +G+W  +QW+K
Sbjct: 6   LASLEKTIDKAFDERDGINTATRGEVREAVEQSLVLLDRGEARVAEKQADGNWQVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  IVRHSAYI 
Sbjct: 66  KAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAILMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+ 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P  N+ G+  GP LYCAVI+K+VDEKTRSKTSIN LLRD
Sbjct: 246 PGKNVPGENWGPSLYCAVIVKRVDEKTRSKTSINELLRD 284


>gi|306840610|ref|ZP_07473363.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella sp. BO2]
 gi|306289395|gb|EFM60629.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella sp. BO2]
          Length = 284

 Score =  404 bits (1038), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 184/279 (65%), Positives = 232/279 (83%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  F+E +  N +   +V++AV+ +L LLDRG +R+A +  +G+W+ +QW+K
Sbjct: 6   LASLEKTIEKAFDERDGINTATRGEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  IVRHSAYI 
Sbjct: 66  KAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+ +G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+ 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P  N+ G+  GP LYCAVI+K+VDEKTRSKTSIN LLRD
Sbjct: 246 PGKNVPGENWGPSLYCAVIVKRVDEKTRSKTSINELLRD 284


>gi|206582134|pdb|3EG4|A Chain A, Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2-
           Carboxylate N-Succinyltransferase From Brucella
           Melitensis Biovar Abortus 2308
          Length = 304

 Score =  404 bits (1038), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 183/279 (65%), Positives = 231/279 (82%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  F+E +  N +   +V++AV+ +L LLDRG +R+A +  +G+W+ +QW+K
Sbjct: 26  LASLEKTIEKAFDERDGINTATRGEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQWLK 85

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  IVRHSAYI 
Sbjct: 86  KAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIA 145

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+ +G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 146 PNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 205

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+ 
Sbjct: 206 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTM 265

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P  N+ G+  GP LYCAVI+K+ DEKTRSKTSIN LLRD
Sbjct: 266 PGKNVPGENWGPSLYCAVIVKRADEKTRSKTSINELLRD 304


>gi|225629477|ref|ZP_03787510.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella ceti str. Cudo]
 gi|237817397|ref|ZP_04596389.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella abortus str. 2308 A]
 gi|225615973|gb|EEH13022.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella ceti str. Cudo]
 gi|237788210|gb|EEP62426.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella abortus str. 2308 A]
          Length = 315

 Score =  404 bits (1037), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 183/279 (65%), Positives = 231/279 (82%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  F+E +  N +   +V++AV+ +L LLDRG +R+A +  +G+W+ +QW+K
Sbjct: 37  LASLEKTIEKAFDERDGINTATRGEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQWLK 96

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  IVRHSAYI 
Sbjct: 97  KAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIA 156

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+ +G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 157 PNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 216

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+ 
Sbjct: 217 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTM 276

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P  N+ G+  GP LYCAVI+K+ DEKTRSKTSIN LLRD
Sbjct: 277 PGKNVPGENWGPSLYCAVIVKRADEKTRSKTSINELLRD 315


>gi|256058812|ref|ZP_05449028.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella neotomae 5K33]
 gi|261322749|ref|ZP_05961946.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella neotomae 5K33]
 gi|261298729|gb|EEY02226.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella neotomae 5K33]
          Length = 284

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 183/279 (65%), Positives = 231/279 (82%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  F+E +  N +   +V++AV+ +L LLDRG +R+A +  +G+W+ +QW+K
Sbjct: 6   LASLEKTIEKAFDERDGINTATRDEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  IVRHSAYI 
Sbjct: 66  KAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+ +G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+ 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P  N+ G+  GP LYCAVI+K+ DEKTRSKTSIN LLRD
Sbjct: 246 PGKNVPGENWGPSLYCAVIVKRADEKTRSKTSINELLRD 284


>gi|306846230|ref|ZP_07478792.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella sp. BO1]
 gi|306273481|gb|EFM55342.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella sp. BO1]
          Length = 284

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/279 (65%), Positives = 232/279 (83%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  F+E +  N +   +V++AV+ +L LLDRG +R+A +  +G+W+ +QW+K
Sbjct: 6   LASLEKTIEKAFDEHDGINTATRGEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  IVRHSAYI 
Sbjct: 66  KAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+ +G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAILMPSFVNLGAYVDKGTMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+ 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P  N+ G+  GP LYCAVI+K+VDEKTRSKTSIN LLRD
Sbjct: 246 PGKNVPGENWGPSLYCAVIVKRVDEKTRSKTSINELLRD 284


>gi|17988614|ref|NP_541247.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|23500751|ref|NP_700191.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella suis 1330]
 gi|62317857|ref|YP_223710.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella abortus bv. 1 str. 9-941]
 gi|83269836|ref|YP_419127.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella melitensis biovar Abortus 2308]
 gi|148558202|ref|YP_001257939.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella ovis ATCC 25840]
 gi|161621076|ref|YP_001594962.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Brucella canis ATCC 23365]
 gi|189023107|ref|YP_001932848.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella abortus S19]
 gi|254690657|ref|ZP_05153911.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella abortus bv. 6 str. 870]
 gi|254696038|ref|ZP_05157866.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella abortus bv. 3 str. Tulya]
 gi|254700223|ref|ZP_05162051.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella suis bv. 5 str. 513]
 gi|254703344|ref|ZP_05165172.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella suis bv. 3 str. 686]
 gi|254705515|ref|ZP_05167343.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella pinnipedialis M163/99/10]
 gi|254710746|ref|ZP_05172557.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella pinnipedialis B2/94]
 gi|254712784|ref|ZP_05174595.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella ceti M644/93/1]
 gi|254715853|ref|ZP_05177664.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella ceti M13/05/1]
 gi|254732591|ref|ZP_05191169.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella abortus bv. 4 str. 292]
 gi|256015787|ref|YP_003105796.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Brucella microti CCM 4915]
 gi|256029129|ref|ZP_05442743.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella pinnipedialis M292/94/1]
 gi|256043896|ref|ZP_05446816.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|256111039|ref|ZP_05452101.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella melitensis bv. 3 str. Ether]
 gi|256157321|ref|ZP_05455239.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella ceti M490/95/1]
 gi|256253701|ref|ZP_05459237.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella ceti B1/94]
 gi|256255839|ref|ZP_05461375.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella abortus bv. 9 str. C68]
 gi|260167779|ref|ZP_05754590.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella sp. F5/99]
 gi|260545092|ref|ZP_05820913.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Brucella abortus NCTC 8038]
 gi|260565073|ref|ZP_05835558.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|260567726|ref|ZP_05838195.1| 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase
           [Brucella suis bv. 4 str. 40]
 gi|260756228|ref|ZP_05868576.1| tetrahydrodipicolinate N-succinyltransferase [Brucella abortus bv.
           6 str. 870]
 gi|260760403|ref|ZP_05872751.1| tetrahydrodipicolinate N-succinyltransferase [Brucella abortus bv.
           4 str. 292]
 gi|260882052|ref|ZP_05893666.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella abortus bv. 9 str. C68]
 gi|261216470|ref|ZP_05930751.1| tetrahydrodipicolinate N-succinyltransferase [Brucella abortus bv.
           3 str. Tulya]
 gi|261217614|ref|ZP_05931895.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella ceti M13/05/1]
 gi|261220838|ref|ZP_05935119.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella ceti B1/94]
 gi|261312919|ref|ZP_05952116.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella pinnipedialis M163/99/10]
 gi|261318314|ref|ZP_05957511.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella pinnipedialis B2/94]
 gi|261320491|ref|ZP_05959688.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella ceti M644/93/1]
 gi|261750718|ref|ZP_05994427.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella suis bv. 5 str. 513]
 gi|261753974|ref|ZP_05997683.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella suis bv. 3 str. 686]
 gi|261757216|ref|ZP_06000925.1| 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase
           [Brucella sp. F5/99]
 gi|265986112|ref|ZP_06098669.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella pinnipedialis M292/94/1]
 gi|265990319|ref|ZP_06102876.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|265992574|ref|ZP_06105131.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella melitensis bv. 3 str. Ether]
 gi|265995806|ref|ZP_06108363.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella ceti M490/95/1]
 gi|294853981|ref|ZP_06794653.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella sp. NVSL 07-0026]
 gi|297249207|ref|ZP_06932908.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella abortus bv. 5 str. B3196]
 gi|71153274|sp|Q576T5|DAPD_BRUAB RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|71153275|sp|Q8YDA8|DAPD_BRUME RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|71153276|sp|Q8FV25|DAPD_BRUSU RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|123545680|sp|Q2YJQ7|DAPD_BRUA2 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|166224199|sp|A5VVT4|DAPD_BRUO2 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|189082809|sp|A9MCV4|DAPD_BRUC2 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724155|sp|B2SC15|DAPD_BRUA1 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|17984416|gb|AAL53511.1| 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|23464406|gb|AAN34196.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella suis 1330]
 gi|62198050|gb|AAX76349.1| DapD, 2,3,4,5-tetrahydropyridine-2-carboxylate
           N-succinyltransferase [Brucella abortus bv. 1 str.
           9-941]
 gi|82940110|emb|CAJ13157.1| Bacterial transferase hexapeptide
           repeat:2,3,4,5-tetrahydropyridine-2-carboxylate
           N-succinyltransferase [Brucella melitensis biovar
           Abortus 2308]
 gi|148369487|gb|ABQ62359.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella ovis ATCC 25840]
 gi|161337887|gb|ABX64191.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella canis ATCC 23365]
 gi|189021681|gb|ACD74402.1| 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase
           [Brucella abortus S19]
 gi|255998447|gb|ACU50134.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Brucella microti CCM 4915]
 gi|260098363|gb|EEW82237.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Brucella abortus NCTC 8038]
 gi|260152716|gb|EEW87809.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|260154391|gb|EEW89472.1| 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase
           [Brucella suis bv. 4 str. 40]
 gi|260670721|gb|EEX57661.1| tetrahydrodipicolinate N-succinyltransferase [Brucella abortus bv.
           4 str. 292]
 gi|260676336|gb|EEX63157.1| tetrahydrodipicolinate N-succinyltransferase [Brucella abortus bv.
           6 str. 870]
 gi|260871580|gb|EEX78649.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella abortus bv. 9 str. C68]
 gi|260918077|gb|EEX84938.1| tetrahydrodipicolinate N-succinyltransferase [Brucella abortus bv.
           3 str. Tulya]
 gi|260919422|gb|EEX86075.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella ceti B1/94]
 gi|260922703|gb|EEX89271.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella ceti M13/05/1]
 gi|261293181|gb|EEX96677.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella ceti M644/93/1]
 gi|261297537|gb|EEY01034.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella pinnipedialis B2/94]
 gi|261301945|gb|EEY05442.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella pinnipedialis M163/99/10]
 gi|261737200|gb|EEY25196.1| 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase
           [Brucella sp. F5/99]
 gi|261740471|gb|EEY28397.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella suis bv. 5 str. 513]
 gi|261743727|gb|EEY31653.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella suis bv. 3 str. 686]
 gi|262550103|gb|EEZ06264.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella ceti M490/95/1]
 gi|262763444|gb|EEZ09476.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella melitensis bv. 3 str. Ether]
 gi|263000988|gb|EEZ13678.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella melitensis bv. 1 str. Rev.1]
 gi|264658309|gb|EEZ28570.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella pinnipedialis M292/94/1]
 gi|294819636|gb|EFG36636.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella sp. NVSL 07-0026]
 gi|297173076|gb|EFH32440.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella abortus bv. 5 str. B3196]
          Length = 284

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 183/279 (65%), Positives = 231/279 (82%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  F+E +  N +   +V++AV+ +L LLDRG +R+A +  +G+W+ +QW+K
Sbjct: 6   LASLEKTIEKAFDERDGINTATRGEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  IVRHSAYI 
Sbjct: 66  KAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+ +G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+ 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P  N+ G+  GP LYCAVI+K+ DEKTRSKTSIN LLRD
Sbjct: 246 PGKNVPGENWGPSLYCAVIVKRADEKTRSKTSINELLRD 284


>gi|225686783|ref|YP_002734755.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella melitensis ATCC 23457]
 gi|256262083|ref|ZP_05464615.1| 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase
           [Brucella melitensis bv. 2 str. 63/9]
 gi|254767074|sp|C0RMG8|DAPD_BRUMB RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|225642888|gb|ACO02801.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella melitensis ATCC 23457]
 gi|263091772|gb|EEZ16103.1| 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase
           [Brucella melitensis bv. 2 str. 63/9]
 gi|326411191|gb|ADZ68255.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella melitensis M28]
 gi|326554482|gb|ADZ89121.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella melitensis M5-90]
          Length = 284

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 183/279 (65%), Positives = 231/279 (82%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  F+E +  N +   +V++AV+ +L LLDRG +R+A +  +G+W+ +QW+K
Sbjct: 6   LASLEKTIEKAFDERDGINTATRGEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  IVRHSAYI 
Sbjct: 66  KAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPSCIVRHSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+ +G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+ 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P  N+ G+  GP LYCAVI+K+ DEKTRSKTSIN LLRD
Sbjct: 246 PGKNVPGENWGPSLYCAVIVKRADEKTRSKTSINELLRD 284


>gi|254699147|ref|ZP_05160975.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella abortus bv. 2 str. 86/8/59]
          Length = 280

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 183/279 (65%), Positives = 231/279 (82%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  F+E +  N +   +V++AV+ +L LLDRG +R+A +  +G+W+ +QW+K
Sbjct: 2   LASLEKTIEKAFDERDGINTATRGEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQWLK 61

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  IVRHSAYI 
Sbjct: 62  KAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIA 121

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+ +G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 122 PNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 181

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+ 
Sbjct: 182 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTM 241

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P  N+ G+  GP LYCAVI+K+ DEKTRSKTSIN LLRD
Sbjct: 242 PGKNVPGENWGPSLYCAVIVKRADEKTRSKTSINELLRD 280


>gi|254720144|ref|ZP_05181955.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella sp. 83/13]
 gi|265985150|ref|ZP_06097885.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella sp. 83/13]
 gi|306839550|ref|ZP_07472357.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella sp. NF 2653]
 gi|264663742|gb|EEZ34003.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella sp. 83/13]
 gi|306405382|gb|EFM61654.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella sp. NF 2653]
          Length = 284

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 183/279 (65%), Positives = 232/279 (83%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  F+E +  N +   +V++AV+ +L LLDRG +R+A +  +G+W+ +QW+K
Sbjct: 6   LASLEKTIEKAFDERDGINTATRGEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  IVRHSAYI 
Sbjct: 66  KAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+ +G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI++R TGE+ YGEVP YSVVV G+ 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVNRATGEVFYGEVPPYSVVVAGTM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P  N+ G+  GP LYCAVI+K+VDEKTRSKTSIN LLRD
Sbjct: 246 PGKNVPGENWGPSLYCAVIVKRVDEKTRSKTSINELLRD 284


>gi|163845142|ref|YP_001622797.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Brucella suis ATCC 23445]
 gi|189082810|sp|A9WW39|DAPD_BRUSI RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|163675865|gb|ABY39975.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brucella suis ATCC 23445]
          Length = 284

 Score =  402 bits (1033), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 182/279 (65%), Positives = 231/279 (82%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  F++ +  N +   +V++AV+ +L LLDRG +R+A +  +G+W+ +QW+K
Sbjct: 6   LASLEKTIEKAFDQRDGINTATRGEVREAVEQSLILLDRGEVRVAEKQADGNWHVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP ++I  G G S+WWDK+P+KFD W   +FEK  FR +P  IVRHSAYI 
Sbjct: 66  KAVLLSFRLNPMEVIKGGPGQSSWWDKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+ +G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAILMPSFVNLGAYVDKGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+ 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P  N+ G+  GP LYCAVI+K+ DEKTRSKTSIN LLRD
Sbjct: 246 PGKNVPGENWGPSLYCAVIVKRADEKTRSKTSINELLRD 284


>gi|116250206|ref|YP_766044.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|166224219|sp|Q1MM74|DAPD_RHIL3 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|115254854|emb|CAK05928.1| putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 286

 Score =  399 bits (1026), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 185/283 (65%), Positives = 228/283 (80%), Gaps = 2/283 (0%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           T +++LE+II++ F+  ++ N S   +V+DAV+S LDLLD G  R+A R  +G W  +QW
Sbjct: 4   TDLASLEKIIEAAFDNRDNVNTSTKGEVRDAVESALDLLDAGKARVAERSSDGAWTVNQW 63

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++N   ++  G+G STWWDK+P+KF++W    F    FR +P  +VR SAY
Sbjct: 64  LKKAVLLSFRLNDMDVVKGGSGNSTWWDKVPSKFENWGENHFRAAGFRAVPNCVVRRSAY 123

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I P A+LMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPT
Sbjct: 124 IAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPT 183

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEGCIIREGSVLGMGVFIGKSTKI+DR TGE+TYGEVP YSVVV G
Sbjct: 184 IIEDNCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKIVDRATGEVTYGEVPPYSVVVAG 243

Query: 243 SYPSIN--LKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S PS N  +      PHLYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 244 SMPSGNATMGNGQPAPHLYCAVIVKRVDEKTRSKTGINELLRD 286


>gi|319407938|emb|CBI81592.1| 2,3,4, 5-tetrahydropyridine-2-carboxylateN-succiny ltransferase
           [Bartonella schoenbuchensis R1]
          Length = 282

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/282 (67%), Positives = 229/282 (81%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T ++ LE II+  F   +S N S   +++D+V+  L+LLD+G +R+A R ++G W+ HQ
Sbjct: 1   MTNLTQLETIIEKAFNNIDSINTSTKGEIRDSVEHALNLLDKGEVRVAKRQEDGQWHIHQ 60

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKAILLSF++NP +IIS     S WWDKIP+KF  W+  DF++ NFR +PG IVRHSA
Sbjct: 61  WLKKAILLSFKLNPMRIISGETNGSCWWDKIPSKFSGWQEDDFKQANFRSVPGAIVRHSA 120

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YI P  +LMPSFVN+GAYI EG+MIDTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GP
Sbjct: 121 YIAPNVILMPSFVNLGAYIDEGTMIDTWTTVGSCAQIGKHVHLSGGVGIGGVLEPLQAGP 180

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIED+CFIGARSEIVEGCIIREG+VLGMGVFIGKSTKIIDR TGEI  GEVP+YSVVVP
Sbjct: 181 TIIEDHCFIGARSEIVEGCIIREGAVLGMGVFIGKSTKIIDRTTGEIFIGEVPAYSVVVP 240

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           GS P   L     GP+LYCAVI+K+VD+KTR KTSIN LLRD
Sbjct: 241 GSLPGKPLPNGEIGPNLYCAVIVKRVDQKTRKKTSINDLLRD 282


>gi|260461131|ref|ZP_05809380.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Mesorhizobium opportunistum WSM2075]
 gi|259033165|gb|EEW34427.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Mesorhizobium opportunistum WSM2075]
          Length = 284

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 184/279 (65%), Positives = 225/279 (80%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  FEE ++ + +   + +DA+QS LDLLDRG +R+A R D+G W+ +QW+K
Sbjct: 6   LASLEKTIEKAFEERDTISTATRGETRDAIQSALDLLDRGTVRVAERQDDGKWHVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP +II  G G + WWDK+ +KFD W   DFEK  FR +PG+IVR SAY+ 
Sbjct: 66  KAVLLSFRLNPMEIIKGGPGQAVWWDKVASKFDGWSAVDFEKAGFRAVPGSIVRRSAYVA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P AVLMPSFVN+GAYI  G+M+DTW  VGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PGAVLMPSFVNVGAYIDTGTMVDTWVGVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGE+ YGEVP  SVVV GS 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRATGEVFYGEVPPNSVVVAGSM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   L  +  GP LYCAVI+K+VD KTRSKTSIN LLRD
Sbjct: 246 PGKPLPNNEPGPSLYCAVIVKRVDAKTRSKTSINELLRD 284


>gi|241202833|ref|YP_002973929.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240856723|gb|ACS54390.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 286

 Score =  398 bits (1022), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 184/283 (65%), Positives = 228/283 (80%), Gaps = 2/283 (0%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           T +++LE+II+S F+  ++ N S   +V+DAV++ LDLLD G  R+A R  +G W  +QW
Sbjct: 4   TDLASLEKIIESAFDNRDNVNTSTKGEVRDAVEAALDLLDAGKARVAERSADGAWTVNQW 63

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++N   ++  G+G STWWDK+P+KF++W    F    FR +P  +VR SAY
Sbjct: 64  LKKAVLLSFRLNDMDVVEGGSGNSTWWDKVPSKFENWGENHFRAAGFRAVPNCVVRRSAY 123

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I P A+LMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPT
Sbjct: 124 IAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPT 183

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEGCIIREGSVLGMGVFIGKSTKI+DR TGE++YGEVP YSVVV G
Sbjct: 184 IIEDNCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKIVDRATGEVSYGEVPPYSVVVAG 243

Query: 243 SYPSIN--LKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S PS N  +      PHLYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 244 SMPSGNATMGNGQPAPHLYCAVIVKRVDEKTRSKTGINELLRD 286


>gi|319780358|ref|YP_004139834.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166246|gb|ADV09784.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 284

 Score =  397 bits (1021), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 185/279 (66%), Positives = 224/279 (80%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  FEE ++ + +   + +DA+QS LDLLDRG +R+A R  +G W+ +QW+K
Sbjct: 6   LASLEKTIEKAFEERDAISTATRGETRDAIQSALDLLDRGAVRVAERQADGKWHVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP +II  G G +TWWDK+P+KFD W   DFEK  FR +PG+IVR SAYI 
Sbjct: 66  KAVLLSFRLNPMEIIKGGPGEATWWDKVPSKFDGWGAVDFEKEGFRAVPGSIVRRSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P AVLMPSFVN+GAY+  G+MIDTW  VGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PGAVLMPSFVNVGAYVDTGTMIDTWVGVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGEI YGEVP  SVVV G+ 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRATGEIFYGEVPPNSVVVAGAM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P         GP LYCAVI+K+VD KTRSKTSIN LLRD
Sbjct: 246 PGKPFPNGEPGPSLYCAVIVKRVDAKTRSKTSINELLRD 284


>gi|254501876|ref|ZP_05114027.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Labrenzia alexandrii DFL-11]
 gi|222437947|gb|EEE44626.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Labrenzia alexandrii DFL-11]
          Length = 283

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/280 (67%), Positives = 228/280 (81%), Gaps = 2/280 (0%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++ L +IID+ FE+S S +     DV++AV++TL+LLDRG +R+A + D G W  +QW K
Sbjct: 5   LAALSKIIDAAFEDSASIDIHTTGDVRNAVETTLNLLDRGQLRVAEKKD-GDWVVNQWAK 63

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP  +I  G G +TWWDK+P+KFD W+  DFE   FR +P   VR SA+IG
Sbjct: 64  KAVLLSFRLNPMDVIKGGPGDATWWDKVPSKFDGWRGLDFEDAGFRAVPNCTVRRSAFIG 123

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GP II
Sbjct: 124 KGVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPVII 183

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI++R TGEITYGEVP YSVVV GS 
Sbjct: 184 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVNRMTGEITYGEVPPYSVVVAGSM 243

Query: 245 PSINLKGD-IAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PS N  G+ +A PHLYCAVI+K VDEKTRSKT+IN LLRD
Sbjct: 244 PSANTMGNGVAAPHLYCAVIVKTVDEKTRSKTAINELLRD 283


>gi|110632748|ref|YP_672956.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Mesorhizobium sp. BNC1]
 gi|123162875|sp|Q11LD4|DAPD_MESSB RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|110283732|gb|ABG61791.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Chelativorans sp. BNC1]
          Length = 284

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 179/279 (64%), Positives = 224/279 (80%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++ LE+ ++  FE  +S N     ++++AV++ LDLLD G +R+A R ++G W  +QW+K
Sbjct: 6   IAALEQTVEKAFENRDSVNTETRGEIREAVEAALDLLDSGGMRVAQRGEDGQWTVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP +II  G G + WWDK+ +KFD W + +FEK  FR +P  IVR SAYI 
Sbjct: 66  KAVLLSFRLNPMQIIKGGPGDAVWWDKVSSKFDGWSSNEFEKAGFRAVPNCIVRRSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P AVLMPSFVN+GAY+G  +M+DTW+TVGSCAQIG+NVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PGAVLMPSFVNLGAYVGRNTMVDTWATVGSCAQIGENVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TG+I YGEVP YSVVV G+ 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRETGQIFYGEVPPYSVVVAGTM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   +     GP+LYCAVI+K+VDEKTRSKTSIN LLRD
Sbjct: 246 PGKTMANGEPGPNLYCAVIVKRVDEKTRSKTSINDLLRD 284


>gi|150395297|ref|YP_001325764.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Sinorhizobium medicae WSM419]
 gi|166224231|sp|A6U5J9|DAPD_SINMW RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|150026812|gb|ABR58929.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sinorhizobium medicae WSM419]
          Length = 285

 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/280 (64%), Positives = 225/280 (80%), Gaps = 1/280 (0%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++L + I++ FE  ++ N      V+DAV++ L+LLD G +R+A R  +G W  +QW+K
Sbjct: 6   LASLSQTIETAFENRDAVNTGTRGAVRDAVEAALNLLDSGKVRVAERAADGTWTVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP +++  G G + WWDK+ +KFD W   +FEK  FR +P  +VR SAYI 
Sbjct: 66  KAVLLSFRLNPMELVRGGPGEAVWWDKVASKFDGWSVNEFEKAGFRAVPNCVVRRSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P AVLMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAVLMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV GS 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVMYGEVPPYSVVVAGSM 245

Query: 245 PSINLKGD-IAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PS +  G+    P+LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 246 PSGSAMGNGQPAPNLYCAVIVKRVDEKTRSKTGINELLRD 285


>gi|227820655|ref|YP_002824625.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Sinorhizobium fredii NGR234]
 gi|254767079|sp|C3MF35|DAPD_RHISN RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|227339654|gb|ACP23872.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sinorhizobium fredii NGR234]
          Length = 285

 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 179/280 (63%), Positives = 225/280 (80%), Gaps = 1/280 (0%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++L + I++ FE+  + + S    ++DAV++ L+LLD G +R+A R  +G W  +QW+K
Sbjct: 6   LASLSQTIETAFEDREAVSTSTRGAIRDAVEAALNLLDSGKVRVAERGADGTWTVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP +++  G G S WWDK+ +KFD W   +FEK  FR +P  +VR SAYI 
Sbjct: 66  KAVLLSFRLNPMELVKGGPGESVWWDKVASKFDGWSVNEFEKAGFRAVPNCVVRRSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+TYGEVP YSVVV GS 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVTYGEVPPYSVVVAGSM 245

Query: 245 PS-INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PS   +      P+LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 246 PSGSTMANGQPAPNLYCAVIVKRVDEKTRSKTGINELLRD 285


>gi|13474056|ref|NP_105624.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Mesorhizobium loti MAFF303099]
 gi|71153302|sp|Q98D61|DAPD_RHILO RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|14024808|dbj|BAB51410.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Mesorhizobium loti MAFF303099]
          Length = 284

 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/279 (64%), Positives = 225/279 (80%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE+ I+  F+E ++ + +   + +DA+Q+ LDLLDRG +R+A R  +G W+ +QW+K
Sbjct: 6   LASLEKTIEKAFDERDAISTATRGETRDAIQAALDLLDRGTVRVAERQADGKWHVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP +II  G G + WWDK+P+KFD W   DFEK  FR +P +IVR SAY+ 
Sbjct: 66  KAVLLSFRLNPMEIIKGGPGQAVWWDKVPSKFDGWSAVDFEKAGFRAVPSSIVRRSAYVA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P AVLMPSFVN+GAY+  G+M+DTW++VGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PGAVLMPSFVNVGAYVDTGTMVDTWASVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGEI YGEVP  SVVV GS 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRATGEIFYGEVPPNSVVVAGSL 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P      +  GP LYCAVI+K+VD KTRSKTSIN LLRD
Sbjct: 246 PGKPFPNNEPGPGLYCAVIVKRVDAKTRSKTSINELLRD 284


>gi|121602076|ref|YP_989571.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bartonella bacilliformis KC583]
 gi|166224196|sp|A1UUB8|DAPD_BARBK RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|120614253|gb|ABM44854.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Bartonella bacilliformis KC583]
          Length = 282

 Score =  394 bits (1013), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 185/282 (65%), Positives = 228/282 (80%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T +  L+ II+  F   +S N +   +++D+V+ TL+LLD+G IR+A R +NG W+ H+
Sbjct: 1   MTDLIQLKMIIEKAFNNHDSLNTATKGEIRDSVEYTLNLLDKGEIRVAERQENGQWHVHE 60

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+L+SF++NP  IIS G   S WWDKIP+KF  W+  DF+K NFR +PG IVRHSA
Sbjct: 61  WLKKAVLMSFRLNPMHIISGGANESFWWDKIPSKFSGWQETDFKKANFRSVPGAIVRHSA 120

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YI    +LMPSFVN+GAY+ E +MIDTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q  P
Sbjct: 121 YIASNVILMPSFVNLGAYVDEETMIDTWATVGSCAQIGKHVHLSGGVGIGGVLEPLQASP 180

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIED+CFIGARSE+VEGCIIREGSVLGMGVFIGKSTKIIDR+TGE+  GEVP+YSVVVP
Sbjct: 181 TIIEDHCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKIIDRSTGEVFIGEVPAYSVVVP 240

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           GS P   L    AGP+LYCAVI+K+VD+KTR KTSIN LLRD
Sbjct: 241 GSLPGKPLPNGEAGPNLYCAVIVKRVDQKTREKTSINDLLRD 282


>gi|209547674|ref|YP_002279591.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|226724186|sp|B5ZN24|DAPD_RHILW RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|209533430|gb|ACI53365.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 286

 Score =  394 bits (1012), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 180/283 (63%), Positives = 228/283 (80%), Gaps = 2/283 (0%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           T +++LE+ I++ F+  ++ N S   +V+DAV++ LDLLD G +R+A+R  +G W  +QW
Sbjct: 4   TDLASLEKTIEAAFDNRDNVNTSTKGEVRDAVEAALDLLDAGKVRVATRGADGAWTVNQW 63

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++N   ++  G+G STWWDK+P+KF+ W    F    FR +P  +VR SAY
Sbjct: 64  LKKAVLLSFRLNDMDVVKGGSGNSTWWDKVPSKFEGWGENHFRAAGFRAVPNCVVRRSAY 123

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I P A+LMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPT
Sbjct: 124 IAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPT 183

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE++YGEVP YSVVV G
Sbjct: 184 IIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVSYGEVPPYSVVVAG 243

Query: 243 SYPSIN--LKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S PS N  +      PHLYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 244 SMPSGNATMGNGKPAPHLYCAVIVKRVDEQTRSKTGINELLRD 286


>gi|163867372|ref|YP_001608566.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Bartonella tribocorum CIP 105476]
 gi|189082808|sp|A9ILJ3|DAPD_BART1 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|161017013|emb|CAK00571.1| 2,3,4,5-tetrahydropyridine-2-carboxylateN-succinyltransferase
           [Bartonella tribocorum CIP 105476]
          Length = 286

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 181/282 (64%), Positives = 229/282 (81%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T ++ LE II+  F++ +S N +   +++++V+ TL LLD+G IR+A R  NG W  HQ
Sbjct: 1   MTHLTQLEIIIEKAFDDRDSINTTTKGEIRESVEHTLSLLDKGEIRVAERQKNGQWYVHQ 60

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+LLSF++NP +II+ G   + WWDK+P+KF  WK  DF+K  FR +PG IVRHSA
Sbjct: 61  WLKKAVLLSFRLNPMQIITGGINGTHWWDKVPSKFSGWKEDDFQKAGFRSVPGAIVRHSA 120

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           Y+ P  +LMPSF+N+GA++ EG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q  P
Sbjct: 121 YVAPNVILMPSFINLGAFVDEGTMVDTWTTVGSCAQIGKHVHLSGGVGIGGVLEPLQANP 180

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIED+CFIGARSE+VEGCIIREG+VLGMGVFIG+STKIIDR TGEI  GEVP+YSVVVP
Sbjct: 181 TIIEDHCFIGARSEVVEGCIIREGAVLGMGVFIGQSTKIIDRTTGEIFIGEVPAYSVVVP 240

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           GS P   L    AGP+LYCAVI+K+VD+KTR KTSIN LLRD
Sbjct: 241 GSLPGKPLPNGEAGPNLYCAVIVKRVDQKTREKTSINELLRD 282


>gi|319898265|ref|YP_004158358.1| 2,3,4, 5-tetrahydropyridine-2-carboxylateN-succiny ltransferase
           [Bartonella clarridgeiae 73]
 gi|319402229|emb|CBI75762.1| 2,3,4, 5-tetrahydropyridine-2-carboxylateN-succiny ltransferase
           [Bartonella clarridgeiae 73]
          Length = 282

 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 184/282 (65%), Positives = 229/282 (81%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T +  LEEII+  F   +S N +   +++++V+  L+LLD+G IR+A R D+G W+ HQ
Sbjct: 1   MTNLIQLEEIIEKAFNNRDSINSATKGEIRESVEHILNLLDKGEIRVAQRQDDGQWHVHQ 60

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+LLSF+++   IIS G   + WWDKIP+KF  W+  DF+K NFR++PG IVRHSA
Sbjct: 61  WLKKAVLLSFRLHSMCIISGGANETHWWDKIPSKFSGWREVDFKKANFRLVPGAIVRHSA 120

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YI P  +LMPSFVN+GAY+GEG+MIDTW++VGSCAQIG+ VH+SGGVGIGGVLEP+Q GP
Sbjct: 121 YIAPNVILMPSFVNIGAYVGEGTMIDTWASVGSCAQIGRYVHLSGGVGIGGVLEPLQAGP 180

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIED+CFIGARSEIVEGCIIREG+VLGMGVFIGKSTKIIDR TGE+  GEVP+YSV+VP
Sbjct: 181 TIIEDHCFIGARSEIVEGCIIREGAVLGMGVFIGKSTKIIDRITGEVFIGEVPAYSVIVP 240

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           GSY    L     GP+LYCAVI+K+VD+KTR KTSIN LLRD
Sbjct: 241 GSYCGKPLPNGEIGPNLYCAVIVKRVDQKTREKTSINDLLRD 282


>gi|86356075|ref|YP_467967.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rhizobium etli CFN 42]
 gi|123513213|sp|Q2KD46|DAPD_RHIEC RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|86280177|gb|ABC89240.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           protein [Rhizobium etli CFN 42]
          Length = 286

 Score =  392 bits (1008), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 178/283 (62%), Positives = 227/283 (80%), Gaps = 2/283 (0%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           T +++LE+ I++ F+  ++ N S   +V+DAV++ L+LLD G  R+A R  +G W  +QW
Sbjct: 4   TDLASLEKTIEAAFDNRDNVNMSTKGEVRDAVEAALNLLDEGKARVAERGADGVWTVNQW 63

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++N  +++  G+G STWWDK+P+KF++W    F    FR +P  +VR SAY
Sbjct: 64  LKKAVLLSFRLNDMQVVKGGSGNSTWWDKVPSKFENWGENQFRASGFRAVPNCVVRRSAY 123

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I P A+LMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPT
Sbjct: 124 IAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPT 183

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEGCIIREGSVLGMGV+IGKSTKI+DR TGE+ YGEVP YSVVV G
Sbjct: 184 IIEDNCFIGARSEVVEGCIIREGSVLGMGVYIGKSTKIVDRATGEVMYGEVPPYSVVVAG 243

Query: 243 SYPSIN--LKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S  S N  +   +  PHLYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 244 SMASANATMANGLPAPHLYCAVIVKRVDEQTRSKTGINELLRD 286


>gi|319406470|emb|CBI80111.1| 2,3,4, 5-tetrahydropyridine-2-carboxylateN-succiny ltransferase
           [Bartonella sp. 1-1C]
          Length = 282

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/276 (67%), Positives = 224/276 (81%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           LEEII+  F   +S N +   +++++V+  L+LLD+G IR+A R DNG W+ HQW+KKAI
Sbjct: 7   LEEIIERAFNNRDSINSATKGEIRESVEHILNLLDKGEIRVAQRQDNGQWHVHQWLKKAI 66

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF+++   IIS G   S WWDKIP+KF  W+  DF+K NFR +PG IVRHSAYI P  
Sbjct: 67  LLSFRLHSMCIISGGANESHWWDKIPSKFSGWREVDFKKANFRSVPGAIVRHSAYIAPHV 126

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           +LMPSFVN+GAY+GEG+MIDTW++VGSCAQIG+ VH+SGGVGIGGVLEP+Q GPTIIED+
Sbjct: 127 ILMPSFVNVGAYVGEGTMIDTWASVGSCAQIGQYVHLSGGVGIGGVLEPLQEGPTIIEDH 186

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGARSEIVEGCIIREG+VLGMGVFIGKSTKIIDR TGE+  GEVP+YSVVVPGS    
Sbjct: 187 CFIGARSEIVEGCIIREGAVLGMGVFIGKSTKIIDRTTGEVFIGEVPAYSVVVPGSCCGK 246

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            L     GP+LYCA+I+K+VD+KTR KTSIN LLRD
Sbjct: 247 PLSNGEMGPNLYCAIIVKRVDKKTREKTSINDLLRD 282


>gi|222084714|ref|YP_002543243.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Agrobacterium radiobacter K84]
 gi|254767072|sp|B9J8D1|DAPD_AGRRK RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|221722162|gb|ACM25318.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Agrobacterium radiobacter K84]
          Length = 285

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 182/282 (64%), Positives = 227/282 (80%), Gaps = 1/282 (0%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           T +++LE  I++ FE  ++ N S   +V+DAV++ L+LLD G +R+A R  +G+W  +QW
Sbjct: 4   TDLASLENAIEAAFENRDNVNVSTRGEVRDAVETALNLLDSGKVRVAERGSDGNWTVNQW 63

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++N  +I+  G G STWWDK+P+KF+ W    F +  FR +P  +VR SAY
Sbjct: 64  LKKAVLLSFRLNDMQIVDGGPGGSTWWDKVPSKFEGWGENRFREAGFRAVPNAVVRRSAY 123

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I P A+LMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPT
Sbjct: 124 IAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPT 183

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEGCIIREGSVLGMGVFIGKSTKI+DR TGEITYGEVP YSVVV G
Sbjct: 184 IIEDNCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKIVDRATGEITYGEVPPYSVVVAG 243

Query: 243 SYPSIN-LKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           + P+ N +      P LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 244 ALPNGNTMANGQPAPSLYCAVIVKRVDEKTRSKTGINELLRD 285


>gi|240849745|ref|YP_002971133.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase
           [Bartonella grahamii as4aup]
 gi|240266868|gb|ACS50456.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase
           [Bartonella grahamii as4aup]
          Length = 282

 Score =  392 bits (1007), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 181/281 (64%), Positives = 229/281 (81%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T ++ LE II   F++ +S + +   +++++++ TL+LLD+G IR+A R  NG W+ HQ
Sbjct: 1   MTHLTQLEMIIQQAFDDRDSIDTTTKGEIRESIEHTLNLLDKGEIRVAERQKNGQWHVHQ 60

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+LLSF++NP +II+ G   + WWDK+P+KF  W+  DF+  +FR +PG IVRHSA
Sbjct: 61  WLKKAVLLSFRLNPMQIITGGINGTHWWDKVPSKFSGWQEADFKSADFRSVPGAIVRHSA 120

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YI P  +LMPSFVN+GA+I EG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q  P
Sbjct: 121 YIAPNVILMPSFVNLGAFIDEGTMVDTWTTVGSCAQIGKHVHLSGGVGIGGVLEPLQANP 180

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIED+CFIGARSEIVEGCIIREG+VLGMGVFIGKSTKIIDR TGEI  GEVP+YSVVVP
Sbjct: 181 TIIEDHCFIGARSEIVEGCIIREGTVLGMGVFIGKSTKIIDRTTGEIFIGEVPAYSVVVP 240

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           GS+P   L    AGP LYCAVI+K+VD+KTR KTSIN LLR
Sbjct: 241 GSFPGKPLPNGEAGPSLYCAVIVKRVDQKTREKTSINDLLR 281


>gi|218509649|ref|ZP_03507527.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhizobium etli Brasil 5]
          Length = 286

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 178/283 (62%), Positives = 226/283 (79%), Gaps = 2/283 (0%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           T +++LE+ I++ F+  ++ N S   +V+DAV++ L+LLD G  R+A R   G W  +QW
Sbjct: 4   TDLASLEKTIEAAFDNRDNVNMSTKGEVRDAVEAALNLLDEGKARVAERGAEGVWTVNQW 63

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++N  +++  G+G STWWDK+P+KF++W    F    FR +P  +VR SAY
Sbjct: 64  LKKAVLLSFRLNDMEVVKGGSGNSTWWDKVPSKFENWGENQFRAAGFRAVPNCVVRRSAY 123

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I P A+LMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPT
Sbjct: 124 IAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPT 183

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEGCIIREGSVLGMGV+IGKSTKI+DR TGE+ YGEVP YSVVV G
Sbjct: 184 IIEDNCFIGARSEVVEGCIIREGSVLGMGVYIGKSTKIVDRATGEVMYGEVPPYSVVVAG 243

Query: 243 SYPSIN--LKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S  S N  +   +  PHLYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 244 SMASANATMANGLPAPHLYCAVIVKRVDEQTRSKTGINELLRD 286


>gi|222147377|ref|YP_002548334.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Agrobacterium vitis S4]
 gi|254767073|sp|B9JZL8|DAPD_AGRVS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|221734367|gb|ACM35330.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Agrobacterium vitis S4]
          Length = 285

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 176/280 (62%), Positives = 226/280 (80%), Gaps = 1/280 (0%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S+L+ +ID+ F+  ++   S   +V+DAV+ +L LLD+G +R+A+R ++G W  HQW+K
Sbjct: 6   LSSLQTVIDTAFDNRDTITLSTKGEVRDAVEQSLALLDQGKVRVATRGEDGQWTVHQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N  +++  G G STWWDK+P+KF+ W    F    FR +P  +VRHSA+I 
Sbjct: 66  KAVLLSFRLNDMEVVKGGPGASTWWDKVPSKFEGWGENQFRAAGFRAVPNAVVRHSAFIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPSFVN+GAY+GEG+M+DTW+TVGSCAQIG++VH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGRHVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCIIREG+VLGMGV+IGKSTKIIDR TGE+ YGEVP YSVVV GS 
Sbjct: 186 EDNCFIGARSEVVEGCIIREGAVLGMGVYIGKSTKIIDRATGEVMYGEVPPYSVVVAGSM 245

Query: 245 PSIN-LKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PS N +   +  P LYCAVI+K+VD +TRSKT IN LLRD
Sbjct: 246 PSPNTMPNGLPAPSLYCAVIVKRVDAQTRSKTGINELLRD 285


>gi|319404985|emb|CBI78588.1| 2,3,4, 5-tetrahydropyridine-2-carboxylateN-succiny ltransferase
           [Bartonella sp. AR 15-3]
          Length = 282

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/282 (65%), Positives = 227/282 (80%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T +  LEEII+  F   +S N +   +++++V+  L+LLD+G +R+A R DNG W  HQ
Sbjct: 1   MTNLIQLEEIIEKAFNNRDSINSTTKGEIRESVEYVLNLLDKGELRVAQRQDNGQWYVHQ 60

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+LLSFQ++   IIS G   S WWDKIP+KF  W+  DF++ NFR +PG IVRHSA
Sbjct: 61  WLKKAVLLSFQLHSMCIISGGANESHWWDKIPSKFFGWREVDFKEANFRSVPGAIVRHSA 120

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YI P  +LMPSFVN+GAY+GEG+M+DTW++VGSCAQIG+ VH+SGGVGIGGVLEP+Q GP
Sbjct: 121 YIAPHVILMPSFVNIGAYVGEGTMVDTWASVGSCAQIGQYVHLSGGVGIGGVLEPLQEGP 180

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIED+CFIGARSEIVEGCIIREG+VLGMGVFIGKSTKIIDR TGE+  GEVP+YSVVVP
Sbjct: 181 TIIEDHCFIGARSEIVEGCIIREGAVLGMGVFIGKSTKIIDRTTGEVFIGEVPAYSVVVP 240

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           GSY    L     GP+LYCAVIIK+VD+KTR KTSIN LLR+
Sbjct: 241 GSYCGKPLPNGEMGPNLYCAVIIKRVDKKTREKTSINNLLRN 282


>gi|49474894|ref|YP_032935.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bartonella henselae str. Houston-1]
 gi|71153271|sp|Q6G549|DAPD_BARHE RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|49237699|emb|CAF26888.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bartonella henselae str. Houston-1]
          Length = 282

 Score =  391 bits (1005), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 180/282 (63%), Positives = 228/282 (80%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T ++ LE II+  F++ NS N +   ++ ++V+  L+LLD+G +R+  R  NG W+ HQ
Sbjct: 1   MTDLTQLEMIIEKAFDDRNSINTTTKGEILESVEHALNLLDKGEVRVVKRQKNGKWHVHQ 60

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+LLSF++NP +I++ G   ++WWDK+P+KF  W+  DF+K +FR +PG IVRHSA
Sbjct: 61  WLKKAVLLSFRLNPMQIMTGGVNGTSWWDKVPSKFSHWQEADFKKADFRSVPGAIVRHSA 120

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YI P  +LMPSFVN+GA++ EG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q  P
Sbjct: 121 YIAPNVILMPSFVNLGAFVDEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPLQANP 180

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIED+CFIGARSE+VEGCIIREGSVLGMGVFIGKSTKIIDR TGEI  GEVP YSVVVP
Sbjct: 181 TIIEDHCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKIIDRTTGEIFIGEVPPYSVVVP 240

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           GS P   L     GP+LYCAVI+K+VD+KTR KTSIN LLRD
Sbjct: 241 GSLPGKPLPNGEIGPNLYCAVIVKRVDQKTREKTSINDLLRD 282


>gi|307301330|ref|ZP_07581092.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sinorhizobium meliloti BL225C]
 gi|307318000|ref|ZP_07597437.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sinorhizobium meliloti AK83]
 gi|71153303|sp|Q92SG5|DAPD_RHIME RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|306896402|gb|EFN27151.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sinorhizobium meliloti AK83]
 gi|306903786|gb|EFN34373.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sinorhizobium meliloti BL225C]
          Length = 285

 Score =  391 bits (1004), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 178/280 (63%), Positives = 223/280 (79%), Gaps = 1/280 (0%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++L + I++ FE  ++ N      V+DAV++ L+LLD G +R+A R ++G W  +QW+K
Sbjct: 6   LASLSQTIETAFEGRDAVNTGTRGAVRDAVETALNLLDSGKVRVAERSEDGTWTVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP +++  G G + WWDK+ +KFD W   +FEK  FR +P  +VR SAYI 
Sbjct: 66  KAVLLSFRLNPMELVRGGPGEAVWWDKVASKFDGWSVNEFEKAGFRAVPNCVVRRSAYIA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P AVLMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 PNAVLMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV GS 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVMYGEVPPYSVVVAGSM 245

Query: 245 PS-INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            S   +      P+LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 246 ASGSTMANGQPAPNLYCAVIVKRVDEKTRSKTGINELLRD 285


>gi|319403557|emb|CBI77139.1| 2,3,4, 5-tetrahydropyridine-2-carboxylateN-succiny ltransferase
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 282

 Score =  390 bits (1003), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 184/282 (65%), Positives = 226/282 (80%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T +  LEEII+  F   +S N +   +++++V+  L+LLD+G IR+A R DNG W  HQ
Sbjct: 1   MTSLIQLEEIIERAFNNRDSINSATKGEIRESVEHILNLLDKGEIRVAQRQDNGQWRVHQ 60

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+LLSF+++   II+ G   S WWDKIP+KF  W+  DF+K NFR +PG IVRHSA
Sbjct: 61  WLKKAVLLSFRLHSMCIIAGGANESYWWDKIPSKFSGWREVDFKKANFRSVPGAIVRHSA 120

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YI P  +LMPSFVN+GAY+GEG+M+DTW++VGSCAQIG+ VH+SGGVGIGGVLEP+Q GP
Sbjct: 121 YIAPHVILMPSFVNVGAYVGEGTMVDTWASVGSCAQIGQYVHLSGGVGIGGVLEPLQEGP 180

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIED+CFIGARSEIVEGCIIREG+VLGMGVFIGKSTKIIDR TGE+  GEVP+YSVVVP
Sbjct: 181 TIIEDHCFIGARSEIVEGCIIREGAVLGMGVFIGKSTKIIDRTTGEVFLGEVPAYSVVVP 240

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           GS     L     GP+LYCAVI+K+VD+KTR KTSIN LLRD
Sbjct: 241 GSCCGKPLPNGEMGPNLYCAVIVKRVDKKTREKTSINDLLRD 282


>gi|195970205|ref|NP_384539.3| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Sinorhizobium meliloti 1021]
 gi|15073362|emb|CAC41870.1| Probable 2,3,4,5-tetrahydropyridine-2-carboxylate
           N-succinyltransferase [Sinorhizobium meliloti 1021]
          Length = 296

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 178/280 (63%), Positives = 223/280 (79%), Gaps = 1/280 (0%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++L + I++ FE  ++ N      V+DAV++ L+LLD G +R+A R ++G W  +QW+K
Sbjct: 17  LASLSQTIETAFEGRDAVNTGTRGAVRDAVETALNLLDSGKVRVAERSEDGTWTVNQWLK 76

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP +++  G G + WWDK+ +KFD W   +FEK  FR +P  +VR SAYI 
Sbjct: 77  KAVLLSFRLNPMELVRGGPGEAVWWDKVASKFDGWSVNEFEKAGFRAVPNCVVRRSAYIA 136

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P AVLMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 137 PNAVLMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTII 196

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV GS 
Sbjct: 197 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVMYGEVPPYSVVVAGSM 256

Query: 245 PS-INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            S   +      P+LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 257 ASGSTMANGQPAPNLYCAVIVKRVDEKTRSKTGINELLRD 296


>gi|327191113|gb|EGE58161.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           protein [Rhizobium etli CNPAF512]
          Length = 286

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 177/283 (62%), Positives = 226/283 (79%), Gaps = 2/283 (0%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           T +++LE+ I++ F+  ++ N S   +V+DAV++ L+LLD G  R+A R  +G W  +QW
Sbjct: 4   TDLASLEKTIEAAFDNRDNVNMSTKGEVRDAVEAALNLLDEGKARVAERGADGVWTVNQW 63

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++N  +++  G+G STWWDK+P+KF++W    F    FR +P  +VR SAY
Sbjct: 64  LKKAVLLSFRLNDMEVVKGGSGNSTWWDKVPSKFENWGENQFRAAGFRAVPNCVVRRSAY 123

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   A+LMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPT
Sbjct: 124 IAANAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPT 183

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEGCIIREGSVLGMGV+IGKSTKI+DR TGE+ YGEVP YSVVV G
Sbjct: 184 IIEDNCFIGARSEVVEGCIIREGSVLGMGVYIGKSTKIVDRATGEVMYGEVPPYSVVVAG 243

Query: 243 SYPSIN--LKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S  S N  +   +  PHLYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 244 SMASANTTMANGLPAPHLYCAVIVKRVDEQTRSKTGINELLRD 286


>gi|190890091|ref|YP_001976633.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rhizobium etli CIAT 652]
 gi|226724185|sp|B3PZG1|DAPD_RHIE6 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|190695370|gb|ACE89455.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           protein [Rhizobium etli CIAT 652]
          Length = 286

 Score =  389 bits (1000), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 177/283 (62%), Positives = 226/283 (79%), Gaps = 2/283 (0%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           T +++LE+ I++ F+  ++ N S   +V+DAV++ L+LLD G  R+A R  +G W  +QW
Sbjct: 4   TDLASLEKTIEAAFDNRDNVNMSTKGEVRDAVEAALNLLDEGKARVAERGADGVWTVNQW 63

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++N  +++  G+G STWWDK+P+KF++W    F    FR +P  +VR SAY
Sbjct: 64  LKKAVLLSFRLNDMEVVKGGSGNSTWWDKVPSKFENWGENQFRAAGFRAVPNCVVRRSAY 123

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   A+LMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPT
Sbjct: 124 IAANAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPT 183

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEGCIIREGSVLGMGV+IGKSTKI+DR TGE+ YGEVP YSVVV G
Sbjct: 184 IIEDNCFIGARSEVVEGCIIREGSVLGMGVYIGKSTKIVDRATGEVMYGEVPPYSVVVAG 243

Query: 243 SYPSIN--LKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S  S N  +   +  PHLYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 244 SMASANATMANGLPAPHLYCAVIVKRVDEQTRSKTGINELLRD 286


>gi|260763643|ref|ZP_05875975.1| tetrahydrodipicolinate N-succinyltransferase [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260674064|gb|EEX60885.1| tetrahydrodipicolinate N-succinyltransferase [Brucella abortus bv.
           2 str. 86/8/59]
          Length = 254

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 176/254 (69%), Positives = 216/254 (85%)

Query: 30  VKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWW 89
           +++AV+ +L LLDRG +R+A +  +G+W+ +QW+KKA+LLSF++NP ++I  G G S+WW
Sbjct: 1   MREAVEQSLILLDRGEVRVAEKQADGNWHVNQWLKKAVLLSFRLNPMEVIKGGPGQSSWW 60

Query: 90  DKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTW 149
           DK+P+KFD W   +FEK  FR +P  IVRHSAYI P A+LMPSFVN+GAY+ +G+MIDTW
Sbjct: 61  DKVPSKFDGWTANEFEKAGFRAVPNCIVRHSAYIAPNAILMPSFVNLGAYVDKGAMIDTW 120

Query: 150 STVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLG 209
           +TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIEDNCFIGARSE+VEGCI+REGSVLG
Sbjct: 121 ATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLG 180

Query: 210 MGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDE 269
           MGVFIGKSTKI+DR TGE+ YGEVP YSVVV G+ P  N+ G+  GP LYCAVI+K+ DE
Sbjct: 181 MGVFIGKSTKIVDRATGEVFYGEVPPYSVVVAGTMPGKNVPGENWGPSLYCAVIVKRADE 240

Query: 270 KTRSKTSINTLLRD 283
           KTRSKTSIN LLRD
Sbjct: 241 KTRSKTSINELLRD 254


>gi|118589727|ref|ZP_01547132.1| probable 2,3,4,5-tetrahydropyridine-2-carboxylate
           n-succinyltransferase protein [Stappia aggregata IAM
           12614]
 gi|118437813|gb|EAV44449.1| probable 2,3,4,5-tetrahydropyridine-2-carboxylate
           n-succinyltransferase protein [Stappia aggregata IAM
           12614]
          Length = 283

 Score =  389 bits (998), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 183/280 (65%), Positives = 227/280 (81%), Gaps = 2/280 (0%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++L +IID+ FE+  + + +   +++DAV+ TL+LLDRG +R+A + D G W  +QW K
Sbjct: 5   LASLSKIIDAAFEDRAAIDTTTTGEIRDAVEETLNLLDRGQLRVAEKKD-GDWTVNQWAK 63

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP  II  G G +TWWDK+P+KFD W+  DFEK  FR +P  IVR SA+IG
Sbjct: 64  KAVLLSFRLNPMDIIKGGPGDATWWDKVPSKFDGWRGMDFEKAGFRAVPNCIVRRSAFIG 123

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GP II
Sbjct: 124 KGVVLMPSFVNLGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPVII 183

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI++R TGEITYGEVP YSVVV GS 
Sbjct: 184 EDNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVNRATGEITYGEVPPYSVVVAGSM 243

Query: 245 PSINLKGD-IAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   + G+  A P+LYCAVI+K VDEKTRSKT IN LLRD
Sbjct: 244 PGNKVMGNGEAAPNLYCAVIVKTVDEKTRSKTGINELLRD 283


>gi|159184277|ref|NP_353403.2| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Agrobacterium tumefaciens str. C58]
 gi|71153269|sp|Q8UIC6|DAPD_AGRT5 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|159139604|gb|AAK86188.2| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Agrobacterium tumefaciens str. C58]
          Length = 284

 Score =  387 bits (993), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 177/282 (62%), Positives = 223/282 (79%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T +++LE II++ F+  +  N S   +V+DAV ++L LLD G +R+A +  +G+W  +Q
Sbjct: 3   LTDLTSLETIIETAFDNRDGVNVSTKGEVRDAVNTSLQLLDSGKVRVAEKQADGNWKVNQ 62

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+LLSF++N  +I++ G G STWWDK+P+KF++W    F    FR +P  +VR SA
Sbjct: 63  WLKKAVLLSFRLNDMEIVTGGPGESTWWDKVPSKFENWGENQFRAAGFRAVPNAVVRRSA 122

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           Y+    VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GP
Sbjct: 123 YVAKNVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGP 182

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIEDNCFIGARSE+VEGCI+REG+VLGMGVFIGKSTKI+DR TGEITYGEVP YSVVV 
Sbjct: 183 TIIEDNCFIGARSEVVEGCIVREGAVLGMGVFIGKSTKIVDRATGEITYGEVPPYSVVVA 242

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           G+ P         GP LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 243 GTMPGKPFPNGEPGPSLYCAVIVKRVDEKTRSKTGINELLRD 284


>gi|325291805|ref|YP_004277669.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Agrobacterium sp. H13-3]
 gi|325059658|gb|ADY63349.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Agrobacterium sp. H13-3]
          Length = 284

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 175/279 (62%), Positives = 220/279 (78%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE  I++ F+  +  N S   +V+DAV ++L LLD G +R+A +  +G+W  +QW+K
Sbjct: 6   LTSLETTIETAFDNRDGVNVSTKGEVRDAVNTSLQLLDSGKVRVAEKQADGNWKVNQWLK 65

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N  +I++ G G STWWDK+P+KF++W    F    FR +P  +VR SAY+ 
Sbjct: 66  KAVLLSFRLNDMEIVTGGPGESTWWDKVPSKFENWGENQFRAAGFRAVPNAVVRRSAYVA 125

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 126 KNVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTII 185

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REG+VLGMGVFIGKSTKI+DR TGEITYGEVP YSVVV G+ 
Sbjct: 186 EDNCFIGARSEVVEGCIVREGAVLGMGVFIGKSTKIVDRATGEITYGEVPPYSVVVAGTM 245

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P         GP LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 246 PGKPFPNGEPGPSLYCAVIVKRVDEKTRSKTGINELLRD 284


>gi|114706683|ref|ZP_01439584.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           protein [Fulvimarina pelagi HTCC2506]
 gi|114538075|gb|EAU41198.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           protein [Fulvimarina pelagi HTCC2506]
          Length = 284

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 173/278 (62%), Positives = 219/278 (78%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           S LE  I+  FE+  S + S   +V++AV++ L++LD G  R+ASR ++G W  HQW+KK
Sbjct: 7   SALEATIEQAFEDRASISTSTTGEVREAVEAALEMLDSGTARVASRGEDGQWTVHQWLKK 66

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N  ++I  GNG S WWDK+P+KF  W    F +  FR +PG+IVR  ++I  
Sbjct: 67  AVLLSFRLNDMEVIEGGNGGSVWWDKVPSKFAGWGEDRFRESGFRAVPGSIVRRGSFIAR 126

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EGSM+D W+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 127 DVVLMPSFVNLGAYVDEGSMVDGWATVGSCAQIGKHVHLSGGVGIGGVLEPLQAGPTIIE 186

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D CFIGARSE+VEGCI+REGSVLGMGV+IGKSTKI+DR TGE++YGE+P YSVVV GS P
Sbjct: 187 DGCFIGARSEVVEGCIVREGSVLGMGVYIGKSTKIVDRTTGEVSYGEIPPYSVVVAGSMP 246

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              +     GP+LYCAVI+K+VDE+TRSKTSIN LLR+
Sbjct: 247 GKPMANGAPGPNLYCAVIVKRVDEQTRSKTSINDLLRN 284


>gi|90419793|ref|ZP_01227702.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90335834|gb|EAS49582.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 284

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 174/278 (62%), Positives = 220/278 (79%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I+  FE+ +S + S   +V+DAV+++LD+LDRG  R+ASR+ +G W  HQW+KK
Sbjct: 7   AALETTIERAFEDRDSISASTTGEVRDAVEASLDMLDRGEARVASREADGSWTVHQWLKK 66

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N   +I  G G +TWWDK+P+KF+ W    F +  FR +P  +VR SA+IG 
Sbjct: 67  AVLLSFRLNDMTVIEGGPGGATWWDKVPSKFEGWNADRFREMGFRAVPNAVVRRSAHIGK 126

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 127 GVVLMPSFVNLGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 186

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D CFIGARSE+VEGCI+REGSVLGMGVF+G+STKI+DR TG I+YGEVP YSVVV GS  
Sbjct: 187 DGCFIGARSEVVEGCIVREGSVLGMGVFLGQSTKIVDRTTGTISYGEVPPYSVVVAGSMQ 246

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              +     GP LYCAVI+K+VDE+TRSKTSIN LLR+
Sbjct: 247 GKPMGNGEPGPSLYCAVIVKRVDERTRSKTSINELLRN 284


>gi|328545260|ref|YP_004305369.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [polymorphum gilvum SL003B-26A1]
 gi|326415002|gb|ADZ72065.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Polymorphum gilvum SL003B-26A1]
          Length = 282

 Score =  381 bits (979), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 180/283 (63%), Positives = 224/283 (79%), Gaps = 1/283 (0%)

Query: 1   MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           MI  ++ L   ID+ FE+  S +     +V+ AV++TL+LLDRG +R+A + D G+W  +
Sbjct: 1   MIHDLAKLAATIDAAFEDRASIDTHTTGEVRQAVETTLNLLDRGQLRVAEKKD-GNWVVN 59

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW KKA+LLSF++NP ++I  G G +TWWDK+P+KFD W+  DFE+  FR +P  IVR S
Sbjct: 60  QWAKKAVLLSFRLNPMEVIKGGPGDATWWDKVPSKFDGWRGVDFEEAGFRAVPNCIVRRS 119

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+IG   VLMPSFVN+GA++GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q G
Sbjct: 120 AFIGKGVVLMPSFVNLGAHVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAG 179

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           P IIEDNCFIGARSE+VEG I+REG+VL MGVFIG STKIIDR TGE+  GEVP+YSVVV
Sbjct: 180 PVIIEDNCFIGARSEVVEGVIVREGAVLSMGVFIGASTKIIDRTTGEVFVGEVPAYSVVV 239

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PG+ P   L     GP LYCAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 240 PGTMPGKPLPDGTPGPSLYCAVIVKRVDEQTRSKTSINELLRD 282


>gi|84515764|ref|ZP_01003125.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Loktanella vestfoldensis SKA53]
 gi|84510206|gb|EAQ06662.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Loktanella vestfoldensis SKA53]
          Length = 275

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/278 (64%), Positives = 221/278 (79%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ ++  ++   +   +V+DA+++TL+ LD G +R+A +  +G W+ +QW KK
Sbjct: 4   AALETAIEAAWDARDTITPATKGEVRDAIETTLNALDSGTLRVAEKQGDGSWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N  + IS GNG STWWDK+P+KFD W   D+    FR +PG+IVR SA+IG 
Sbjct: 64  AVLLSFRLNDMEPISGGNGGSTWWDKVPSKFDGWTEADWRAAGFRAVPGSIVRRSAFIGK 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EGSM+D W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGSMVDGWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCIIREGSVLGMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIIREGSVLGMGVFIGQSTKIVDRATGEVMYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 244 STN------GINLYCAVIVKRVDEKTRSKTGINELLRD 275


>gi|163757853|ref|ZP_02164942.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Hoeflea phototrophica DFL-43]
 gi|162285355|gb|EDQ35637.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Hoeflea phototrophica DFL-43]
          Length = 280

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 176/280 (62%), Positives = 221/280 (78%), Gaps = 1/280 (0%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++ L   I++ F+  +S + S   +V++AV   L+LLDRG  R+A R D+G W  +QW+K
Sbjct: 1   MAALASTIETAFDNRDSVSVSTRGEVREAVDEALNLLDRGEARVAVRGDDGTWTVNQWLK 60

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP +II  G G + WWDK+P+KF+ W   +FE+  FR +PG+IVR  ++IG
Sbjct: 61  KAVLLSFRLNPMEIIKGGPGDAVWWDKVPSKFEGWSANEFERSGFRAVPGSIVRRGSFIG 120

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GAY+ EGSM+D W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 121 KNVVLMPSFVNLGAYVDEGSMVDGWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTII 180

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEGCI+REGSVLGMGV+IGKST+I++R TGEI YGEVP YSVVV GS 
Sbjct: 181 EDNCFIGARSEVVEGCIVREGSVLGMGVYIGKSTRIVNRMTGEIGYGEVPPYSVVVAGSM 240

Query: 245 PSINLKGDIA-GPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PS    G+ A  P+LYCAVI+K VD +TRSKT IN LLRD
Sbjct: 241 PSSGTMGNGATAPNLYCAVIVKTVDAQTRSKTGINELLRD 280


>gi|304392399|ref|ZP_07374340.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ahrensia sp. R2A130]
 gi|303295503|gb|EFL89862.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ahrensia sp. R2A130]
          Length = 280

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 171/276 (61%), Positives = 217/276 (78%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           L+  I++ FE+ ++ + S    V+DAV+  L +LD G  R+A R  +G W  +QW+K+A+
Sbjct: 5   LQATIEAAFEDRDNISTSTTGAVRDAVEQALAMLDNGTARVAERGADGTWTVNQWLKQAV 64

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++N  ++I  G+G STWWDK+P+KF+ W  + F    FR +PG+I R  A+IG   
Sbjct: 65  LLSFRLNDMEVIGGGSGNSTWWDKVPSKFEGWGAEQFRAAGFRAVPGSICRQGAFIGKNV 124

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPSFVN+GAY+ +GSM+D W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIEDN
Sbjct: 125 VLMPSFVNLGAYVDDGSMVDGWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTIIEDN 184

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGARSE+VEGCI+REGSVLGMGV+IG+STKI++R TGEI+YGEVP YSVVV GS PS 
Sbjct: 185 CFIGARSEVVEGCIVREGSVLGMGVYIGQSTKIVNRATGEISYGEVPPYSVVVAGSMPSK 244

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            +     GP+LYCAVI+K VDE+TRSKT IN LLRD
Sbjct: 245 PMGNGDTGPNLYCAVIVKTVDERTRSKTGINELLRD 280


>gi|218658499|ref|ZP_03514429.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhizobium etli IE4771]
          Length = 274

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/274 (63%), Positives = 218/274 (79%), Gaps = 2/274 (0%)

Query: 12  IDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSF 71
           I++ F+  ++ N S   +V+DAV + LDLLD G +R+A R  +G W  +QW+KKA+LLSF
Sbjct: 1   IETAFDNRDNVNMSTKGEVRDAVDAALDLLDGGKVRVAERGTDGIWTVNQWLKKAVLLSF 60

Query: 72  QINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMP 131
           ++N  +++  G+G STWWDK+P+KF++W    F    FR +P  +VR SAYI P A+LMP
Sbjct: 61  RLNDMEVVKGGSGNSTWWDKVPSKFENWGENQFRAAGFRAVPNCVVRRSAYIAPNAILMP 120

Query: 132 SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIG 191
           SFVN+GAY+GEG+M+D+W+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPTIIEDNCFIG
Sbjct: 121 SFVNLGAYVGEGTMVDSWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPTIIEDNCFIG 180

Query: 192 ARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKG 251
           ARSE+VEGCIIREGSVLGMGV+IGKSTKI+DR TGE+ YGEVP YSVVV GS  S N   
Sbjct: 181 ARSEVVEGCIIREGSVLGMGVYIGKSTKIVDRATGEVMYGEVPPYSVVVAGSMASANAAM 240

Query: 252 DIA--GPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
                 PHLYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 241 ANGQPAPHLYCAVIVKRVDEQTRSKTGINELLRD 274


>gi|49473748|ref|YP_031790.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bartonella quintana str. Toulouse]
 gi|71153272|sp|Q6G1F4|DAPD_BARQU RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|49239251|emb|CAF25572.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bartonella quintana str. Toulouse]
          Length = 282

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/282 (63%), Positives = 230/282 (81%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T ++ LE II+  F++ +S   +   +++++V+  L+LLD+G IR+A R  NG W+ HQ
Sbjct: 1   MTNLTQLEMIIEKAFDDRDSIKTTTKGEIRESVEHALNLLDKGEIRVAERQKNGQWHVHQ 60

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+LL F++NP +II+ G   + WWDK+P+KF +W+  DF+K NFR +PGTIVRHSA
Sbjct: 61  WLKKAVLLFFRLNPMQIIAGGVNGTYWWDKVPSKFSNWQETDFKKANFRSVPGTIVRHSA 120

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YI P  +LMPSFVN+GA+I EG+M+DTW+TVGSCAQIGK+VH+SGGVG+GGVLEP+Q  P
Sbjct: 121 YIAPNVILMPSFVNLGAFIDEGTMVDTWATVGSCAQIGKHVHLSGGVGLGGVLEPLQANP 180

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIED+CFIGARSE+VEGCIIREG+VLGMGVFIGKSTKIIDR TGE+  GEVP+YSVVVP
Sbjct: 181 TIIEDHCFIGARSEVVEGCIIREGAVLGMGVFIGKSTKIIDRTTGEVFIGEVPAYSVVVP 240

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           GS P   L     GP+LYCAVI+K+VD+KTR KTSIN LLRD
Sbjct: 241 GSLPGKPLPNGEVGPNLYCAVIVKRVDQKTREKTSINDLLRD 282


>gi|126733860|ref|ZP_01749607.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Roseobacter sp. CCS2]
 gi|126716726|gb|EBA13590.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Roseobacter sp. CCS2]
          Length = 275

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/278 (62%), Positives = 215/278 (77%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ ++  +    S   + ++A++ TL+ LD G +R+A + D+G W+ +QW KK
Sbjct: 4   AALETAIEAAWDARDQVTTSTQGETREAIEDTLNALDSGKLRVAEKLDDGSWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N  + IS GNG STWWDK+P+KFD W    +    FR +PG+IVR SAYI  
Sbjct: 64  AVLLSFRLNDMEPISGGNGGSTWWDKVPSKFDGWGENQWRDAGFRAVPGSIVRRSAYIAK 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EGSM+D W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 DVVLMPSFVNLGAYVDEGSMVDGWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N         LYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 244 SKN------NISLYCAVIVKRVDERTRSKTGINELLRD 275


>gi|254437768|ref|ZP_05051262.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Octadecabacter antarcticus 307]
 gi|198253214|gb|EDY77528.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Octadecabacter antarcticus 307]
          Length = 275

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/278 (63%), Positives = 216/278 (77%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I+S ++  ++   +   +V+DA+  TL  LD G +R+A R +NG W+ +QW KK
Sbjct: 4   AQLETAIESAWDVRDTITVATKGEVRDAITDTLTALDSGKLRVAERRENGDWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N  + IS GNG +TWWDK+P+KFD W    +    FR +PG+IVR SA+IG 
Sbjct: 64  AVLLSFRLNDMEPISGGNGGTTWWDKVPSKFDGWGENQWRDAGFRAVPGSIVRRSAFIGK 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EGSM+D W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGSMVDGWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCIIREGSVLGMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIIREGSVLGMGVFIGQSTKIVDRETGEVFYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N        +LYCAVI+K+VD KTRSKT IN LLRD
Sbjct: 244 SKN------NVNLYCAVIVKRVDAKTRSKTGINELLRD 275


>gi|254473769|ref|ZP_05087164.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pseudovibrio sp. JE062]
 gi|211957155|gb|EEA92360.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pseudovibrio sp. JE062]
          Length = 283

 Score =  364 bits (935), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 169/279 (60%), Positives = 218/279 (78%), Gaps = 1/279 (0%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++ LE  I++ F++ ++ +     DV+DAV + L+L+D G +R+A +  +G W  +QW K
Sbjct: 6   LAALEATINAAFDDRDNISTDTTGDVRDAVNTALNLMDHGKLRVADKT-SGDWVVNQWAK 64

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++NP +II  G   + WWDK+P+KFD W   DFE+  FR +PG+IVR SA++G
Sbjct: 65  KAVLLSFRLNPMQIIKGGPDDAPWWDKVPSKFDGWGAIDFEEAGFRAVPGSIVRRSAFVG 124

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
             AVLMPSFVN+GA++ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GP II
Sbjct: 125 KSAVLMPSFVNLGAFVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPVII 184

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEG I+REG+VL MGVFI  +TKI+DR TGEI YGEVP+YSVVVPGS 
Sbjct: 185 EDNCFIGARSEVVEGVIVREGAVLSMGVFISATTKIVDRTTGEIFYGEVPAYSVVVPGSM 244

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   L     GP+L CAVI+K+VD +TR+KTS+N LLRD
Sbjct: 245 PGKPLPDGTPGPNLGCAVIVKRVDAQTRAKTSVNDLLRD 283


>gi|254451756|ref|ZP_05065193.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Octadecabacter antarcticus 238]
 gi|198266162|gb|EDY90432.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Octadecabacter antarcticus 238]
          Length = 275

 Score =  363 bits (933), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 171/278 (61%), Positives = 214/278 (76%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I+S ++  +        +V+DA+  TL+ LD G +R+A R +NG W+ +QW KK
Sbjct: 4   AQLEAAIESAWDARDQITVETKGEVRDAITDTLNALDSGKLRVAERRENGDWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N   +I   NG ++WWDK+P+K+  W   +++   FR +PG+IVR SA+IG 
Sbjct: 64  AVLLSFRLNDMAMIEGSNGGASWWDKVPSKWQGWGDNEWKAAGFRAVPGSIVRRSAFIGK 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EGSM+D W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 NVVLMPSFVNIGAYVDEGSMVDGWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N        +LYCAVI+K+VD KTRSKT IN LLRD
Sbjct: 244 SKN------NVNLYCAVIVKRVDAKTRSKTGINELLRD 275


>gi|126738614|ref|ZP_01754319.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseobacter sp. SK209-2-6]
 gi|126720413|gb|EBA17119.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseobacter sp. SK209-2-6]
          Length = 275

 Score =  363 bits (933), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 171/278 (61%), Positives = 219/278 (78%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++ + +   + ++A++ TL+ LD G +R+A + +NG W+ +QW KK
Sbjct: 4   AQLETAIEAAWEARDTISPATTGEQREAIEDTLNALDTGSLRVAEKLENGDWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N   +I   NG S+WWDK+P+K+  W   +++   FR +PG+IVR SAYI P
Sbjct: 64  AVLLSFRLNDMAMIEGSNGNSSWWDKVPSKWQGWGDNEWKAAGFRAVPGSIVRQSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EGSM+D W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNIGAYVDEGSMVDGWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S   K +I+   LYCAVI+K+VD KTRSKT IN LLRD
Sbjct: 244 S---KNNIS---LYCAVIVKRVDAKTRSKTGINELLRD 275


>gi|114769876|ref|ZP_01447486.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [alpha proteobacterium HTCC2255]
 gi|114549581|gb|EAU52463.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [alpha proteobacterium HTCC2255]
          Length = 274

 Score =  362 bits (928), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 174/278 (62%), Positives = 212/278 (76%), Gaps = 7/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           S LE  I++ ++  +  + +   + +DA+++TLD LD G +R+A   D+G W+ +QW KK
Sbjct: 4   SQLEIAIEAAWDNRDEISSNTVGEARDAIEATLDALDSGKLRVAEPQDSGQWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +I   G    TWWDK+ +KF  W   DF+   FR +P  IVR SAYI P
Sbjct: 64  AVLLGFRIQDMEIQEGGPQGGTWWDKVDSKFKGWGASDFQSAGFRAVPNCIVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVLMPSFVN+GA++GEG+M+DTW+TVGSCAQIG NVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GAVLMPSFVNLGAHVGEGTMVDTWATVGSCAQIGANVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI DR +GEITYGEVPS SVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIFDRESGEITYGEVPSGSVVVAGSLP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S        G +LYCAVI+KKVD KTRSKTSIN LLRD
Sbjct: 244 S-------KGVNLYCAVIVKKVDAKTRSKTSINELLRD 274


>gi|158421838|ref|YP_001523130.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Azorhizobium caulinodans ORS 571]
 gi|158328727|dbj|BAF86212.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Azorhizobium caulinodans ORS 571]
          Length = 288

 Score =  361 bits (926), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 168/277 (60%), Positives = 204/277 (73%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
            L++II   FE       S    +++AV   L LLD G  R+A    +G W  +QW+KKA
Sbjct: 12  ALQKIITDAFEARAEIGFSTAGQIREAVNEALALLDSGAARVAEPAADGSWQVNQWLKKA 71

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++N   +I  G G + WWDK+P+KF  W   +F    FR +PG IVR SAYI P 
Sbjct: 72  VLLSFRLNDMDLIPGGPGGAAWWDKVPSKFAKWGASEFRAAGFRAVPGAIVRQSAYIAPN 131

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPSFVN+GA++GEG+M+DTW+TVGSCAQIGK VH+SGGVGIGGVLEP+Q GP IIED
Sbjct: 132 VVLMPSFVNLGAHVGEGTMVDTWATVGSCAQIGKRVHLSGGVGIGGVLEPLQAGPVIIED 191

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           +CFIGARSE+VEG ++R+GSVL MGVFI  STKIIDR TGE+  GEVP+YSVVVPGS P 
Sbjct: 192 DCFIGARSEVVEGVVVRKGSVLSMGVFISASTKIIDRTTGEVFIGEVPAYSVVVPGSMPG 251

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
             L     GP LYCAVI+K+VDEKTR+KTSIN LLRD
Sbjct: 252 KPLPDGTPGPSLYCAVIVKRVDEKTRAKTSINDLLRD 288


>gi|39933703|ref|NP_945979.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodopseudomonas palustris CGA009]
 gi|192289060|ref|YP_001989665.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodopseudomonas palustris TIE-1]
 gi|71153304|sp|Q6NC47|DAPD_RHOPA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724187|sp|B3QCH6|DAPD_RHOPT RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|39647549|emb|CAE26070.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rhodopseudomonas palustris CGA009]
 gi|192282809|gb|ACE99189.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodopseudomonas palustris TIE-1]
          Length = 281

 Score =  359 bits (922), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 160/279 (57%), Positives = 211/279 (75%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++ LE  I++ F+  ++   +   +++ AV+  LDLLD+G +R+A RD +G W  +QW+K
Sbjct: 3   LTALESTINAAFDARDTVTAATQGEIRQAVEDALDLLDQGKVRVAQRDASGAWTVNQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N   +I+ G G + WWDK+P+KF+ W    F +  FR +PG IVR SA+I 
Sbjct: 63  KAVLLSFRLNDMGVIAGGPGGANWWDKVPSKFEGWGENRFREAGFRAVPGAIVRRSAFIA 122

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
             AVLMPSFVN+GAY+ E +M+DTW+TVGSCAQIGK VHISGG GIGGVLEP+Q GP II
Sbjct: 123 KNAVLMPSFVNLGAYVDESTMVDTWATVGSCAQIGKRVHISGGAGIGGVLEPLQAGPVII 182

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           ED+CFIGARSE+ EG I+R+G+VL MGVF+G STKI+DR TGE+  GEVP Y+V+VPG+ 
Sbjct: 183 EDDCFIGARSEVAEGVIVRKGAVLAMGVFLGASTKIVDRETGEVFVGEVPEYAVLVPGTL 242

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   +K    GP   CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 243 PGKPMKNGAPGPATACAVIVKRVDERTRSKTSINELLRD 281


>gi|154246588|ref|YP_001417546.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Xanthobacter autotrophicus Py2]
 gi|154160673|gb|ABS67889.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Xanthobacter autotrophicus Py2]
          Length = 285

 Score =  359 bits (921), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 169/279 (60%), Positives = 207/279 (74%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++ L  IID  FE+      S   +V+ AV   L LLD G  R+A +  +G W  +QW+K
Sbjct: 7   LADLSRIIDDAFEKRAEIGFSTTGEVRLAVDEALTLLDSGAARVAEKGADGTWTVNQWLK 66

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N  + I+ G G + WWDK+P+KF  W   DF    FR +PG IVR SA+I 
Sbjct: 67  KAVLLSFRLNDMEPIAGGPGGAHWWDKVPSKFATWGETDFRSAGFRAVPGAIVRRSAFIA 126

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P  VLMPSFVN+GA++GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GP II
Sbjct: 127 PNVVLMPSFVNLGAHVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPVII 186

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           ED+CFIGARSE+VEG ++R GSVL MGVFI  STKI+DR TGE+  GEVP+YSVVVPGS 
Sbjct: 187 EDDCFIGARSEVVEGVVVRTGSVLSMGVFISASTKIVDRETGEVFVGEVPAYSVVVPGSL 246

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   L     GP LYCAVI+K+VD +TRSKTSIN LLRD
Sbjct: 247 PGKPLPNGQPGPSLYCAVIVKRVDAQTRSKTSINDLLRD 285


>gi|316932094|ref|YP_004107076.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodopseudomonas palustris DX-1]
 gi|315599808|gb|ADU42343.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodopseudomonas palustris DX-1]
          Length = 281

 Score =  359 bits (921), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 162/279 (58%), Positives = 210/279 (75%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++ LE  I++ F+  ++   +   +V++AV   LDLLD+G +R+A RD +G W  +QW+K
Sbjct: 3   LTALESTINAAFDARDTVTPATQGEVREAVNDALDLLDQGKVRVAQRDASGAWTVNQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N   +I+ G G + WWDK+P+KF+ W    F +  FR +PG IVR SA+I 
Sbjct: 63  KAVLLSFRLNDMGVIAGGPGGANWWDKVPSKFEGWGENRFREAGFRAVPGAIVRRSAFIA 122

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
             AVLMPSFVN+GAY+ E +M+DTW+TVGSCAQIGK VHISGG GIGGVLEP+Q GP II
Sbjct: 123 KNAVLMPSFVNLGAYVDESTMVDTWATVGSCAQIGKRVHISGGAGIGGVLEPLQAGPVII 182

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           ED+CFIGARSE+ EG I+R+G+VL MGVF+G STKI+DR TGE   GEVP Y+V+VPG+ 
Sbjct: 183 EDDCFIGARSEVAEGVIVRKGAVLAMGVFLGASTKIVDRETGETFIGEVPEYAVLVPGTL 242

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   LK    GP   CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 243 PGKPLKNGAPGPATACAVIVKRVDERTRSKTSINELLRD 281


>gi|163738113|ref|ZP_02145529.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Phaeobacter gallaeciensis BS107]
 gi|163742494|ref|ZP_02149880.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Phaeobacter gallaeciensis 2.10]
 gi|161384079|gb|EDQ08462.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Phaeobacter gallaeciensis 2.10]
 gi|161388729|gb|EDQ13082.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Phaeobacter gallaeciensis BS107]
          Length = 275

 Score =  357 bits (916), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 168/278 (60%), Positives = 214/278 (76%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++   +   + +DA++ TL+ LD G +R+A R D+G+W+ +QW KK
Sbjct: 4   AQLETAIEAAWEARDTITSATTGEQRDAIEETLNALDSGKLRVAERQDSGNWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +  S G   S WWDK+ +KF  W   ++++  FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRIKDMEEQSGGPQGSGWWDKVDSKFKGWGEAEWKEAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAHVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 244 SKN------GINLYCAVIVKRVDERTRSKTGINELLRD 275


>gi|159042562|ref|YP_001531356.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Dinoroseobacter shibae DFL 12]
 gi|189082813|sp|A8LJS9|DAPD_DINSH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|157910322|gb|ABV91755.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Dinoroseobacter shibae DFL 12]
          Length = 275

 Score =  357 bits (915), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 168/278 (60%), Positives = 212/278 (76%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++ + +   + ++A++ TL+ LD G +R+A R  +G W+ +QW KK
Sbjct: 4   AQLETAIEAAWEARDTISPATTGETREAIEETLNALDSGALRVAERGADGSWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +  S G     WWDK+ +KF  W +  +EK  FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRIKDMEAQSGGPQGGGWWDKVDSKFLGWNSGAWEKAGFRAVPSCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 244 SKN------GVNLYCAVIVKRVDERTRSKTGINELLRD 275


>gi|110677597|ref|YP_680604.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Roseobacter denitrificans OCh 114]
 gi|123173062|sp|Q16DM5|DAPD_ROSDO RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|109453713|gb|ABG29918.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseobacter denitrificans OCh 114]
          Length = 275

 Score =  357 bits (915), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 171/278 (61%), Positives = 212/278 (76%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  +S + +     +DA+++TL  LD G +R+A R  +G+W+ +QW KK
Sbjct: 4   AELETAIEAAWEARDSISPATKGAERDAIEATLAALDGGGLRVAERQADGNWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   ++ S G     WWDK+ +KF  W   D++   FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRIKDMEMQSGGAQGGGWWDKVDSKFAGWGEADWKDAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE TYGEVP+ SVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRETGEFTYGEVPAGSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+KKVD +TRSKTSIN LLRD
Sbjct: 244 SKN------GVNLYCAVIVKKVDAQTRSKTSINELLRD 275


>gi|163733189|ref|ZP_02140633.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Roseobacter litoralis Och 149]
 gi|161393724|gb|EDQ18049.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Roseobacter litoralis Och 149]
          Length = 275

 Score =  356 bits (914), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 171/278 (61%), Positives = 211/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  +S   +     +DA+++TL  LD G +R+A R  +G+W+ +QW KK
Sbjct: 4   AELETAIEAAWEARDSITPATKGAQRDAIEATLAALDGGGLRVAERQSDGNWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   ++ S G     WWDK+ +KF  W   D++   FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRIKDMEMQSGGAQGGGWWDKVDSKFAGWGEADWKDAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VL+PSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLLPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE TYGEVPS SVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRETGEFTYGEVPSGSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+KKVD +TRSKTSIN LLRD
Sbjct: 244 SKN------GVNLYCAVIVKKVDAQTRSKTSINELLRD 275


>gi|92119155|ref|YP_578884.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Nitrobacter hamburgensis X14]
 gi|122416786|sp|Q1QH73|DAPD_NITHX RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|91802049|gb|ABE64424.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrobacter hamburgensis X14]
          Length = 281

 Score =  355 bits (912), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 163/279 (58%), Positives = 205/279 (73%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +++LE  I+  F+   +   +   +V++AV   LDLLD+G +R+A R  +G W  +QW+K
Sbjct: 3   LASLETTINGAFDARETVTAATKGEVREAVDHALDLLDKGEVRVAERAADGKWTVNQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N   +I  G G + WWDK+P+KF+ W    F    FR +PG IVR SAYI 
Sbjct: 63  KAVLLSFRLNDMSVIPGGPGKAVWWDKVPSKFEGWDENRFRDAGFRAVPGAIVRRSAYIA 122

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
             AVLMPSFVN+GAY+ E +M+DTW TVGSCAQIGK VHISGG GIGGVLEP+Q GP II
Sbjct: 123 KNAVLMPSFVNLGAYVDESTMVDTWCTVGSCAQIGKRVHISGGAGIGGVLEPLQAGPVII 182

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           ED+CFIGARSE+ EG I+R+G+VL MGVF+G STKI+DR TGEI  GEVP Y+VVVPG+ 
Sbjct: 183 EDDCFIGARSEVAEGVIVRKGAVLSMGVFLGASTKIVDRETGEIFMGEVPEYAVVVPGAL 242

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   LK    GP   CAVI+K+VDE+TRSKT IN LLRD
Sbjct: 243 PGKPLKNGQPGPSTACAVIVKRVDERTRSKTGINELLRD 281


>gi|259417955|ref|ZP_05741874.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Silicibacter sp. TrichCH4B]
 gi|259346861|gb|EEW58675.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Silicibacter sp. TrichCH4B]
          Length = 275

 Score =  355 bits (910), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 168/278 (60%), Positives = 211/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++   +   + +DA+++TL  LD G +R+A + D+G W+ +QW KK
Sbjct: 4   AQLETAIEAAWEARDTITPATKGETRDAIEATLAALDSGKLRVAEKQDSGDWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F++   +  S G   S WWDK+ +KF  W+  D++   FR +P  IVR SAYI P
Sbjct: 64  AVLLGFRLKDMEEQSGGPQGSGWWDKVDSKFKGWEASDWQSAGFRAVPNCIVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGK VH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKGVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+REGSVLGMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGVIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 244 SKN------GVNLYCAVIVKRVDEKTRSKTGINELLRD 275


>gi|83949867|ref|ZP_00958600.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseovarius nubinhibens ISM]
 gi|83837766|gb|EAP77062.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseovarius nubinhibens ISM]
          Length = 275

 Score =  353 bits (907), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 167/278 (60%), Positives = 211/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I+S ++  ++   +     ++A++ TL+ LD G +R+A R ++G W+ +QW KK
Sbjct: 4   AELETAIESAWDARDTITPATTGATREAIEETLNALDSGKLRVAERGEDGTWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   ++   G     WWDK+ +KF  W   D++   FR +P  +VR SA+I P
Sbjct: 64  AVLLGFRIKDMEVQDGGPQAGGWWDKVDSKFKGWGASDWKTAGFRAVPNCVVRKSAFIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGE+ YGEVPS SVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPSGSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VDEKTRSKTSIN LLRD
Sbjct: 244 SKN------GVNLYCAVIVKRVDEKTRSKTSINELLRD 275


>gi|254477125|ref|ZP_05090511.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ruegeria sp. R11]
 gi|214031368|gb|EEB72203.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ruegeria sp. R11]
          Length = 275

 Score =  353 bits (907), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 169/278 (60%), Positives = 211/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++   +   + +DA++ TL+ LD G +R+A + ++G W+ +QW KK
Sbjct: 4   AQLETAIEAAWEARDTITPATTGEQRDAIEETLNALDSGKLRVAEKLESGDWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +  S G   S WWDK+ +KF  W    ++   FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRIKDMEEQSGGPQGSGWWDKVDSKFKGWGDSQWKDAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRETGEVMYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 244 SKN------GINLYCAVIVKRVDEKTRSKTGINELLRD 275


>gi|161899026|ref|YP_615003.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Ruegeria sp. TM1040]
          Length = 275

 Score =  353 bits (907), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 167/278 (60%), Positives = 211/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++   +   + +DA+++TL  LD G +R+A + D+G W+ +QW KK
Sbjct: 4   AQLETAIEAAWEARDTITPATKGETRDAIEATLAALDSGKLRVAEKQDSGDWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F++   +  S G   S WWDK+ +KF  W+  D++   FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRLKDMEEQSGGPQGSGWWDKVDSKFKGWEAADWKTAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGK VH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKGVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+REGSVLGMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGVIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 244 SKN------GINLYCAVIVKRVDEKTRSKTGINELLRD 275


>gi|307943170|ref|ZP_07658515.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseibium sp. TrichSKD4]
 gi|307773966|gb|EFO33182.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseibium sp. TrichSKD4]
          Length = 282

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 178/283 (62%), Positives = 224/283 (79%), Gaps = 1/283 (0%)

Query: 1   MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           M   ++ LE++ID+ FE+  + +     +V+DAV +TL+LLDRG +R+A + D G+W  +
Sbjct: 1   MTHDLAQLEKVIDAAFEDRAAIDTHTTGEVRDAVDTTLNLLDRGQLRVAEKVD-GNWQVN 59

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW KKA+LLSF++N  ++I  G G +TWWDK+P+KFD W+  DFE   FR +P   VR S
Sbjct: 60  QWAKKAVLLSFRLNTMEVIKGGPGDATWWDKVPSKFDGWRGVDFENAGFRAVPNCTVRRS 119

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+IG  AVLMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q G
Sbjct: 120 AFIGKGAVLMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAG 179

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           P IIEDNCFIGARSE+VEG ++ EGSV+ MGVFIG+STKI+DR TG+I  G+VP YSVVV
Sbjct: 180 PVIIEDNCFIGARSEVVEGVVVGEGSVISMGVFIGQSTKIVDRQTGQIHVGKVPPYSVVV 239

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            GS P  NL G+  GP LYCAVI+K VDE+TRSKTSIN LLRD
Sbjct: 240 SGSLPGKNLPGENYGPSLYCAVIVKTVDEQTRSKTSINELLRD 282


>gi|99039129|gb|ABF65741.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ruegeria sp. TM1040]
          Length = 296

 Score =  353 bits (906), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 167/278 (60%), Positives = 211/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++   +   + +DA+++TL  LD G +R+A + D+G W+ +QW KK
Sbjct: 25  AQLETAIEAAWEARDTITPATKGETRDAIEATLAALDSGKLRVAEKQDSGDWHVNQWAKK 84

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F++   +  S G   S WWDK+ +KF  W+  D++   FR +P  +VR SAYI P
Sbjct: 85  AVLLGFRLKDMEEQSGGPQGSGWWDKVDSKFKGWEAADWKTAGFRAVPNCVVRKSAYIAP 144

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGK VH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 145 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKGVHLSGGVGIGGVLEPMQAGPTIIE 204

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+REGSVLGMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 205 DNCFIGARSEVVEGVIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAGSMP 264

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 265 SKN------GINLYCAVIVKRVDEKTRSKTGINELLRD 296


>gi|149204060|ref|ZP_01881028.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Roseovarius sp. TM1035]
 gi|149142502|gb|EDM30547.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Roseovarius sp. TM1035]
          Length = 275

 Score =  353 bits (905), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 165/278 (59%), Positives = 210/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++   +   + ++A+++TL  LD G +R+A R  +G W+ +QW KK
Sbjct: 4   AALESAIEAAWEARDTITSATGGETREAIEATLAALDSGSLRVAERQADGQWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +I + G   + WWDK+ +KF  W   ++ +  FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRIKDMEIHAGGPQGAGWWDKVDSKFKGWGDAEWREAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRETGEVMYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VD +TRSKT IN LLRD
Sbjct: 244 SKN------GINLYCAVIVKRVDAQTRSKTGINELLRD 275


>gi|83855371|ref|ZP_00948901.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sulfitobacter sp. NAS-14.1]
 gi|83941894|ref|ZP_00954356.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sulfitobacter sp. EE-36]
 gi|83843214|gb|EAP82381.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sulfitobacter sp. NAS-14.1]
 gi|83847714|gb|EAP85589.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sulfitobacter sp. EE-36]
          Length = 275

 Score =  352 bits (904), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 167/278 (60%), Positives = 211/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ ++  ++   +   + +DA++ TL  LD G +R+A + +NG W+ +QW KK
Sbjct: 4   AQLETAIEAAWDARDTITSATTGETRDAIEDTLAALDSGKLRVAEKMENGDWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +    G   S WWDK+ +KF  W   D+++  FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRIKDMEQQDGGPQGSGWWDKVDSKFKGWNDADWKEAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNIGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGV+IG+STKI+DR TGE+ YGEVP+ SVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVYIGQSTKILDRETGEVFYGEVPAGSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G HLYCAVI+K+VDEKTRSKTSIN LLRD
Sbjct: 244 SKN------GVHLYCAVIVKRVDEKTRSKTSINELLRD 275


>gi|83312972|ref|YP_423236.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Magnetospirillum magneticum AMB-1]
 gi|123540743|sp|Q2W0E8|DAPD_MAGSA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|82947813|dbj|BAE52677.1| Tetrahydrodipicolinate N-succinyltransferase [Magnetospirillum
           magneticum AMB-1]
          Length = 280

 Score =  352 bits (903), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 162/278 (58%), Positives = 208/278 (74%), Gaps = 1/278 (0%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE+ ID+ +E  +  N     +V+DAV++ LD LD G +R+A++ D+G W  +QW+KK
Sbjct: 4   AALEKTIDAAWEARDGINLQTKGEVRDAVEAALDALDSGSLRVAAKGDDGKWVVNQWLKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+++  K++ DG G +TW+DK+P KF+ W    F    FR +PG +VR SAYI P
Sbjct: 64  AVLLSFRLSDNKVMGDGPG-TTWFDKVPTKFEGWDDSRFRAAGFRAVPGAVVRRSAYIAP 122

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GA++G G+M+DTW+TVGSCAQIGKNVHISGG GIGGVLEP+Q GP IIE
Sbjct: 123 GVVLMPSFVNLGAHVGSGTMVDTWATVGSCAQIGKNVHISGGAGIGGVLEPLQAGPVIIE 182

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGAR+E+ EG I+  G+VL MGV+IG STKI+DR TGEI  G VP+YSVVV G+ P
Sbjct: 183 DNCFIGARAEVAEGVIVETGAVLSMGVYIGASTKIVDRETGEIFMGRVPAYSVVVSGTMP 242

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
                    GP LYCAVI+K+VDE+TRSK  IN LLRD
Sbjct: 243 GKPFPDGTPGPGLYCAVIVKRVDERTRSKVGINELLRD 280


>gi|254510407|ref|ZP_05122474.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacteraceae bacterium KLH11]
 gi|221534118|gb|EEE37106.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacteraceae bacterium KLH11]
          Length = 275

 Score =  352 bits (903), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 167/253 (66%), Positives = 198/253 (78%), Gaps = 6/253 (2%)

Query: 31  KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWD 90
           +DA++ TL+ LD G +R+A + DNG W+ +QW KKA+LL F+I   +I S G   S WWD
Sbjct: 29  RDAIEDTLNALDSGALRVAEKRDNGDWHVNQWAKKAVLLGFRIKDMEIQSGGPQGSGWWD 88

Query: 91  KIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWS 150
           K+ +KF  W+   +    FR +P  +VR SAYI P  VLMPSFVN+GAY+  G+M+DTW+
Sbjct: 89  KVDSKFAGWEASQWGAAGFRAVPNCVVRKSAYIAPGVVLMPSFVNLGAYVDAGTMVDTWA 148

Query: 151 TVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGM 210
           TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIEDNCFIGARSE+VEGCI+REGSVLGM
Sbjct: 149 TVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGM 208

Query: 211 GVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEK 270
           GVFIGKSTKI+DR TGE+TYGEVP YSVVV GS PS N         LYCAVI+K+VDEK
Sbjct: 209 GVFIGKSTKIVDRETGEVTYGEVPPYSVVVAGSMPSKN------NISLYCAVIVKRVDEK 262

Query: 271 TRSKTSINTLLRD 283
           TRSKT IN LLRD
Sbjct: 263 TRSKTGINELLRD 275


>gi|218681820|ref|ZP_03529561.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhizobium etli CIAT 894]
          Length = 255

 Score =  352 bits (903), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 157/246 (63%), Positives = 203/246 (82%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           T +++LE+ I++ F+  ++ + S   +V+DAV++ LDLLD G +R+A+R  +G W  +QW
Sbjct: 4   TDLASLEKTIEAAFDNRDNVSTSTKGEVRDAVEAALDLLDAGKVRVATRGADGAWTVNQW 63

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++N  +++  G+G STWWDK+P+KF++W    F    FR +P  +VR SAY
Sbjct: 64  LKKAVLLSFRLNDMEVVKGGSGNSTWWDKVPSKFENWGENQFRASGFRAVPNCVVRRSAY 123

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I P A+LMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPT
Sbjct: 124 IAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPT 183

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEGCIIREGSVLGMGV+IGKSTKI+DR TGE+TYGEVP YSVVV G
Sbjct: 184 IIEDNCFIGARSEVVEGCIIREGSVLGMGVYIGKSTKIVDRTTGEVTYGEVPPYSVVVAG 243

Query: 243 SYPSIN 248
           S PS N
Sbjct: 244 SMPSGN 249


>gi|114569005|ref|YP_755685.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Maricaulis maris MCS10]
 gi|122316771|sp|Q0ASJ0|DAPD_MARMM RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|114339467|gb|ABI64747.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Maricaulis maris MCS10]
          Length = 275

 Score =  352 bits (903), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 162/271 (59%), Positives = 210/271 (77%), Gaps = 5/271 (1%)

Query: 12  IDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSF 71
           ID+ ++  +S +     +V+DAV++ ++LLD G  R+ASR D+GHW  HQW+KKA+LL F
Sbjct: 10  IDTAWDNRDSVSTDTTGEVRDAVETAINLLDSGKARVASRGDDGHWVVHQWLKKAVLLGF 69

Query: 72  QINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMP 131
           ++NP  +I  G   + WWDK+P+KF+ W   +F+   FR +P   VR  A+I P AVLMP
Sbjct: 70  RLNPMDLIEGGIAGAKWWDKVPSKFEGWGEAEFKAAGFRAVPPCAVRRGAFIAPGAVLMP 129

Query: 132 SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIG 191
           S+VN+GAY+GEG+MIDTW++VGSCAQ+G N HIS G GIGGVLEP+Q  P IIEDNCFIG
Sbjct: 130 SYVNLGAYVGEGTMIDTWASVGSCAQVGANCHISAGTGIGGVLEPLQADPVIIEDNCFIG 189

Query: 192 ARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKG 251
           ARSE+VEG I+REGSVL MGV+I +STKI+DR +GEI+YGEVP+YSVVVPG+ P  + KG
Sbjct: 190 ARSEVVEGVIVREGSVLAMGVYITRSTKIVDRASGEISYGEVPAYSVVVPGALP--DPKG 247

Query: 252 DIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
              GP LYCAVI+K+VD +TR+KTSIN LLR
Sbjct: 248 ---GPSLYCAVIVKRVDAQTRAKTSINDLLR 275


>gi|86139445|ref|ZP_01058014.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseobacter sp. MED193]
 gi|85823948|gb|EAQ44154.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseobacter sp. MED193]
          Length = 275

 Score =  352 bits (902), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 166/278 (59%), Positives = 212/278 (76%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  +S   +   + ++A+++TL  LD G +R+A + D+G W+ +QW KK
Sbjct: 4   AQLETAIEAAWEARDSITPATTGEQREAIEATLQALDSGSLRVAQKLDSGDWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   ++ S G   S+WWDK+ +KF  W   ++++  FR +P  IVR SAY+ P
Sbjct: 64  AVLLGFRIKDMEMQSGGPQGSSWWDKVDSKFMGWGDAEWKEAGFRAVPNCIVRKSAYVAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGV+IGKSTKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVYIGKSTKIVDRETGEVMYGEVPPYSVVVSGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N         LYCAVI+K+VD +TRSKT IN LLRD
Sbjct: 244 SKN------NVSLYCAVIVKRVDAQTRSKTGINELLRD 275


>gi|254293240|ref|YP_003059263.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Hirschia baltica ATCC 49814]
 gi|254041771|gb|ACT58566.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Hirschia baltica ATCC 49814]
          Length = 277

 Score =  352 bits (902), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 163/282 (57%), Positives = 210/282 (74%), Gaps = 5/282 (1%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T +S LE  I+S ++  ++ + +   D++DAV   L L D+GI+R A  D NG W  ++
Sbjct: 1   MTDISALELAINSAWDARDTVSTATQGDIRDAVTEALLLTDQGILRAAEPDGNGGWKANE 60

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+LLSF++NP +II  G G +TW+DK+P+KFD W   ++++  FR +P   VR  +
Sbjct: 61  WVKKAVLLSFRLNPNEIIKGGPGEATWFDKVPSKFDGWGEAEYKEAGFRAVPNCTVRRGS 120

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           ++   AVLMPSF+N+GAY+ EG+M+DTW+TVGSCAQIGKNVHISGG GIGGVLEP+Q  P
Sbjct: 121 FVAKNAVLMPSFINIGAYVDEGTMVDTWATVGSCAQIGKNVHISGGAGIGGVLEPLQATP 180

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
            IIEDNCFIGAR+E+ EG IIREGSVL MG FI +STKI+DR TGE TYGEVP YSVVVP
Sbjct: 181 VIIEDNCFIGARAEVAEGVIIREGSVLAMGTFISQSTKIVDRATGEFTYGEVPPYSVVVP 240

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           G+ P+ N      GP L C VI+K VD KTRSKT +N LLRD
Sbjct: 241 GAMPAAN-----GGPSLACVVIVKTVDAKTRSKTGVNELLRD 277


>gi|149913271|ref|ZP_01901805.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseobacter sp. AzwK-3b]
 gi|149813677|gb|EDM73503.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseobacter sp. AzwK-3b]
          Length = 275

 Score =  351 bits (901), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 165/278 (59%), Positives = 210/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE+ I++ +E  +    S   + ++A+++TL  LD G +R+A R DNG W+ +QW KK
Sbjct: 4   AQLEQAIEAAWEVRDQITSSTGGETREAIEATLSALDSGKLRVAERQDNGDWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   ++   G     WWDK+ +KF  W   D++   FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRIKDMEMQDGGPQGGGWWDKVDSKFKGWGETDWKAAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GA++GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAHVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGV+IG+STKI+DR TGE+  GEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVYIGQSTKIVDRETGEVFMGEVPPYSVVVSGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           + N        +LYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 244 TKN------NLNLYCAVIVKRVDERTRSKTGINELLRD 275


>gi|294675800|ref|YP_003576415.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacter capsulatus SB 1003]
 gi|294474620|gb|ADE84008.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacter capsulatus SB 1003]
          Length = 275

 Score =  351 bits (901), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 166/278 (59%), Positives = 214/278 (76%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++       + +DA+++TL+ LD+G++R+A +  +G+W+ +QW KK
Sbjct: 4   AMLEAAIEAAWEVRDTLTPHTKGEARDAIEATLEALDKGVLRVAEKQADGNWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F++   ++ S G    TWWDK+ +KF  W    ++   FR +P  IVR SAYI  
Sbjct: 64  AVLLGFRLKDMEVHSGGPQNGTWWDKVDSKFAHWGEAQWKAAGFRAVPHCIVRRSAYIAK 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVL+PSFVN+GAY+ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GAVLLPSFVNLGAYVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRETGEVFYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           +   KG I   +LYCAVI+K+VD +TRSKT+IN LLRD
Sbjct: 244 T---KGGI---NLYCAVIVKRVDAQTRSKTAINDLLRD 275


>gi|83859289|ref|ZP_00952810.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Oceanicaulis alexandrii HTCC2633]
 gi|83852736|gb|EAP90589.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Oceanicaulis alexandrii HTCC2633]
          Length = 276

 Score =  351 bits (900), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 160/277 (57%), Positives = 208/277 (75%), Gaps = 5/277 (1%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
            L+ +ID+ +++ +        DV+DAV + L+LLD G  R+ASRD++G W  H+W+KKA
Sbjct: 5   ALKSVIDAAWDDRDQLTTQTQGDVRDAVNAALNLLDSGEARVASRDESGQWVVHEWLKKA 64

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++NP +II  G  +  WWDK+ +KF+ W   +F++  FR +P   VR  A+IG  
Sbjct: 65  VLLSFRLNPNRIIPGGADHGPWWDKVASKFEGWDAAEFQEAGFRAVPPAAVRRGAFIGKG 124

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVHISGG GIGGVLEP+Q  P IIED
Sbjct: 125 VVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHISGGAGIGGVLEPLQANPVIIED 184

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGAR+E+ EG I+REG+VL MGV++  STKI+DR TGEI  GEVP Y+VVVPG    
Sbjct: 185 NCFIGARAEVAEGVIVREGAVLAMGVYLSGSTKIVDRETGEIFRGEVPPYAVVVPG---- 240

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            NL G+   P LYCAVI+K+VD +TR+KTSIN LLRD
Sbjct: 241 -NLPGEAGKPGLYCAVIVKRVDAQTRAKTSINALLRD 276


>gi|170739692|ref|YP_001768347.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacterium sp. 4-46]
 gi|226724180|sp|B0UJH5|DAPD_METS4 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|168193966|gb|ACA15913.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacterium sp. 4-46]
          Length = 281

 Score =  350 bits (899), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 203/278 (73%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + L   I++ +E+      +    V++AV++ L LLD G +R+A +  N  W  +QW+KK
Sbjct: 4   ADLARTIEAAWEDRADVTAATQGPVREAVEAALALLDSGQVRVAEKSGNADWQVNQWLKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++   ++IS   G + WWDK+P+KFD W  + F +  FR +PG IVR SA+I P
Sbjct: 64  AVLLSFRLTDMELISGAPGGAAWWDKVPSKFDGWDAERFRQAGFRAVPGAIVRRSAFIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVLMPSFVN+GA++GEG+M+DTW+TVGSCAQIGKN HISGG GIGGVLEP+Q  P IIE
Sbjct: 124 GAVLMPSFVNLGAHVGEGTMVDTWATVGSCAQIGKNCHISGGAGIGGVLEPLQANPVIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGAR+E+ EG I+ EGSVL MGV++G STKI+DR TGE+ YG VP YSVVV GS P
Sbjct: 184 DNCFIGARAEVAEGVIVGEGSVLSMGVYLGASTKIVDRATGEVVYGRVPPYSVVVSGSLP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              L     GP LYCAVI+K+VD  TR+KT IN LLRD
Sbjct: 244 GKALPDGAPGPALYCAVIVKRVDAGTRAKTGINELLRD 281


>gi|260432268|ref|ZP_05786239.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416096|gb|EEX09355.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 275

 Score =  350 bits (899), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 167/278 (60%), Positives = 209/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++   +   + ++A++ TL+ LD G +R+A +  +G W+ +QW KK
Sbjct: 4   AQLETAIEAAWEARDTITPATTGEQREAIEDTLNALDSGTLRVAEKQADGSWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +I S G     WWDK+ +KF  W    +    FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRIKDMEIQSGGPQGGGWWDKVDSKFAGWGENQWRAAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCIIREGSVLGMGV+IG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIIREGSVLGMGVYIGQSTKIVDRETGEVFYGEVPPYSVVVSGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 244 SKN------GINLYCAVIVKRVDEKTRSKTGINELLRD 275


>gi|254460218|ref|ZP_05073634.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacterales bacterium HTCC2083]
 gi|206676807|gb|EDZ41294.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 275

 Score =  350 bits (898), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 166/278 (59%), Positives = 212/278 (76%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++   +   + ++A++ TL+ LD G +R+A +  +G+W+ +QW KK
Sbjct: 4   AQLETAIEAAWEARDTITPATTGEQREAIEDTLNALDSGKLRVAEKQADGNWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +    G   + WWDK+ +KF  W  K ++   FR +P  IVR SA+I P
Sbjct: 64  AVLLGFRIKDMEQQEGGPQGAGWWDKVDSKFKGWGDKQWKAAGFRAVPNCIVRKSAFIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GAVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGE TYGEVP+ SVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEFTYGEVPAGSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VD +TRSKTSIN LLRD
Sbjct: 244 SKN------GVNLYCAVIVKRVDAQTRSKTSINELLRD 275


>gi|27383215|ref|NP_774744.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Bradyrhizobium japonicum USDA 110]
 gi|71153273|sp|Q89BP4|DAPD_BRAJA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|27356389|dbj|BAC53369.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bradyrhizobium japonicum USDA 110]
          Length = 281

 Score =  350 bits (898), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 161/279 (57%), Positives = 206/279 (73%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S LE  I+S F+  +  + S   +V++AV   L+ LD+G  R+A R  +G W  +QW+K
Sbjct: 3   LSALESTINSAFDARDGISTSTKGEVREAVDQVLETLDKGEARVAERGADGKWKVNQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N   +I  G G +TWWDK+P+KF+ W    F    FR +PG +VR SA+I 
Sbjct: 63  KAVLLSFRLNDMGVIPGGPGQATWWDKVPSKFEGWGENRFRDAGFRAVPGAVVRRSAFIA 122

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GAY+ E +M+DTW+TVGSCAQIGK VHISGG GIGGVLEP+Q  P II
Sbjct: 123 KNVVLMPSFVNLGAYVDESTMVDTWATVGSCAQIGKRVHISGGAGIGGVLEPLQAEPVII 182

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           ED+CFIGARSE+ EG I+R+G+VL MGVF+G STKI+DR+TGE+  GEVP YSVVVPG+ 
Sbjct: 183 EDDCFIGARSEVAEGVIVRKGAVLAMGVFLGASTKIVDRDTGEVFIGEVPEYSVVVPGAL 242

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   +K    GP   CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 243 PGKPMKNGHIGPSTACAVIVKRVDERTRSKTSINELLRD 281


>gi|315498741|ref|YP_004087545.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n-succinyltransferase
           [Asticcacaulis excentricus CB 48]
 gi|315416753|gb|ADU13394.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Asticcacaulis excentricus CB 48]
          Length = 286

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 168/285 (58%), Positives = 217/285 (76%), Gaps = 8/285 (2%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++   + I++ +E  ++ + S    V+DAV+  L L+D G  R++ + D G W THQW+K
Sbjct: 4   LAAFHDDIEAAWEIRDTLSPSTTGPVRDAVEKALGLIDNGRFRVSEKID-GEWVTHQWLK 62

Query: 65  KAILLSFQINPTKIISDGN------GYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVR 118
           KA+LLSF++N  +I+  G+          +WDK+P KF  WK +D++   FR +PG IVR
Sbjct: 63  KAVLLSFRLNGNQIMQAGHTVFDKAAIGPFWDKVPNKFAKWKAEDYQDAGFRSVPGAIVR 122

Query: 119 HSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQ 178
           H A++G   VLMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q
Sbjct: 123 HGAFVGKNVVLMPSFVNIGAYVGEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPLQ 182

Query: 179 TGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSV 238
             PTIIEDNCFIGARSE+VEG I+REGSVLGMGV++G+ST+I+DR TGE+ YGEVP YSV
Sbjct: 183 ANPTIIEDNCFIGARSEVVEGVIVREGSVLGMGVYLGQSTRIVDRATGEVFYGEVPPYSV 242

Query: 239 VVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           VV GS PS N K   A PHLYCAVI+K+VD +TRSKT IN LLRD
Sbjct: 243 VVAGSMPSSNDKNPNA-PHLYCAVIVKRVDAQTRSKTGINELLRD 286


>gi|85705311|ref|ZP_01036410.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseovarius sp. 217]
 gi|85670184|gb|EAQ25046.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseovarius sp. 217]
          Length = 275

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 164/278 (58%), Positives = 208/278 (74%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++   +   + ++A++ TL+ LD G +R+A R  +G W+ +QW KK
Sbjct: 4   AALETAIEAAWEARDTITPATGGETREAIEETLNALDSGALRVAERQADGQWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +I + G   + WWDK+ +KF  W   ++    FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRIKDMEIHAGGPQGAGWWDKVDSKFKGWGDAEWRDAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TG + YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRETGAVMYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VD +TRSKT IN LLRD
Sbjct: 244 SKN------GINLYCAVIVKRVDAQTRSKTGINELLRD 275


>gi|254488481|ref|ZP_05101686.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseobacter sp. GAI101]
 gi|214045350|gb|EEB85988.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseobacter sp. GAI101]
          Length = 305

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 165/278 (59%), Positives = 213/278 (76%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++   +   + +DA+++TL  LD G +R+A + ++G W+ +QW KK
Sbjct: 34  AQLETAIEAAWEARDTITSATTGETRDAIEATLAALDSGKLRVAEKTESGDWHVNQWAKK 93

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +  + G   + WWDK+ +KF  W   +++   FR +P  +VR SAYI P
Sbjct: 94  AVLLGFRIKDMEHQTGGPQGAGWWDKVDSKFKGWGDDEWKTAGFRAVPNCVVRKSAYIAP 153

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 154 GVVLMPSFVNIGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 213

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR+TGE+ YGEVP+ SVVV GS P
Sbjct: 214 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKILDRDTGEVMYGEVPAGSVVVAGSMP 273

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VDEKTRSKTSIN LLRD
Sbjct: 274 SKN------GVNLYCAVIVKRVDEKTRSKTSINELLRD 305


>gi|260576610|ref|ZP_05844598.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacter sp. SW2]
 gi|259021214|gb|EEW24522.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacter sp. SW2]
          Length = 274

 Score =  349 bits (896), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 169/268 (63%), Positives = 208/268 (77%), Gaps = 7/268 (2%)

Query: 16  FEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINP 75
           +E  ++ + +     ++A+++TL  LD G +R+A +     W+ +QW KKA+LLSF++N 
Sbjct: 14  WEGRDAISPATKGAAREAIEATLAALDSGSLRVAEKR-GADWHVNQWAKKAVLLSFRLND 72

Query: 76  TKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVN 135
              IS GNG S WWDK+P+KF  W   D+ K   R +PG+IVR SAYI    VLMPSFVN
Sbjct: 73  MAEISGGNGGSNWWDKVPSKFQGWSAADWRKSGIRAVPGSIVRRSAYISKGVVLMPSFVN 132

Query: 136 MGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSE 195
           +GAY+GEGSM+D WSTVGSCAQIG+NVH+SGGVGIGGVLEP+Q GPTIIED+CFIGARSE
Sbjct: 133 VGAYVGEGSMVDGWSTVGSCAQIGRNVHLSGGVGIGGVLEPMQAGPTIIEDDCFIGARSE 192

Query: 196 IVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAG 255
           +VEGCI+REGSVLGMGVFIG+STKI+DR TG + YGEVP+ SVVV GS PS   KG I+ 
Sbjct: 193 VVEGCIVREGSVLGMGVFIGQSTKIVDRETGAVMYGEVPAGSVVVAGSMPS---KGGIS- 248

Query: 256 PHLYCAVIIKKVDEKTRSKTSINTLLRD 283
             LYCAVI+KKVD KTR+KTSIN LLRD
Sbjct: 249 --LYCAVIVKKVDAKTRAKTSINELLRD 274


>gi|254465215|ref|ZP_05078626.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacterales bacterium Y4I]
 gi|206686123|gb|EDZ46605.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacterales bacterium Y4I]
          Length = 275

 Score =  348 bits (894), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 166/253 (65%), Positives = 197/253 (77%), Gaps = 6/253 (2%)

Query: 31  KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWD 90
           +DA++ TL+ LD G +R+A +  NG W+ +QW KKA+LL F+I   +I   G     WWD
Sbjct: 29  RDAIEDTLNALDSGKLRVAEKLANGDWHVNQWAKKAVLLGFRIKDMEIHEGGPQAGGWWD 88

Query: 91  KIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWS 150
           K+ +KF  W   D++   FR +P  +VR SAYI P AVLMPSFVN+GAY+ EG+M+DTW+
Sbjct: 89  KVDSKFAGWGEADWKSAGFRAVPNCVVRKSAYIAPGAVLMPSFVNLGAYVDEGTMVDTWA 148

Query: 151 TVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGM 210
           TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIEDNCFIGARSE+VEGCI+REGSVLGM
Sbjct: 149 TVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGM 208

Query: 211 GVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEK 270
           GVFIGKSTKI+DR TGE+ YGEVP YSVVV GS PS N         LYCAVI+K+VDEK
Sbjct: 209 GVFIGKSTKIVDRETGEVMYGEVPPYSVVVAGSMPSKN------NISLYCAVIVKRVDEK 262

Query: 271 TRSKTSINTLLRD 283
           TRSKT IN LLRD
Sbjct: 263 TRSKTGINELLRD 275


>gi|23014945|ref|ZP_00054738.1| COG2171: Tetrahydrodipicolinate N-succinyltransferase
           [Magnetospirillum magnetotacticum MS-1]
          Length = 279

 Score =  348 bits (892), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 161/278 (57%), Positives = 206/278 (74%), Gaps = 2/278 (0%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE+ ID+ +E  +  N     +V+DAV++ LD LD G +R+A++  +G W  +QW+KK
Sbjct: 4   AALEKTIDAAWEARDGINLQTKGEVRDAVEAALDALDDGKLRVAAKGADGKWVVNQWLKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N  K++  G G STW+DK+P KF+ W    F    FR +PG +VR SAYI P
Sbjct: 64  AVLLSFRLNDNKVM--GEGPSTWFDKVPTKFEGWDDSRFRAAGFRAVPGAVVRRSAYIAP 121

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GA++  G+M+DTW+TVGSCAQIGKNVHISGG GIGGVLEP+Q GP IIE
Sbjct: 122 GVVLMPSFVNLGAHVDSGTMVDTWATVGSCAQIGKNVHISGGAGIGGVLEPLQAGPVIIE 181

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGAR+E+ EG I+  G+VL MGV+IG STKI+DR TGE+  G VP+YSVVV G+ P
Sbjct: 182 DNCFIGARAEVAEGVIVETGAVLSMGVYIGASTKIVDRETGEVFMGRVPAYSVVVSGTMP 241

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              L     GP LYCAVI+K+VDE+TRSK  IN LLRD
Sbjct: 242 GKALPDGTPGPGLYCAVIVKRVDERTRSKVGINELLRD 279


>gi|254421025|ref|ZP_05034749.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brevundimonas sp. BAL3]
 gi|196187202|gb|EDX82178.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brevundimonas sp. BAL3]
          Length = 285

 Score =  348 bits (892), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 165/290 (56%), Positives = 214/290 (73%), Gaps = 13/290 (4%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T +S LE +I++ +E+    + +   DV+DAV++ L LLD G  R+ASR ++G W THQ
Sbjct: 1   MTDLSHLESVIEAAWEDRADVSAATHGDVRDAVETALALLDAGQARVASRGEDGVWTTHQ 60

Query: 62  WIKKAILLSFQINPTKIISDGN--------GYSTWWDKIPAKFDDWKTKDFEKHNFRIIP 113
           W+KKA+LLSF++N  +I+  G+        G   +WDK+P KF DW   D++   FR +P
Sbjct: 61  WLKKAVLLSFRLNDNQIMRAGDRGPTSHAPGVGPYWDKVPNKFGDWAAGDYQAAGFRSVP 120

Query: 114 GTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGV 173
           G IVR  AYI    VLMPSFVN+GAY+ EG+M+D W+TVGSCAQIGKNVH+SGG GIGGV
Sbjct: 121 GAIVRQGAYIARNVVLMPSFVNIGAYVDEGAMVDAWATVGSCAQIGKNVHLSGGAGIGGV 180

Query: 174 LEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEV 233
           LEP+Q  PTIIED CFIGAR+E+ EG I+REG+VL MGV++  STKI+DR TGEI  GEV
Sbjct: 181 LEPLQANPTIIEDGCFIGARAEVAEGVIVREGAVLAMGVYLSGSTKIVDRATGEIFRGEV 240

Query: 234 PSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P+YSVVVPG+ P  + KG   GP LYCAVI+K+VD +TR+KT +N LLRD
Sbjct: 241 PAYSVVVPGALP--DPKG---GPSLYCAVIVKRVDAQTRAKTGVNELLRD 285


>gi|299132598|ref|ZP_07025793.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Afipia sp. 1NLS2]
 gi|298592735|gb|EFI52935.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Afipia sp. 1NLS2]
          Length = 281

 Score =  348 bits (892), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 173/279 (62%), Positives = 215/279 (77%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S LE  +++ F+  ++ N S   +V+DAV+  LD+LD+G  R+A    NG W  +QW+K
Sbjct: 3   LSALETTLNTAFDARDTVNASTKGEVRDAVELALDMLDKGEARVAEPQANGAWKVNQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N    I  G G + WWDK+P+KF+D+  + F +  FR +PG IVR SA+IG
Sbjct: 63  KAVLLSFRLNDMAPIPGGPGGAHWWDKVPSKFEDYSEQSFREAGFRAVPGAIVRRSAFIG 122

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GAY+ E +MIDTWSTVGSCAQIGK+VHISGGVGIGGVLEP+Q GP II
Sbjct: 123 KNVVLMPSFVNLGAYVDEATMIDTWSTVGSCAQIGKHVHISGGVGIGGVLEPLQAGPVII 182

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           ED+CFIGARSE+ EG I+R+G+VL MGVFIG STKIIDR TGE+  GEVP+YSVVVPGS 
Sbjct: 183 EDDCFIGARSEVAEGVIVRKGAVLSMGVFIGASTKIIDRTTGEVFVGEVPAYSVVVPGSL 242

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   +K    GP LYCAVI+K+VDEKTRSKTSIN LLRD
Sbjct: 243 PGKPMKDGTPGPSLYCAVIVKRVDEKTRSKTSINELLRD 281


>gi|119385241|ref|YP_916297.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Paracoccus denitrificans PD1222]
 gi|166224217|sp|A1B507|DAPD_PARDP RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|119375008|gb|ABL70601.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Paracoccus denitrificans PD1222]
          Length = 274

 Score =  347 bits (890), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 166/277 (59%), Positives = 210/277 (75%), Gaps = 7/277 (2%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
            LE  I+S +E  +    +   +V+DAV++TL+ LD+G++R+A +  +  W+ +QW KKA
Sbjct: 5   ALEAAIESAWEIRDQITPATRGEVRDAVEATLEALDKGVLRVAEKRGS-DWHVNQWAKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LL F++   ++   G    TWWDK+ +KF  W    ++   FR +P  +VR SAYI   
Sbjct: 64  VLLGFRLKDMEVHMGGPQGGTWWDKVDSKFAHWGEAQWQAAGFRAVPNCVVRRSAYIAKG 123

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIED
Sbjct: 124 VVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIED 183

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEGCI+REGSVLGMGVFIGKSTKI+DR TGE+ YGEVP+ SVVV GS PS
Sbjct: 184 NCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRETGEVMYGEVPAGSVVVAGSMPS 243

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            N      G +LYCAVI+K+VD +TRSKTSIN LLRD
Sbjct: 244 KN------GVNLYCAVIVKRVDAQTRSKTSINELLRD 274


>gi|302384401|ref|YP_003820224.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302195029|gb|ADL02601.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 285

 Score =  347 bits (889), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 163/290 (56%), Positives = 212/290 (73%), Gaps = 13/290 (4%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T  + LE  I+S +E       +   + + AV++ + +LD G  R+ASR ++G W THQ
Sbjct: 1   MTDPAALEAAIESAWEARTELTPATGGETRKAVETAIAMLDSGQARVASRGEDGTWTTHQ 60

Query: 62  WIKKAILLSFQINPTKIISDGN--------GYSTWWDKIPAKFDDWKTKDFEKHNFRIIP 113
           W+KKA+LLSF++N  +I+  G+        G   W+DK+P KF DW   DF +  FR +P
Sbjct: 61  WLKKAVLLSFRLNDNEIMRGGDRGLSSPAPGVGPWYDKVPNKFGDWTGNDFREAGFRAVP 120

Query: 114 GTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGV 173
           G+IVR  A++G   VLMPSFVN+GAY+ +GSM+D W+TVGSCAQIGKNVH+SGGVGIGGV
Sbjct: 121 GSIVRKGAFVGRNVVLMPSFVNIGAYVDDGSMVDGWATVGSCAQIGKNVHLSGGVGIGGV 180

Query: 174 LEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEV 233
           LEP+Q  PTIIEDNCFIGARSE+VEG I+REG+VL MGV+I  STKI+DR TGE+  GEV
Sbjct: 181 LEPLQANPTIIEDNCFIGARSEVVEGVIVREGAVLAMGVYISSSTKIVDRATGEVLRGEV 240

Query: 234 PSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P+YSVVVPG+ P  N      GP LYCAVI+K+VD +TR+KT++N LLRD
Sbjct: 241 PAYSVVVPGALPDPN-----GGPSLYCAVIVKRVDAQTRAKTAVNELLRD 285


>gi|75677248|ref|YP_319669.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Nitrobacter winogradskyi Nb-255]
 gi|123612578|sp|Q3SN24|DAPD_NITWN RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|74422118|gb|ABA06317.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrobacter winogradskyi Nb-255]
          Length = 281

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 160/278 (57%), Positives = 200/278 (71%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           ++LE  I+  F+   +   +   +V+DAV   L LLD+G  R+A R  +G W  +QW+KK
Sbjct: 4   ASLETTINGAFDARETITPATRGEVRDAVDQALGLLDKGEARVAERAADGKWQVNQWLKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N   +I  G G + WWDK+P+KF+ W    F    FR +PG IVR SA+I  
Sbjct: 64  AVLLSFRLNDMSVIPGGPGNAAWWDKVPSKFEGWDENRFRDAGFRAVPGAIVRRSAFIAR 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ E +M+DTW TVGSCAQIGK VHISGG GIGGVLEP+Q GP IIE
Sbjct: 124 NVVLMPSFVNLGAYVDESTMVDTWCTVGSCAQIGKRVHISGGAGIGGVLEPLQAGPVIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D+CFIGARSE+ EG I+R+G+VL MGVF+G STKI+DR TGEI  GEVP Y+VVVPG+ P
Sbjct: 184 DDCFIGARSEVAEGVIVRKGAVLSMGVFLGASTKIVDRTTGEIFMGEVPEYAVVVPGALP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              L     GP   CAVI+K+VDE+TRSKT IN LLRD
Sbjct: 244 GKPLSNGQLGPSTACAVIVKRVDERTRSKTGINELLRD 281


>gi|126724396|ref|ZP_01740239.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacterales bacterium HTCC2150]
 gi|126705560|gb|EBA04650.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacterales bacterium HTCC2150]
          Length = 275

 Score =  346 bits (887), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 166/278 (59%), Positives = 207/278 (74%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E   + + +   + ++A+  TL+ LD G +R+A    +G+W+ +QW KK
Sbjct: 4   AALETAIEAAWEARETISPATTGEQREAIDDTLNALDSGKLRVAEPRPDGNWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F++   +I   G    TWWDK+  KF  W    F +  FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRVKDMEIHGGGAQDGTWWDKVDNKFKGWGDNQFSEAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNIGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGE+ YGEVPS SVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPSGSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+KKVD +TRSKTSIN LLRD
Sbjct: 244 SKN------GVNLYCAVIVKKVDARTRSKTSINELLRD 275


>gi|310817042|ref|YP_003965006.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ketogulonicigenium vulgare Y25]
 gi|308755777|gb|ADO43706.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ketogulonicigenium vulgare Y25]
          Length = 275

 Score =  345 bits (886), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 164/252 (65%), Positives = 198/252 (78%), Gaps = 6/252 (2%)

Query: 32  DAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDK 91
           DA+++TL+ LD+G +R+A R  NG W+ +QW KKA+LL F+I   +I   G    TWWDK
Sbjct: 30  DAIEATLEALDKGKLRVAERQANGDWHVNQWAKKAVLLGFRIKDMEIHDGGPQGGTWWDK 89

Query: 92  IPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWST 151
           + +KF  W   D+ +  FR +P  +VR SAY+ P AVLMPSFVN+GAY+ EG+M+DTW T
Sbjct: 90  VDSKFKGWGEADWREAGFRAVPNCVVRRSAYVAPGAVLMPSFVNLGAYVDEGTMVDTWVT 149

Query: 152 VGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMG 211
           VGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIEDNCFIGARSEIVEG I+REGSV+ MG
Sbjct: 150 VGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEIVEGVIVREGSVISMG 209

Query: 212 VFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKT 271
           VFIGKSTKI++R+TGE+TYGEVP YSVVV GS PS N      G +LYCAVI+K+VD KT
Sbjct: 210 VFIGKSTKIVNRDTGEVTYGEVPPYSVVVSGSMPSKN------GVNLYCAVIVKQVDAKT 263

Query: 272 RSKTSINTLLRD 283
           RS T IN LLRD
Sbjct: 264 RSSTGINELLRD 275


>gi|89052840|ref|YP_508291.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Jannaschia sp. CCS1]
 gi|122499703|sp|Q28VJ6|DAPD_JANSC RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|88862389|gb|ABD53266.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Jannaschia sp. CCS1]
          Length = 275

 Score =  344 bits (883), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 161/278 (57%), Positives = 209/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++   +   + ++A++ TL  LD G +R+A + D+G W+ +QW KK
Sbjct: 4   AQLETAIEAAWEARDTITPATMGETREAIEDTLAALDGGTLRVAEKQDSGDWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F++   ++        +WWDK+ +K+  W   ++    FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRLKDMEMQGGSAQGGSWWDKVDSKWATWGDNEWGAAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TG++ YGEVPS SVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGDVMYGEVPSGSVVVAGSLP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 244 SKN------GVNLYCAVIVKRVDERTRSKTSINELLRD 275


>gi|91974557|ref|YP_567216.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodopseudomonas palustris BisB5]
 gi|123722272|sp|Q13F24|DAPD_RHOPS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|91681013|gb|ABE37315.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodopseudomonas palustris BisB5]
          Length = 281

 Score =  344 bits (882), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 168/279 (60%), Positives = 211/279 (75%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S LE  I++ F+  ++ + +   +V+DAV   LDLLDRG  R+A RD +G W  +QW+K
Sbjct: 3   LSALENTINTAFDARDTISAATKGEVRDAVDQALDLLDRGEARVAERDASGTWTVNQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N    I+ G G +TWWDK+P+KF+ W    F +  FR +PG IVR SA+I 
Sbjct: 63  KAVLLSFRLNDMHTIAGGPGGATWWDKVPSKFEGWGESRFREAGFRAVPGAIVRRSAFIA 122

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
             AVLMPSFVN+GAY+ E +M+DTWSTVGSCAQIGK VHISGGVGIGGVLEP+Q GP II
Sbjct: 123 KNAVLMPSFVNLGAYVDEATMVDTWSTVGSCAQIGKRVHISGGVGIGGVLEPLQAGPVII 182

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           ED+CFIGARSE+ EG I+R G+VL MGVF+G STKI+DR TGE+  GEVP Y+V+VPG+ 
Sbjct: 183 EDDCFIGARSEVAEGVIVRRGAVLAMGVFLGASTKIVDRETGEVFIGEVPEYAVLVPGAL 242

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   LK    GP   CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 243 PGKPLKNGTPGPSTACAVIVKRVDERTRSKTSINELLRD 281


>gi|163744979|ref|ZP_02152339.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Oceanibulbus indolifex HEL-45]
 gi|161381797|gb|EDQ06206.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Oceanibulbus indolifex HEL-45]
          Length = 275

 Score =  344 bits (882), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 162/278 (58%), Positives = 209/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ ++  +    +   + +DA++ TL+ LD G +R+A + ++G+W  +QW KK
Sbjct: 4   AQLETAIEAAWDTRDQITSATTGETRDAIEETLNALDSGKLRVAEKQEDGNWKVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +    G   + WWDK+ +KF  W   ++++  FR +P  +VR SA+I P
Sbjct: 64  AVLLGFRIKDMEHQEGGPQGAGWWDKVDSKFKGWGDAEWKEAGFRAVPNCVVRRSAFIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNIGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGEI YGEVP+ SVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRATGEIMYGEVPAGSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N        +LYCAVI+K+VD KTRSKTSIN LLRD
Sbjct: 244 SKN------NVNLYCAVIVKRVDAKTRSKTSINELLRD 275


>gi|85717147|ref|ZP_01048106.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Nitrobacter sp. Nb-311A]
 gi|85696038|gb|EAQ33937.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Nitrobacter sp. Nb-311A]
          Length = 281

 Score =  343 bits (881), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 199/278 (71%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           ++LE  I+  F+   +   +   +V++AV   L LLD+G  R+A R  +G W  +QW+KK
Sbjct: 4   ASLETTINGAFDARETITPATKGEVREAVDHALGLLDKGEARVAERAADGRWTVNQWLKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N    I  G G + WWDK+P+KF+ W    F    FR +PG IVR SA+I  
Sbjct: 64  AVLLSFRLNDMTTIPGGPGKAAWWDKVPSKFEGWDENRFRSAGFRAVPGAIVRRSAFIAR 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ E +M+DTW TVGSCAQIGK VHISGG GIGGVLEP+Q GP IIE
Sbjct: 124 NVVLMPSFVNLGAYVDESTMVDTWCTVGSCAQIGKRVHISGGAGIGGVLEPLQAGPVIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D+CFIGARSE+ EG I+R+G+VL MGVF+G STKI+DR TGEI  GEVP Y+VVVPG+ P
Sbjct: 184 DDCFIGARSEVAEGVIVRKGAVLSMGVFLGASTKIVDRTTGEIFMGEVPEYAVVVPGALP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              L     GP   CAVI+K+VDE+TRSKT IN LLRD
Sbjct: 244 GKPLGNGQPGPSTACAVIVKRVDERTRSKTGINELLRD 281


>gi|220921025|ref|YP_002496326.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacterium nodulans ORS 2060]
 gi|254767078|sp|B8IHY5|DAPD_METNO RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|219945631|gb|ACL56023.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacterium nodulans ORS 2060]
          Length = 281

 Score =  343 bits (881), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 156/276 (56%), Positives = 198/276 (71%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           L   I++ +E+  S   +    V++AV++ L LLD G  R+A +  +  W  +QW+KKA+
Sbjct: 6   LARTIEAAWEDRASVGPTTQGTVREAVEAALALLDSGQARVAEKSGSADWQVNQWLKKAV 65

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++N   +I  G G + WWDK+P+KF+ W    F    FR +PG +VR  +YI P A
Sbjct: 66  LLSFRLNDMSVIPGGPGGAAWWDKVPSKFEGWDADRFRAAGFRAVPGAVVRRGSYIAPGA 125

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPSFVN+GAY+GEG+M+DTW+T+GSCAQ+GKN HISGG GI GVLEP+Q  P IIEDN
Sbjct: 126 VLMPSFVNLGAYVGEGTMVDTWATIGSCAQVGKNCHISGGAGIAGVLEPLQANPVIIEDN 185

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGAR+E+ EG I+ EGSVL MGV+IG STKIIDR TGE+ YG VP YSVVV G+ P  
Sbjct: 186 CFIGARAEVAEGVIVGEGSVLSMGVYIGASTKIIDRATGEVMYGRVPPYSVVVSGTQPGK 245

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            L     GP LYCAVI+K+VD  TR+KT IN LLRD
Sbjct: 246 PLPDGTPGPSLYCAVIVKRVDAGTRAKTGINELLRD 281


>gi|329888490|ref|ZP_08267088.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brevundimonas diminuta ATCC 11568]
 gi|328847046|gb|EGF96608.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Brevundimonas diminuta ATCC 11568]
          Length = 289

 Score =  343 bits (880), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 161/294 (54%), Positives = 211/294 (71%), Gaps = 17/294 (5%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T ++ LE +I++ +E     + +   +V+DAV + L LLD G  R+ASR ++G W THQ
Sbjct: 1   MTDLTHLESVIEAAWEARAEVSAATRGEVRDAVDTALALLDSGQARVASRGEDGVWTTHQ 60

Query: 62  WIKKAILLSFQINPTKIISDGNGYST------------WWDKIPAKFDDWKTKDFEKHNF 109
           W+KKA+LLSF++N   I+  G+  +             +WDK+P KF DW   D++   F
Sbjct: 61  WLKKAVLLSFRLNDNVIMRAGHAPTLPLSADHPVAVGPFWDKVPNKFGDWSAADYKAAGF 120

Query: 110 RIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVG 169
           R +PG +VR  AY+G   VLMPSFVN+GAY+ EGSM+D W+TVGSCAQIGKNVH+SGG G
Sbjct: 121 RSVPGAVVRRGAYVGKNVVLMPSFVNIGAYVDEGSMVDAWATVGSCAQIGKNVHLSGGAG 180

Query: 170 IGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEIT 229
           IGGVLEP+Q  PTIIED CFIGAR+E+ EG I+REG+VL MGV++  STKI+DR+TGEI 
Sbjct: 181 IGGVLEPLQANPTIIEDGCFIGARAEVAEGVIVREGAVLAMGVYLSASTKIVDRSTGEIF 240

Query: 230 YGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            GEVP+YSVVVPG+ P  N      GP LYCAVI+K+VD +TR+KT +N LLRD
Sbjct: 241 RGEVPAYSVVVPGALPDPN-----GGPSLYCAVIVKRVDAQTRAKTGVNELLRD 289


>gi|260429538|ref|ZP_05783515.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Citreicella sp. SE45]
 gi|260420161|gb|EEX13414.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Citreicella sp. SE45]
          Length = 275

 Score =  343 bits (879), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 160/255 (62%), Positives = 197/255 (77%), Gaps = 6/255 (2%)

Query: 29  DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTW 88
           + ++A++ TL+ LD G +R+A +  +G+W  +QW KKA+LL F+I   +I  +G     W
Sbjct: 27  ETREAIEDTLEALDSGKLRVAEKQADGNWQVNQWAKKAVLLGFRIKDMEIHDNGPQGGGW 86

Query: 89  WDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDT 148
           WDK+ +KF  W    ++   FR +P  +VR SAYI P  VLMPSFVN+GA++GEG+M+DT
Sbjct: 87  WDKVDSKFKGWGNNQWKAAGFRAVPNCVVRKSAYIAPGVVLMPSFVNLGAHVGEGTMVDT 146

Query: 149 WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208
           W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GP IIEDNCFIGARSE+VEGCI+REGSVL
Sbjct: 147 WATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPVIIEDNCFIGARSEVVEGCIVREGSVL 206

Query: 209 GMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVD 268
           GMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS PS N      G  LYCAVI+K+VD
Sbjct: 207 GMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAGSMPSKN------GISLYCAVIVKRVD 260

Query: 269 EKTRSKTSINTLLRD 283
            KTRSKT IN LLRD
Sbjct: 261 AKTRSKTGINELLRD 275


>gi|312115823|ref|YP_004013419.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311220952|gb|ADP72320.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 279

 Score =  343 bits (879), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 159/280 (56%), Positives = 206/280 (73%), Gaps = 1/280 (0%)

Query: 4   IVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           + + L+ +ID+ FE+  +       +V DAV++ L LLD G  R+A +   G W  ++W+
Sbjct: 1   MTNDLKAVIDAAFEDRQAIRFGQKGEVADAVEAALSLLDEGKARVAEKV-GGEWVVNEWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N   ++ DG     WWDK+P+KF  W    F    FR +PG+IVR SA+I
Sbjct: 60  KKAVLLSFRLNDNTLLGDGEAPGPWWDKVPSKFSGWDEARFRAAGFRALPGSIVRRSAFI 119

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPSFVN+GAY+GEG+M+DTW+TVGSCAQIG++VH+SGG GIGGVLEP+Q GP I
Sbjct: 120 ERNVVLMPSFVNVGAYVGEGTMVDTWATVGSCAQIGRHVHLSGGAGIGGVLEPLQAGPVI 179

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGAR+E+ EG ++ EGSVL MGV++G+STKI+DR TGE+ YG VP YSVVV G+
Sbjct: 180 IEDNCFIGARAEVAEGVVVGEGSVLSMGVYLGQSTKIVDRATGEVFYGRVPPYSVVVSGA 239

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            P   L     GP LYCAVI+K+VDEKTRSKTSIN LLR+
Sbjct: 240 MPGKPLPNGEPGPSLYCAVIVKRVDEKTRSKTSINDLLRE 279


>gi|288957350|ref|YP_003447691.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Azospirillum sp. B510]
 gi|288909658|dbj|BAI71147.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Azospirillum sp. B510]
          Length = 280

 Score =  342 bits (878), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 162/278 (58%), Positives = 203/278 (73%), Gaps = 1/278 (0%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           ++L+  ID+ +E       +    V+DAV + LD LD G +R+A +   G W  +QW+KK
Sbjct: 4   ASLQATIDAAWENRADLTTATTGPVRDAVNAALDALDAGDLRVAEKTAGG-WTVNQWLKK 62

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N  ++I  G   S+W+DK+P KF+ W    F+   FR +PG I R S+Y+ P
Sbjct: 63  AVLLSFRLNANEMIPGGPAGSSWYDKVPPKFEGWTEGQFQNAGFRALPGAIARKSSYVAP 122

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             +LMPSFVN+GAY+  G+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIE
Sbjct: 123 GVILMPSFVNVGAYVDSGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQADPVIIE 182

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EG+V+ MG FIG STKIIDR+TGE+  G VP+YSVVVPGS P
Sbjct: 183 DNCFIGARSEIVEGVIVEEGAVISMGCFIGASTKIIDRHTGEVFVGRVPAYSVVVPGSLP 242

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              L     GP LYC VIIK+VDEKTRSKT+IN LLRD
Sbjct: 243 GKPLPDGTPGPSLYCCVIIKRVDEKTRSKTAINDLLRD 280


>gi|296447254|ref|ZP_06889183.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylosinus trichosporium OB3b]
 gi|296255216|gb|EFH02314.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylosinus trichosporium OB3b]
          Length = 285

 Score =  342 bits (877), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 161/280 (57%), Positives = 208/280 (74%), Gaps = 4/280 (1%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDN----GHWNTHQWI 63
           LE II + FE+  + + S   D++ AV+S L LLD G +R+A + +       W  +QW+
Sbjct: 6   LENIITTAFEDRANIDASTQGDIRHAVESALRLLDSGKLRVAEKIEGETGPSSWKVNQWL 65

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N   +I  G G +TWWDK+P+KF  W   + +   FR +PG++VRHSAY+
Sbjct: 66  KKAVLLSFRLNDMSVIEGGPGGATWWDKVPSKFAGWGAAEHKAAGFRSVPGSVVRHSAYV 125

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  +LMPSFVN+GA++  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTI
Sbjct: 126 APGVILMPSFVNLGAFVDAGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTI 185

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IED+CFIGARSEIVEG ++ +G+V+ MGVFIG STK+IDR TG+I  G VP YSVVV G+
Sbjct: 186 IEDDCFIGARSEIVEGVVVGKGAVISMGVFIGASTKVIDRATGQIHTGYVPPYSVVVSGN 245

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            P   L    AGP LYCAVI+K VD +TR KT+IN LLRD
Sbjct: 246 LPGKPLPDGSAGPSLYCAVIVKTVDAQTRGKTAINELLRD 285


>gi|103488305|ref|YP_617866.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Sphingopyxis alaskensis RB2256]
 gi|98978382|gb|ABF54533.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sphingopyxis alaskensis RB2256]
          Length = 280

 Score =  342 bits (876), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 203/280 (72%)

Query: 4   IVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           + + L+  I++ ++  ++   +    V++AV + +  LD G  R+A RD  G W  +QW+
Sbjct: 1   MTADLQATIEAAWDARDTLGLATTGAVREAVDTAIAGLDDGSFRVAERDARGTWQVNQWL 60

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  +II  G   +TWWDK+P+KF  W    F    FR +PG+IVR  A+I
Sbjct: 61  KKAVLLSFRLNDMEIIEGGADGATWWDKVPSKFAGWGENRFRDAGFRAVPGSIVRRGAFI 120

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
              AVLMPSFVN+GAY+GEGSM+D W+TVGSCAQIG NVH+SGG GIGGVLEP+Q GP +
Sbjct: 121 SKGAVLMPSFVNIGAYVGEGSMVDAWATVGSCAQIGANVHLSGGAGIGGVLEPLQAGPVV 180

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IED  FIGAR+E+ EG I+REG+VL MGV++G STKIIDR TGE+  GEVP+YSVVVPGS
Sbjct: 181 IEDGAFIGARAEVAEGVIVREGAVLSMGVYLGASTKIIDRATGEVFVGEVPAYSVVVPGS 240

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            P   L     GP LYCAVI+K+VD +TR+KT IN LLRD
Sbjct: 241 LPGKPLPDGTPGPSLYCAVIVKRVDAQTRAKTGINELLRD 280


>gi|114762098|ref|ZP_01441566.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pelagibaca bermudensis HTCC2601]
 gi|114545122|gb|EAU48125.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseovarius sp. HTCC2601]
          Length = 275

 Score =  340 bits (872), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 200/255 (78%), Gaps = 6/255 (2%)

Query: 29  DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTW 88
           + ++A+++TL  LD G +R+A + D+G+W+ +QW KKA+LL F+I   ++   G   S W
Sbjct: 27  ETREAIEATLHALDSGTLRVAEKLDDGNWHVNQWAKKAVLLGFRIKDMEMQDGGPQGSGW 86

Query: 89  WDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDT 148
           WDK+ +KF  W   +++   FR +P  +VR SAYI P  VLMPSFVN+GAY+ EG+M+DT
Sbjct: 87  WDKVDSKFKGWGDSEWKAAGFRAVPNCVVRKSAYIAPGVVLMPSFVNLGAYVDEGTMVDT 146

Query: 149 WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208
           W+TVGSCAQIGK VH+SGGVGIGGVLEP+Q GPTIIEDNCFIGARSE+VEG I+REGSVL
Sbjct: 147 WATVGSCAQIGKGVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGVIVREGSVL 206

Query: 209 GMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVD 268
           GMGVF+G+STKI+DR TGE+ YGEVP YSVVV G+ PS N      G +LYCAVI+K+VD
Sbjct: 207 GMGVFLGQSTKIVDRETGEVFYGEVPPYSVVVAGTMPSKN------GVNLYCAVIVKRVD 260

Query: 269 EKTRSKTSINTLLRD 283
           EKTRSKT IN LLRD
Sbjct: 261 EKTRSKTGINELLRD 275


>gi|300021569|ref|YP_003754180.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299523390|gb|ADJ21859.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 284

 Score =  339 bits (869), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 160/276 (57%), Positives = 206/276 (74%), Gaps = 1/276 (0%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           L++ I+S ++  ++ +     +V+DAV+++L LLD G  R+A + D G W  +QW+KKA+
Sbjct: 10  LQKTIESAWDNRDAVSFETKGEVRDAVETSLGLLDTGRARVAEKKD-GAWTVNQWLKKAV 68

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++N  + IS G   S +WDK+P KF  W   DF K  FR++PG +VR SAYI P A
Sbjct: 69  LLSFRLNDMETISGGPAGSFYWDKVPPKFAGWTEADFRKGGFRVLPGAVVRRSAYIAPGA 128

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           V++P+FVN+GAY+  G+M+DTW+TVGSCAQIGKN HISGG GIGGVLEP+Q GP +IEDN
Sbjct: 129 VILPAFVNLGAYVDSGTMVDTWATVGSCAQIGKNCHISGGAGIGGVLEPLQAGPVVIEDN 188

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGAR+E+ EG  + EGSVL MGV++G ST IIDR TGE  +G+VP YSVVV GS    
Sbjct: 189 CFIGARAEVAEGVEVGEGSVLSMGVYLGASTTIIDRTTGEKFFGKVPPYSVVVSGSMAGK 248

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            L     GP+LYCAVI+K+VDEKTRSKTSIN LLRD
Sbjct: 249 PLPNGEPGPNLYCAVIVKRVDEKTRSKTSINELLRD 284


>gi|146337890|ref|YP_001202938.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Bradyrhizobium sp. ORS278]
 gi|166224198|sp|A4YLC4|DAPD_BRASO RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|146190696|emb|CAL74700.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           (Tetrahydrodipicolinate N-succinyltransferase) (THP
           succinyltransferase) (Tetrahydropicolinate succinylase)
           [Bradyrhizobium sp. ORS278]
          Length = 281

 Score =  338 bits (868), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 166/279 (59%), Positives = 211/279 (75%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S LE  I+S F+  +  + S   +V+DAV+S L+LLD+G  R+A R  +G W+ +QW+K
Sbjct: 3   LSALESTINSAFDARDGVSTSTKGEVRDAVESALELLDKGEARVAERAADGKWSVNQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N   +I  G G ++WWDK+P+KF+ W    F +  FR +PG IVR SA+I 
Sbjct: 63  KAVLLSFRLNDMSVIPGGPGQASWWDKVPSKFEGWGENRFREAGFRAVPGAIVRRSAFIA 122

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GAY+ E +M+DTWSTVGSCAQIGK VHISGGVGIGGVLEP+Q GP II
Sbjct: 123 RNVVLMPSFVNLGAYVDESTMVDTWSTVGSCAQIGKRVHISGGVGIGGVLEPLQAGPVII 182

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           ED+CFIGARSE+ EG I+R+G+VL MGVF+G STKI+DR TGE   GEVP Y+VVVPG+ 
Sbjct: 183 EDDCFIGARSEVAEGVIVRKGAVLAMGVFLGASTKIVDRETGETFVGEVPEYAVVVPGAL 242

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   +K    GP   CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 243 PGKPMKNGQIGPSTACAVIVKRVDERTRSKTSINELLRD 281


>gi|84503471|ref|ZP_01001526.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Oceanicola batsensis HTCC2597]
 gi|84388149|gb|EAQ01102.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Oceanicola batsensis HTCC2597]
          Length = 275

 Score =  338 bits (868), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 160/278 (57%), Positives = 206/278 (74%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  +  + +   + ++A++ TL+ LD G +R+A +  +G W+ +QW KK
Sbjct: 4   AQLETAIEAAWEARDQISPATTGETREAIEDTLNALDSGALRVAEKQSDGSWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F++   +  S G     WWDK+ +KF  W    ++   FR +P  +VR SA+I P
Sbjct: 64  AVLLGFRLRDMEQQSGGPQGGGWWDKVDSKFAGWGENQWKAAGFRAVPNCVVRKSAFIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGK VH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKGVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+REGSVLGMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGVIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVSGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VD +TRSKT IN LLRD
Sbjct: 244 SKN------GVNLYCAVIVKRVDAQTRSKTGINELLRD 275


>gi|148555819|ref|YP_001263401.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sphingomonas wittichii RW1]
 gi|148501009|gb|ABQ69263.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sphingomonas wittichii RW1]
          Length = 274

 Score =  338 bits (868), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 157/276 (56%), Positives = 205/276 (74%), Gaps = 6/276 (2%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           L+ II+  ++E      S   +V+DAV+S L LLD G  R+A +   G W  +QW+KKA+
Sbjct: 5   LQTIIEKAWDEREGVTFSTKGEVRDAVESALGLLDSGARRVAEKGAEG-WTVNQWLKKAV 63

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++N  ++I  G G ++WWDK+P+KF  W   ++    FR +PG+IVR  A+I   A
Sbjct: 64  LLSFRLNDMELIPGGPGGASWWDKVPSKFAAWGEAEYRAAGFRAVPGSIVRRGAHIARGA 123

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPSFVN+GAY+GE +M+DTW+TVGSCAQIG NVH+SGGVGIGGVLEP+Q GP +IED+
Sbjct: 124 VLMPSFVNLGAYVGENTMVDTWATVGSCAQIGSNVHLSGGVGIGGVLEPLQAGPVVIEDD 183

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGARSE+ EG ++ +G+VL MGV++G STKI+DR TGE+  G VPSY+VVVPG+ P  
Sbjct: 184 CFIGARSEVAEGVVVEQGAVLSMGVYLGASTKIVDRATGEVFVGRVPSYAVVVPGTLP-- 241

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              G   GP LYCAVI+K+VD +TRSKT IN LLRD
Sbjct: 242 ---GKDGGPGLYCAVIVKRVDAQTRSKTGINELLRD 274


>gi|56698161|ref|YP_168533.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Ruegeria pomeroyi DSS-3]
 gi|71153312|sp|Q5LN75|DAPD_SILPO RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|56679898|gb|AAV96564.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ruegeria pomeroyi DSS-3]
          Length = 275

 Score =  338 bits (867), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 160/276 (57%), Positives = 203/276 (73%), Gaps = 6/276 (2%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           LE  I++ ++  +S   +     ++A++ TL  LD G +R+A +  +G W+ +QW KKA+
Sbjct: 6   LEAAIEAAWDARDSITPATTGATREAIEETLAALDGGGLRVAEKQADGSWHVNQWAKKAV 65

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LL F+I   +I S G     WWDK+ +KF  W    ++   FR +P  +VR SAYI P  
Sbjct: 66  LLGFRIKDMEIQSGGPQGGGWWDKVDSKFAGWGESQWKAAGFRAVPNCVVRKSAYIAPGV 125

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPSFVN+GAY+  G+M+DTW+TVGSCAQIG+NVH+SGGVGIGGVLEP+Q GPTIIEDN
Sbjct: 126 VLMPSFVNLGAYVDSGTMVDTWATVGSCAQIGRNVHLSGGVGIGGVLEPMQAGPTIIEDN 185

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGARSE+VEG I+REG+VLGMGV+IG+STKI+DR TGE+ YGEVP YSVVV GS PS 
Sbjct: 186 CFIGARSEVVEGVIVREGAVLGMGVYIGQSTKIVDRETGEVMYGEVPPYSVVVSGSMPST 245

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
                  G  LYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 246 G------GVSLYCAVIVKRVDERTRSKTGINELLRD 275


>gi|115522678|ref|YP_779589.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodopseudomonas palustris BisA53]
 gi|122297689|sp|Q07TX5|DAPD_RHOP5 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|115516625|gb|ABJ04609.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodopseudomonas palustris BisA53]
          Length = 281

 Score =  338 bits (867), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 166/279 (59%), Positives = 211/279 (75%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S LE  I++ F+  ++ + +   +V+DAV+  LDLLD+G +R+A+R+ +G W  +QW+K
Sbjct: 3   LSALESTINAAFDARDTVSAATKGEVRDAVEQALDLLDKGEVRVAAREASGAWVVNQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N    IS G G ++WWDK+P+KF  W    F    FR +PG IVR SA+IG
Sbjct: 63  KAVLLSFRLNDMTTISGGPGGASWWDKVPSKFYGWGENRFRDAGFRAVPGAIVRRSAFIG 122

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GAY+ E +M+DTWSTVGSCAQIGK VHISGGVGIGGVLEP+Q GP II
Sbjct: 123 KNVVLMPSFVNLGAYVDEATMVDTWSTVGSCAQIGKRVHISGGVGIGGVLEPLQAGPVII 182

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           ED+CFIGAR+E+ EG I+R G+VL MGVF+G STKI+DR TGEI  GEVP YSVVVPG+ 
Sbjct: 183 EDDCFIGARAEVAEGVIVRRGAVLAMGVFLGASTKIVDRTTGEIFIGEVPEYSVVVPGAL 242

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   +     GP   CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 243 PGKPMANGEPGPATACAVIVKRVDERTRSKTSINELLRD 281


>gi|146276104|ref|YP_001166263.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodobacter sphaeroides ATCC 17025]
 gi|166224221|sp|A4WNJ4|DAPD_RHOS5 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|145554345|gb|ABP68958.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 274

 Score =  338 bits (866), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 162/255 (63%), Positives = 199/255 (78%), Gaps = 7/255 (2%)

Query: 29  DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTW 88
           + +DAV++TL+ LD+G +R+A +     W+ +QW KKA+LL F++    + + G    TW
Sbjct: 27  EARDAVEATLEALDKGSLRVAEKR-GADWHVNQWAKKAVLLGFRLKDMDVQTGGPQGGTW 85

Query: 89  WDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDT 148
           WDK+ +KF  W    ++   FR +P  IVR SAYI    VLMPSFVN+GAY+ EG+M+DT
Sbjct: 86  WDKVDSKFAQWGEAQWKAAGFRAVPNCIVRRSAYIAKGVVLMPSFVNLGAYVDEGTMVDT 145

Query: 149 WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208
           W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIEDNCFIGARSE+VEGCI+REGSVL
Sbjct: 146 WATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVL 205

Query: 209 GMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVD 268
           GMGVFIGKSTKI+DR TGE+ YGEVP+ SVVV GS PS   KG   G +LYCAVI+K+VD
Sbjct: 206 GMGVFIGKSTKIVDRETGEVMYGEVPAGSVVVAGSMPS---KG---GVNLYCAVIVKRVD 259

Query: 269 EKTRSKTSINTLLRD 283
            +TRSKTSIN LLRD
Sbjct: 260 AQTRSKTSINELLRD 274


>gi|197103850|ref|YP_002129227.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Phenylobacterium zucineum HLK1]
 gi|196477270|gb|ACG76798.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Phenylobacterium zucineum HLK1]
          Length = 272

 Score =  337 bits (865), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 162/279 (58%), Positives = 203/279 (72%), Gaps = 7/279 (2%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S L+  I+  +E  +  + +    V DAV+  L+ LD G +R+A R  +G W THQW+K
Sbjct: 1   MSDLKSTIEQAWEARDGISAATTGAVADAVREVLEQLDSGRLRVAERGADGAWTTHQWVK 60

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           +AILLSF++NP  ++  G     +WDK+P KFD W    FE+  FR +PG IVR SA+I 
Sbjct: 61  QAILLSFRLNPNVVMEPG----PYWDKVPLKFDGWDAARFEQAGFRAVPGAIVRKSAFIS 116

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GAY+GEG+M+DTW+TVGSCAQ+GKN HISGG G+GGVLEP+Q  PTII
Sbjct: 117 KGVVLMPSFVNVGAYVGEGTMVDTWATVGSCAQVGKNCHISGGAGLGGVLEPLQANPTII 176

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGAR+E+ EG I+REGSVL MGVFI  +T I+DR TGE   GEVP YSVVV GS 
Sbjct: 177 EDNCFIGARAEVAEGVIVREGSVLSMGVFITSTTPIVDRRTGETFTGEVPPYSVVVSGSR 236

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P+     D + P  YCAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 237 PNPT---DPSLPSTYCAVIMKRVDERTRSKTSINELLRD 272


>gi|144900138|emb|CAM77002.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 280

 Score =  337 bits (865), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 157/278 (56%), Positives = 206/278 (74%), Gaps = 1/278 (0%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + L++ I+  +E  ++ N      ++DAV+  L +LD G +R+A + D G W  +QW+KK
Sbjct: 4   ADLQKAIEDAWEVRDTINAKTDSKIRDAVEMALGMLDTGHMRVAEKLD-GEWVVNQWLKK 62

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N ++ +S     S W+DK+P KF+ W    F+ H FR +PG +VR  AYI P
Sbjct: 63  AVLLSFRLNDSRPVSGAPNGSHWFDKVPTKFEGWDEGMFQAHGFRAVPGAVVRRPAYIAP 122

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+  G+M+DTW+TVGSCAQIG+NVHISGG GIGGVLEP+Q GP I+E
Sbjct: 123 GVVLMPSFVNVGAYVDSGTMVDTWATVGSCAQIGRNVHISGGAGIGGVLEPLQAGPVILE 182

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DN FIGAR+E+ EG I+ EG+VL MGV+IGKSTKI+DR TGE+ YG VP+YSVVV G+ P
Sbjct: 183 DNVFIGARAEVAEGVIVEEGAVLSMGVYIGKSTKIVDRATGEVFYGRVPAYSVVVSGTMP 242

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              L     GP+LYCAVI+K+VDE+TRSK SIN LLRD
Sbjct: 243 GKPLPNGEPGPNLYCAVIVKRVDEQTRSKVSINELLRD 280


>gi|154250723|ref|YP_001411547.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Parvibaculum lavamentivorans DS-1]
 gi|171769556|sp|A7HPQ7|DAPD_PARL1 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|154154673|gb|ABS61890.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Parvibaculum lavamentivorans DS-1]
          Length = 281

 Score =  337 bits (865), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 163/280 (58%), Positives = 200/280 (71%), Gaps = 2/280 (0%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S L+ +I+  FE  +  N     +V+DAV   L+ LD G  R+A +   G W  HQW+K
Sbjct: 3   LSDLKPVIERAFENRDQINAQTKGEVRDAVNEALNALDSGKARVAEKF-QGSWEVHQWLK 61

Query: 65  KAILLSFQINPTKIISDGNGYST-WWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
            A+LLSF++N    I+ G G +T WWDK+P+KF+ W   +F K  FR +PG IVR SAYI
Sbjct: 62  MAVLLSFRLNDMSTIAGGPGENTNWWDKVPSKFEGWGEAEFRKAGFRAVPGAIVRRSAYI 121

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPSFVN+GA++ EG+M+DTW TVGSCAQIGKN H+SGGVGIGGVLEP+Q  P I
Sbjct: 122 APNVVLMPSFVNLGAHVDEGTMVDTWVTVGSCAQIGKNCHLSGGVGIGGVLEPLQANPVI 181

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EG+VL MGVFI  STKIIDR TGE+  G+VP YSVVVPGS
Sbjct: 182 IEDNCFIGARSEVVEGVIVGEGAVLSMGVFISASTKIIDRATGEVHIGKVPPYSVVVPGS 241

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            P          P LYC VI+K VD +TR+KT+IN LLRD
Sbjct: 242 LPGKANPDGSPAPSLYCCVIVKTVDAQTRAKTAINELLRD 281


>gi|255261749|ref|ZP_05341091.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Thalassiobium sp. R2A62]
 gi|255104084|gb|EET46758.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Thalassiobium sp. R2A62]
          Length = 275

 Score =  337 bits (865), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 210/278 (75%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ ++  ++   +   + +DA+  TL+ LD G +R+A R +NG W+ +QW KK
Sbjct: 4   AQLETAIEAAWDARDAITPATTGETRDAITDTLNALDSGSLRVAERKENGDWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F++   ++ S G    +W+DK+ +KF  W   ++    FR +PG I R SAYI P
Sbjct: 64  AVLLGFRLKDMEMQSGGPQGVSWFDKVDSKFHGWGENEWGATGFRAVPGAIARKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+  G+M+DTW++VGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDTGTMVDTWASVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D+CFIGARSE+VEG I+REG+VLGMGV+IG+STKI+DR TG+++YGEVP+ SVVV G+ P
Sbjct: 184 DDCFIGARSEVVEGVIVREGAVLGMGVYIGQSTKIVDRETGDVSYGEVPAGSVVVSGTMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+KKVD KTRSKTSIN LLRD
Sbjct: 244 SKN------GVNLYCAVIVKKVDAKTRSKTSINDLLRD 275


>gi|84684530|ref|ZP_01012431.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667509|gb|EAQ13978.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacterales bacterium HTCC2654]
          Length = 275

 Score =  337 bits (865), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 165/278 (59%), Positives = 207/278 (74%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E  ++   +   + ++A++ TL+ LD G +R+A R DNG W+ +QW KK
Sbjct: 4   AALETAIEAAWEARDTITPTTGGETREAIEDTLNALDSGELRVAERRDNGDWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +I   G     WWDK+ +KF  W    ++   FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRIKDMEIQPGGPQGGGWWDKVDSKFKGWGDNQWKAAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGK VH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKGVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+REGSVLGMGV+IG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGVIVREGSVLGMGVYIGQSTKIVDRETGEVMYGEVPPYSVVVSGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S        G +LYCAVI+K+VDEKTRSKT IN LLRD
Sbjct: 244 S------TGGVNLYCAVIVKRVDEKTRSKTGINELLRD 275


>gi|126732706|ref|ZP_01748502.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sagittula stellata E-37]
 gi|126706836|gb|EBA05906.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sagittula stellata E-37]
          Length = 275

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 161/278 (57%), Positives = 203/278 (73%), Gaps = 6/278 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ +E           + ++A++ TL+ LD G +R+A +  +  W+ +QW KK
Sbjct: 4   AQLETAIEAAWENRADITPMTGGETREAIEDTLNALDSGRLRVAEKQADMSWHVNQWAKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LL F+I   +   +G     WWDK+ +KF  W    ++   FR +P  +VR SAYI P
Sbjct: 64  AVLLGFRIKDMESHDNGPQGGGWWDKVDSKFKGWGDNQWKAAGFRAVPNCVVRKSAYIAP 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGK VH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 124 GVVLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKGVHLSGGVGIGGVLEPMQAGPTIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEGCI+REGSVLGMGVFIG+STKI+DR TGE+ YGEVP YSVVV GS P
Sbjct: 184 DNCFIGARSEVVEGCIVREGSVLGMGVFIGQSTKIVDRETGEVMYGEVPPYSVVVAGSMP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S N      G +LYCAVI+K+VD +TRSKT IN LLRD
Sbjct: 244 SKN------GINLYCAVIVKRVDAQTRSKTGINELLRD 275


>gi|90422331|ref|YP_530701.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodopseudomonas palustris BisB18]
 gi|122477310|sp|Q21B54|DAPD_RHOPB RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|90104345|gb|ABD86382.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodopseudomonas palustris BisB18]
          Length = 281

 Score =  337 bits (864), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 168/279 (60%), Positives = 209/279 (74%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S LE  I++ F+  ++ + +   +V+DAV+  LD+LD+G  R+A R D+G W  +QW+K
Sbjct: 3   LSALETSINTAFDARDTVSTATKGEVRDAVEHALDMLDKGEARVAERGDDGKWTVNQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N    IS G G +TWWDK+P+KF  W    F    FR +PG IVR SA+I 
Sbjct: 63  KAVLLSFRLNDMSTISGGPGGATWWDKVPSKFSGWGENRFRDAGFRAVPGAIVRRSAFIA 122

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GAY+ E +M+DTW TVGSCAQIGK VHISGGVGIGGVLEP+Q GP II
Sbjct: 123 KNVVLMPSFVNLGAYVDEATMVDTWVTVGSCAQIGKRVHISGGVGIGGVLEPLQAGPVII 182

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           ED+CFIGARSE+ EG I+R G+VL MGVF+G STKIIDR++GEI  GEVP YSVVVPG+ 
Sbjct: 183 EDDCFIGARSEVAEGVIVRRGAVLSMGVFLGASTKIIDRDSGEIFVGEVPEYSVVVPGNL 242

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   LK    GP   CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 243 PGRPLKNGQPGPSTACAVIVKRVDERTRSKTSINELLRD 281


>gi|148258517|ref|YP_001243102.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Bradyrhizobium sp. BTAi1]
 gi|166224197|sp|A5ESQ2|DAPD_BRASB RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|146410690|gb|ABQ39196.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Bradyrhizobium sp. BTAi1]
          Length = 281

 Score =  337 bits (863), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 163/279 (58%), Positives = 211/279 (75%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S LE  I+S F+  +  + +   +++DAV+S L+LLD+G  R+A R  +G W+ +QW+K
Sbjct: 3   LSALESTINSAFDARDGVSTTTKGEIRDAVESALELLDKGEARVAERGTDGTWSVNQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N   +I  G G ++WWDK+P+KF+ W    F +  FR +PG IVR SA+I 
Sbjct: 63  KAVLLSFRLNDMSVIPGGPGQASWWDKVPSKFEGWGENRFREAGFRAVPGAIVRRSAFIA 122

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GAY+ E +M+DTWSTVGSCAQIGK VHISGGVGIGGVLEP+Q GP II
Sbjct: 123 KNVVLMPSFVNLGAYVDEATMVDTWSTVGSCAQIGKRVHISGGVGIGGVLEPLQAGPVII 182

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           ED+CFIGARSE+ EG ++R+G+VL MGVF+G STK+IDR TGE   GEVP Y+VVVPG+ 
Sbjct: 183 EDDCFIGARSEVAEGVVVRKGAVLAMGVFLGASTKVIDRETGETFVGEVPEYAVVVPGAL 242

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   +K    GP   CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 243 PGKPMKNGQIGPSTACAVIVKRVDERTRSKTSINELLRD 281


>gi|77464712|ref|YP_354216.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodobacter sphaeroides 2.4.1]
 gi|332559605|ref|ZP_08413927.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodobacter sphaeroides WS8N]
 gi|123590843|sp|Q3IYR9|DAPD_RHOS4 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|77389130|gb|ABA80315.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacter sphaeroides 2.4.1]
 gi|332277317|gb|EGJ22632.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodobacter sphaeroides WS8N]
          Length = 274

 Score =  336 bits (862), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 200/255 (78%), Gaps = 7/255 (2%)

Query: 29  DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTW 88
           + ++A+++TL+ LD+G +R+A +     W+ +QW KKA+LL F++   ++ + G    TW
Sbjct: 27  ETREAIEATLEALDKGSLRVAEKR-GADWHVNQWAKKAVLLGFRLKDMEVQTGGPQAGTW 85

Query: 89  WDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDT 148
           WDK+ +KF  W    ++   FR +P  +VR SAYI    VLMPSFVN+GAY+ EG+M+DT
Sbjct: 86  WDKVDSKFAQWGEAQWKAAGFRAVPNCVVRRSAYIARGVVLMPSFVNLGAYVDEGTMVDT 145

Query: 149 WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208
           W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIEDNCFIGARSE+VEGCI+REGSVL
Sbjct: 146 WATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVL 205

Query: 209 GMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVD 268
           GMGVFIGKSTKI+DR TGE+ YGEVP+ SVVV GS PS   KG   G +LYCAVI+K+VD
Sbjct: 206 GMGVFIGKSTKIVDRETGEVMYGEVPAGSVVVAGSMPS---KG---GVNLYCAVIVKRVD 259

Query: 269 EKTRSKTSINTLLRD 283
            +TRSKTSIN LLRD
Sbjct: 260 AQTRSKTSINELLRD 274


>gi|182680234|ref|YP_001834380.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|226724153|sp|B2IDV9|DAPD_BEII9 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|182636117|gb|ACB96891.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 285

 Score =  336 bits (862), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 165/280 (58%), Positives = 198/280 (70%), Gaps = 4/280 (1%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNG----HWNTHQWI 63
           LE +I++ FE+    N S   DV+D V+  L  LD G +R+A +         W  +QW+
Sbjct: 6   LESLIEAAFEDRAQINASTQGDVRDGVERALLELDSGKLRVAEKQAGATGPDAWKVNQWL 65

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N    I  G G S+WWDK+P+KF  W   +     FR +P  +VR SAYI
Sbjct: 66  KKAVLLSFRLNDMSTIEGGPGGSSWWDKVPSKFAGWTAAEHAAAGFRSVPNCVVRRSAYI 125

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPSFVN+GAY+  GSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 126 APGVVLMPSFVNLGAYVDTGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 185

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IED+CFIGARSEIVEG II +GSV+ MGVFI  STKIIDR TG+I  G VP YSVVV G+
Sbjct: 186 IEDDCFIGARSEIVEGVIIGQGSVVSMGVFISSSTKIIDRATGKIHIGYVPPYSVVVSGN 245

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            P  NL     GP LYCAVI+K VD +TRSKT IN LLRD
Sbjct: 246 LPGKNLPDGTPGPSLYCAVIVKTVDAQTRSKTGINELLRD 285


>gi|209886645|ref|YP_002290502.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Oligotropha carboxidovorans OM5]
 gi|226724182|sp|B6JJP3|DAPD_OLICO RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|209874841|gb|ACI94637.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Oligotropha carboxidovorans OM5]
          Length = 281

 Score =  335 bits (858), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 167/279 (59%), Positives = 211/279 (75%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S LE  +++ F+  +S   +   +V+DAV+  LDLLD+G  R+A    +G W  +QW+K
Sbjct: 3   LSALETTLNTAFDARDSITAATKGEVRDAVELALDLLDKGEARVAEPQADGAWKINQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+L+SF++N    I  G G + WWDK+P+K +++  + F +  FR +PG IVR SA+I 
Sbjct: 63  KAVLISFRLNDMAPIPGGPGGAQWWDKVPSKLENYSEQKFREAGFRAVPGAIVRRSAFIA 122

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GAY+ E +MIDTWSTVGSCAQIGK+VHISGGVGIGGVLEP+Q GP II
Sbjct: 123 KNVVLMPSFVNLGAYVDEATMIDTWSTVGSCAQIGKHVHISGGVGIGGVLEPLQAGPVII 182

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+ EG I+R+G+VL MGVFIG ST+IIDR TGE+  GEVP+YSVVVPGS 
Sbjct: 183 EDNCFIGARSEVAEGVIVRKGAVLSMGVFIGASTRIIDRATGEVYIGEVPAYSVVVPGSM 242

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   L     GP LYCAVI+K+VDEKTRSKTSIN LLR+
Sbjct: 243 PGKPLPDGSPGPSLYCAVIVKRVDEKTRSKTSINELLRE 281


>gi|89067200|ref|ZP_01154713.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Oceanicola granulosus HTCC2516]
 gi|89046769|gb|EAR52823.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Oceanicola granulosus HTCC2516]
          Length = 274

 Score =  334 bits (857), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 161/276 (58%), Positives = 203/276 (73%), Gaps = 7/276 (2%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           LE  I++ +E  +    +   + ++A+Q TL+ LD G +R+A +  +  W+ +QW KKA+
Sbjct: 6   LEAAIEAAWETRDQITPATGGETREAIQDTLNALDSGQLRVAEKRGD-DWHVNQWAKKAV 64

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LL F+I   +I   G     WWDK+ +KF  W    +    FR +P  +VR SAYI P  
Sbjct: 65  LLGFRIKDMEIQHGGPQGGGWWDKVDSKFAGWGENAWRAAGFRAVPNCVVRKSAYIAPGV 124

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGK VH+SGGVGIGGVLEP+Q GPTIIEDN
Sbjct: 125 VLMPSFVNLGAYVDEGTMVDTWATVGSCAQIGKGVHLSGGVGIGGVLEPMQAGPTIIEDN 184

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGARSE+VEG I+REGSVLGMGV+IG+STKI+DR +GE+ YGEVP YSVVV G+ PS 
Sbjct: 185 CFIGARSEVVEGVIVREGSVLGMGVYIGQSTKIVDRESGEVFYGEVPPYSVVVSGTMPSK 244

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           N      G HLYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 245 N------GVHLYCAVIVKRVDERTRSKTGINELLRD 274


>gi|126463552|ref|YP_001044666.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodobacter sphaeroides ATCC 17029]
 gi|166224220|sp|A3PNH8|DAPD_RHOS1 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|126105216|gb|ABN77894.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 274

 Score =  334 bits (857), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 199/255 (78%), Gaps = 7/255 (2%)

Query: 29  DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTW 88
           + ++A+++TL+ LD+G +R+A +     W+ +QW KKA+LL F++   ++ + G    TW
Sbjct: 27  ETREAIEATLEALDKGSLRVAEKR-GADWHVNQWAKKAVLLGFRLKDMEVQTGGPQAGTW 85

Query: 89  WDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDT 148
           WDK+ +KF  W    ++   FR +P  IVR SAYI    VLMPSFVN+GAY+ E +M+DT
Sbjct: 86  WDKVDSKFAQWGEAQWKAAGFRAVPNCIVRRSAYIARGVVLMPSFVNLGAYVDESTMVDT 145

Query: 149 WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208
           W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIEDNCFIGARSE+VEGCI+REGSVL
Sbjct: 146 WATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVL 205

Query: 209 GMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVD 268
           GMGVFIGKSTKI+DR TGE+ YGEVP+ SVVV GS PS   KG   G +LYCAVI+K+VD
Sbjct: 206 GMGVFIGKSTKIVDRETGEVMYGEVPAGSVVVAGSMPS---KG---GVNLYCAVIVKRVD 259

Query: 269 EKTRSKTSINTLLRD 283
            +TRSKTSIN LLRD
Sbjct: 260 AQTRSKTSINELLRD 274


>gi|114778626|ref|ZP_01453442.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Mariprofundus ferrooxydans PV-1]
 gi|114551091|gb|EAU53652.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Mariprofundus ferrooxydans PV-1]
          Length = 274

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 210/278 (75%), Gaps = 8/278 (2%)

Query: 8   LEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++ I+  +    S  + ++  ++++A++  + LLD G +R+A +D +G W T +W+KKA
Sbjct: 4   LQDTIEQAWNTRESWTSSTVSAEIREAIEHAIQLLDDGGVRVAEKDADGKWVTQEWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LL F+++  ++IS G+  + ++DK+P KF +W    F K   R++P   VR  A+I PK
Sbjct: 64  VLLYFKLHDNQVISGGD--TNYFDKVPQKFANWGEDMFRKGGMRVVPPATVRKGAFIAPK 121

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+VN+GAY+ EG+M+DTWSTVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 122 VVLMPSYVNIGAYVDEGTMVDTWSTVGSCAQIGKNVHLSGGVGIGGVLEPLQATPTIIED 181

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSEIVEG I+REGSV+ MGV+IGKST+IIDR TG + YGEVP YSVVV GS P 
Sbjct: 182 NCFIGARSEIVEGVIVREGSVISMGVYIGKSTRIIDRETGAVMYGEVPPYSVVVSGSMP- 240

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDY 284
               G   GP+LYCAVI+K+VDEKTRSKT I  LLRD+
Sbjct: 241 ----GKSGGPNLYCAVIVKQVDEKTRSKTGITELLRDF 274


>gi|221640626|ref|YP_002526888.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodobacter sphaeroides KD131]
 gi|221161407|gb|ACM02387.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodobacter sphaeroides KD131]
          Length = 277

 Score =  334 bits (856), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 199/255 (78%), Gaps = 7/255 (2%)

Query: 29  DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTW 88
           + ++A+++TL+ LD+G +R+A +     W+ +QW KKA+LL F++   ++ + G    TW
Sbjct: 30  ETREAIEATLEALDKGSLRVAEKR-GADWHVNQWAKKAVLLGFRLKDMEVQTGGPQAGTW 88

Query: 89  WDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDT 148
           WDK+ +KF  W    ++   FR +P  IVR SAYI    VLMPSFVN+GAY+ EG+M+DT
Sbjct: 89  WDKVDSKFAQWGEAQWKAAGFRAVPNCIVRRSAYIARGVVLMPSFVNLGAYVDEGTMVDT 148

Query: 149 WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208
           W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIEDNCFIGARSE+VEGCI+REGSVL
Sbjct: 149 WATVGSCAQIGKNVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVL 208

Query: 209 GMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVD 268
           GMGVFIGKSTKI+DR TGE+ Y EVP+ SVVV GS PS   KG   G +LYCAVI+K+VD
Sbjct: 209 GMGVFIGKSTKIVDRETGEVMYCEVPAGSVVVAGSMPS---KG---GVNLYCAVIVKRVD 262

Query: 269 EKTRSKTSINTLLRD 283
            +TRSKTSIN LLRD
Sbjct: 263 AQTRSKTSINELLRD 277


>gi|83594808|ref|YP_428560.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodospirillum rubrum ATCC 11170]
 gi|123525543|sp|Q2RNM2|DAPD_RHORT RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|83577722|gb|ABC24273.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodospirillum rubrum ATCC 11170]
          Length = 283

 Score =  333 bits (853), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 158/277 (57%), Positives = 196/277 (70%), Gaps = 1/277 (0%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           +L+  I++ +E            V+DAV++ LD LD GI R+A +     W  HQW+K A
Sbjct: 5   SLQTTIEAAWESREGVTLETRGAVRDAVEAVLDGLDAGIYRVAEKIGE-TWVVHQWLKMA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++N    +S   G +TWWDK+P+KF  W    F    FR +PG IVR SA+I P 
Sbjct: 64  VLLSFRLNDMTPVSGAPGGATWWDKVPSKFAGWGEDRFRAAGFRAVPGAIVRRSAHIAPG 123

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPSFVN+GA +  G+MIDTW+TVGSCAQIG+NVH+SGG GIGGVLEP+Q GP IIED
Sbjct: 124 VVLMPSFVNLGARVESGAMIDTWATVGSCAQIGRNVHLSGGAGIGGVLEPLQAGPVIIED 183

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+ EG ++  G+VL MGVFIG ST++IDR TGE+  G VP+YSVVVPGS P 
Sbjct: 184 NCFIGARSEVAEGVLVETGAVLSMGVFIGASTRVIDRETGEVFMGRVPAYSVVVPGSLPG 243

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
             L     GP L CAVI+K+VDE+TRSK SIN LLRD
Sbjct: 244 KPLPDGTPGPGLACAVIVKRVDERTRSKVSINDLLRD 280


>gi|162138523|ref|YP_484299.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodopseudomonas palustris HaA2]
          Length = 281

 Score =  333 bits (853), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 163/278 (58%), Positives = 207/278 (74%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ F+  ++ + +   +++DAV   LDLLD+G  R+A R+ +G W  +QW+KK
Sbjct: 4   AALESTINTAFDARDTVSAATKGEIRDAVDHALDLLDKGEARVAEREASGTWTVNQWLKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N    I  G G + WWDK+P+KF+ W    F +  FR +PG IVR SA+I  
Sbjct: 64  AVLLSFRLNDMSTIPGGPGGANWWDKVPSKFEGWGENRFREAGFRAVPGAIVRRSAFIAK 123

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVLMPSFVN+GAY+ E +M+DTWSTVGSCAQIGK VHISGGVGIGGVLEP+Q GP IIE
Sbjct: 124 NAVLMPSFVNLGAYVDEATMVDTWSTVGSCAQIGKRVHISGGVGIGGVLEPLQAGPVIIE 183

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D+CFIGARSE+ EG I+R G+VL MGVF+G STKI+DR TGE   GEVP Y+V+VPG+ P
Sbjct: 184 DDCFIGARSEVAEGVIVRRGAVLAMGVFLGASTKIVDRETGETFIGEVPEYAVLVPGTLP 243

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              LK    GP   CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 244 GKPLKNGNPGPATACAVIVKRVDERTRSKTSINELLRD 281


>gi|298293965|ref|YP_003695904.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Starkeya novella DSM 506]
 gi|296930476|gb|ADH91285.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Starkeya novella DSM 506]
          Length = 280

 Score =  333 bits (853), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 166/278 (59%), Positives = 202/278 (72%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           S L+  I++ FE+  S N      V+ AV   L LLD G  R+A    +G W  +QW+KK
Sbjct: 3   SELQSTIEAAFEDRASINFETGGAVRHAVNEALGLLDAGKARVAEPGADGKWTVNQWLKK 62

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N    I    G + WWDK+P+KFD W   +F    FR +PG IVR SAYI P
Sbjct: 63  AVLLSFRLNDMSAIPGAPGGAHWWDKVPSKFDGWGESEFRAAGFRAVPGAIVRRSAYIAP 122

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GA++G  +M+DTW+TVGSCAQIG NVH+SGGVGIGGVLEP+Q GP IIE
Sbjct: 123 NVVLMPSFVNLGAHVGASTMVDTWATVGSCAQIGANVHLSGGVGIGGVLEPLQAGPVIIE 182

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D+CFIGARSE+VEG ++R GSVL MGVFI  +TKI+DR TGE+  GEVP+YSVVVPGS P
Sbjct: 183 DDCFIGARSEVVEGVVVRRGSVLSMGVFISATTKIVDRATGEVFVGEVPAYSVVVPGSLP 242

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              L     GP LYCAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 243 GKPLPDGTPGPSLYCAVIVKRVDEQTRSKTSINDLLRD 280


>gi|163795441|ref|ZP_02189408.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [alpha proteobacterium BAL199]
 gi|159179427|gb|EDP63958.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [alpha proteobacterium BAL199]
          Length = 286

 Score =  332 bits (852), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 206/283 (72%), Gaps = 5/283 (1%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           S ++ +ID+ +E       +   +V+DAV++ L+ LD G +R+A+ D +  W  +QW+KK
Sbjct: 4   SQMQAVIDAAWERRTEIGTATKGEVRDAVEAALEGLDNGSLRVATPDGDHQWTVNQWLKK 63

Query: 66  AILLSFQINPTKIISDG-----NGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           A+LLSF++   ++I  G      G S WWDK+P+KF  W    F +  FR +P  +VR S
Sbjct: 64  AVLLSFRLFDMEVIPGGPNDPERGPSVWWDKVPSKFAGWGENRFREAGFRAVPNCVVRRS 123

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    +LMPSFVN+GAY+  G+M+DTW+TVGSCAQIGKN H+SGGVGIGGVLEP+Q  
Sbjct: 124 AHIAANVILMPSFVNVGAYVDTGTMVDTWATVGSCAQIGKNCHLSGGVGIGGVLEPLQAD 183

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           P IIEDNCFIGARSE+VEG I+  G+VL MGV++ K+T+I++R+TGE++ G VP+YSVVV
Sbjct: 184 PVIIEDNCFIGARSEVVEGVIVETGAVLSMGVYLSKTTRIVNRDTGEVSMGRVPAYSVVV 243

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PGS P   L     GP LYCAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 244 PGSMPGKPLPNGQPGPSLYCAVIVKQVDEQTRSKTSINDLLRD 286


>gi|114327350|ref|YP_744507.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Granulibacter bethesdensis CGDNIH1]
 gi|122327674|sp|Q0BUB8|DAPD_GRABC RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|114315524|gb|ABI61584.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Granulibacter bethesdensis CGDNIH1]
          Length = 280

 Score =  332 bits (851), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 199/278 (71%), Gaps = 1/278 (0%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           + +L + ID  +E     + +   + +DAV+  L LLD G +R+A     G W+ +QW+K
Sbjct: 3   IDSLRDSIDRLWENREGLSSATTGEARDAVEEALRLLDSGQVRVAEPKAEGGWSVNQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++  +   + G G    +DK+P KF+ W    F +  FR++PG +VR SAYI 
Sbjct: 63  KAVLLSFRLTDSTP-APGFGPVASYDKVPLKFEGWDQARFAQGGFRVVPGAVVRRSAYIA 121

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P  VLMPSFVN+GAY+  G+MIDTW+TVGSCAQ+GKN HISGG GIGGVLEP+Q GP +I
Sbjct: 122 PGVVLMPSFVNVGAYVDSGTMIDTWATVGSCAQVGKNCHISGGTGIGGVLEPLQAGPVVI 181

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDN FIGARSE+ EG ++ +GSV+ MGVFIG STKIIDR TGE+ YG VP+YSVVVPGS 
Sbjct: 182 EDNVFIGARSEVAEGVVVEQGSVISMGVFIGASTKIIDRATGEVLYGRVPAYSVVVPGSL 241

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           P   L     GP L CAVI+K+VDE+TRSKTSIN LLR
Sbjct: 242 PGKPLPDGTPGPSLACAVIVKRVDERTRSKTSINELLR 279


>gi|262277960|ref|ZP_06055753.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [alpha proteobacterium HIMB114]
 gi|262225063|gb|EEY75522.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [alpha proteobacterium HIMB114]
          Length = 269

 Score =  332 bits (851), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 162/276 (58%), Positives = 207/276 (75%), Gaps = 7/276 (2%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           +E+II+  +E     + +  + + DA+ +T++ +D+G IR+A +  +  W  HQWIKKAI
Sbjct: 1   MEKIINDAWENRAKIDGNSDKSILDAITTTIEKVDKGDIRVAEKKGD-EWVVHQWIKKAI 59

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF+ N  + ++    Y+TWWDK+  K   W   +F++ NFR++P  +VRH +YI    
Sbjct: 60  LLSFKTNEMQTLA--GPYATWWDKVKGKTAGWGHAEFKEANFRMVPNGVVRHGSYIAKNV 117

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPSFVN+GAY+ EG+MIDTW++VGSCAQ+GKN H+SGG GIGGVLEP+Q  PTIIEDN
Sbjct: 118 VLMPSFVNVGAYVDEGTMIDTWASVGSCAQVGKNCHVSGGAGIGGVLEPMQANPTIIEDN 177

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGARSEIVEG I+ EGSV+ MGVFIG+STKII+R TGE  YG++P YSVVVPGS P  
Sbjct: 178 CFIGARSEIVEGVIVGEGSVISMGVFIGQSTKIINRETGETIYGKIPPYSVVVPGSLPDK 237

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           N K    GP LYCAVI+K VDEKTRSKTSIN LLRD
Sbjct: 238 NGK----GPSLYCAVIVKTVDEKTRSKTSINDLLRD 269


>gi|294789519|ref|ZP_06754755.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Simonsiella muelleri ATCC 29453]
 gi|294482599|gb|EFG30290.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Simonsiella muelleri ATCC 29453]
          Length = 273

 Score =  332 bits (851), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 159/277 (57%), Positives = 208/277 (75%), Gaps = 8/277 (2%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L++II++ FE  ++   +++  +VK AV+ TL  LD G +R+A R D G W  ++W KK
Sbjct: 2   SLQQIIETAFENRADITPKTVTPEVKQAVEETLRQLDNGTLRVAERQDIGQWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I    ++  G+G + ++DK+P KF +W  +DF+   FR +PG + R  ++I  
Sbjct: 62  AVLLSFRIQDNVVL--GDGVNQYFDKVPTKFANWTQEDFQAAGFRAVPGAVARRGSFIAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NTVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV G+ P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGNLP 239

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S + K       LYCAVI+KKVD KTRSKTS+N LLR
Sbjct: 240 SQDGK-----YSLYCAVIVKKVDAKTRSKTSVNELLR 271


>gi|332185425|ref|ZP_08387173.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sphingomonas sp. S17]
 gi|332014403|gb|EGI56460.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sphingomonas sp. S17]
          Length = 275

 Score =  332 bits (851), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 156/276 (56%), Positives = 198/276 (71%), Gaps = 5/276 (1%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           L   ID+ +E       +   + + AV   L LLDRG  R+A  D  G W  +QW+KKA+
Sbjct: 5   LAATIDAAWENRAELGFATQGEARIAVDRALALLDRGEARVAEPDGQGGWTVNQWLKKAV 64

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++N   +I +G G   W+DK+P+KF  W   DF    FR +PG++VR  A++   A
Sbjct: 65  LLSFRLNDNVLIDNGPGAGHWFDKVPSKFSGWSEADFRAAGFRAVPGSVVRRGAHVAKGA 124

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           +LMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGG GIGGVLEP+Q GP IIED 
Sbjct: 125 ILMPSFVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGAGIGGVLEPLQAGPVIIEDG 184

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
            FIGAR+E+ EG  + EG+VL MGV++G STKIIDR TGE+  G VP YSVVVPG+ PS+
Sbjct: 185 AFIGARAEVAEGVRVGEGAVLSMGVYLGASTKIIDRETGEVFRGHVPPYSVVVPGTTPSV 244

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           + K     P LYCAVI+K+VD +TRSKTSIN LLRD
Sbjct: 245 DGK-----PGLYCAVIVKRVDAQTRSKTSINDLLRD 275


>gi|86570831|gb|ABD05388.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodopseudomonas palustris HaA2]
          Length = 310

 Score =  331 bits (849), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 163/278 (58%), Positives = 207/278 (74%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE  I++ F+  ++ + +   +++DAV   LDLLD+G  R+A R+ +G W  +QW+KK
Sbjct: 33  AALESTINTAFDARDTVSAATKGEIRDAVDHALDLLDKGEARVAEREASGTWTVNQWLKK 92

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N    I  G G + WWDK+P+KF+ W    F +  FR +PG IVR SA+I  
Sbjct: 93  AVLLSFRLNDMSTIPGGPGGANWWDKVPSKFEGWGENRFREAGFRAVPGAIVRRSAFIAK 152

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVLMPSFVN+GAY+ E +M+DTWSTVGSCAQIGK VHISGGVGIGGVLEP+Q GP IIE
Sbjct: 153 NAVLMPSFVNLGAYVDEATMVDTWSTVGSCAQIGKRVHISGGVGIGGVLEPLQAGPVIIE 212

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D+CFIGARSE+ EG I+R G+VL MGVF+G STKI+DR TGE   GEVP Y+V+VPG+ P
Sbjct: 213 DDCFIGARSEVAEGVIVRRGAVLAMGVFLGASTKIVDRETGETFIGEVPEYAVLVPGTLP 272

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              LK    GP   CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 273 GKPLKNGNPGPATACAVIVKRVDERTRSKTSINELLRD 310


>gi|163851001|ref|YP_001639044.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacterium extorquens PA1]
 gi|226724178|sp|A9W317|DAPD_METEP RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|163662606|gb|ABY29973.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacterium extorquens PA1]
          Length = 280

 Score =  331 bits (848), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 196/275 (71%), Gaps = 1/275 (0%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           LE+ I++ +EE    + +    V++AV   L+LLD G  R+A +  +  W  +QW+KKA+
Sbjct: 6   LEKTIEAAWEERAGISTATTGAVREAVDEALNLLDSGQARVAEKAGD-SWQVNQWLKKAV 64

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++N    I  G G S WWDK+P+KFD+W   +F    FR +PG  VR  +YI P A
Sbjct: 65  LLSFRLNDMVPIEGGPGSSAWWDKVPSKFDNWGEAEFRAAGFRAVPGCFVRRGSYIAPGA 124

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPSF+N+GA++GEG+M+DTW T+GSCAQ+GKN HISGG GI GVLEP+Q  P IIEDN
Sbjct: 125 VLMPSFINLGAHVGEGTMVDTWVTIGSCAQVGKNCHISGGAGIAGVLEPLQANPVIIEDN 184

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CF+GAR+E+ EG II EGSVL MGV+IG ST+IIDR TGE  YG VP YSVVV G+ P  
Sbjct: 185 CFVGARAEVAEGVIIGEGSVLSMGVYIGASTRIIDRTTGETFYGRVPPYSVVVSGTTPGK 244

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            L     GP LYCAVI+K+VD  TR+KT IN LLR
Sbjct: 245 PLPDGTPGPGLYCAVIVKRVDAGTRAKTGINELLR 279


>gi|240138132|ref|YP_002962604.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Methylobacterium extorquens AM1]
 gi|240008101|gb|ACS39327.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Methylobacterium extorquens AM1]
          Length = 280

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 196/275 (71%), Gaps = 1/275 (0%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           LE+ I++ +EE    + +    V++AV   L+LLD G  R+A +  +  W  +QW+KKA+
Sbjct: 6   LEKTIEAAWEERAGISTATTGAVREAVDEALNLLDSGQARVAEKAGD-SWQVNQWLKKAV 64

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++N    I  G G STWWDK+P+KF +W   +F    FR +PG  VR  +YI P A
Sbjct: 65  LLSFRLNDMVPIEGGPGSSTWWDKVPSKFANWGEAEFRAAGFRAVPGCFVRRGSYIAPGA 124

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPSF+N+GA++GEG+M+DTW T+GSCAQ+GKN HISGG GI GVLEP+Q  P IIEDN
Sbjct: 125 VLMPSFINLGAHVGEGTMVDTWVTIGSCAQVGKNCHISGGAGIAGVLEPLQANPVIIEDN 184

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CF+GAR+E+ EG II EGSVL MGV+IG ST+IIDR TGE  YG VP YSVVV G+ P  
Sbjct: 185 CFVGARAEVAEGVIIGEGSVLSMGVYIGASTRIIDRTTGETFYGRVPPYSVVVSGTTPGK 244

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            L     GP LYCAVI+K+VD  TR+KT IN LLR
Sbjct: 245 PLPDGTPGPGLYCAVIVKRVDAGTRAKTGINELLR 279


>gi|170750496|ref|YP_001756756.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacterium radiotolerans JCM 2831]
 gi|170657018|gb|ACB26073.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 291

 Score =  330 bits (845), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 151/277 (54%), Positives = 197/277 (71%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           S L + I++ +E+  + + +    V++AV++ L+LLD G  R+A +  N  W  +QW+KK
Sbjct: 14  SDLAQTIEAAWEDRANVSTATKGAVREAVEAALELLDSGKARVAEKSGNRDWVVNQWLKK 73

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N    I  G G + WWDK+ +KF  W   +F     R +PG  VR  +YI P
Sbjct: 74  AVLLSFRLNDMATIEGGPGGAPWWDKVASKFAGWGEAEFRAAGLRAVPGCFVRRGSYIAP 133

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVLMPSFVN+GA++GEG+M+DTW T+GSCAQ+GKN HISGG GI GVLEP+Q  P IIE
Sbjct: 134 GAVLMPSFVNLGAHVGEGTMVDTWVTIGSCAQVGKNCHISGGAGIAGVLEPLQANPVIIE 193

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D+CFIGAR+E+ EG I+ +GSVL MGV+IG STKI+DR TGE+ YG VP YSVVV G+ P
Sbjct: 194 DDCFIGARAEVAEGVIVGQGSVLSMGVYIGASTKIVDRTTGEVMYGRVPPYSVVVSGTMP 253

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
              L     GP LYCAVI+K+VD  TRSKT+IN LLR
Sbjct: 254 GKALPDGTPGPGLYCAVIVKRVDAGTRSKTAINELLR 290


>gi|217977389|ref|YP_002361536.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylocella silvestris BL2]
 gi|217502765|gb|ACK50174.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylocella silvestris BL2]
          Length = 285

 Score =  329 bits (844), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 162/282 (57%), Positives = 202/282 (71%), Gaps = 4/282 (1%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASR--DDNG--HWNTHQ 61
           + LE II++ FE+  + N     DV+ AV + L LLD G +R+A +   ++G   W  HQ
Sbjct: 4   TALETIIEAAFEDRANINAQTQGDVRKAVDAALHLLDAGKLRVAEKIAGESGPQSWRVHQ 63

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+LLSF++N    I  G G +TWWDK+P+KF  W  K+     FR +P  +VR SA
Sbjct: 64  WLKKAVLLSFRLNDMGEIPGGPGGATWWDKVPSKFAGWGAKEHAAAGFRSVPSCVVRRSA 123

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YI P  VLMPSFVN+GAY+ + +M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P
Sbjct: 124 YIAPGVVLMPSFVNLGAYVDQNTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANP 183

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIED+CFIGARSEIVEG I+ EG+V+ MG FI  STKIIDR TG+I  G VP +SVVV 
Sbjct: 184 TIIEDDCFIGARSEIVEGVIVGEGAVVSMGTFISASTKIIDRATGKIHIGYVPPFSVVVS 243

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           G+ P   L     GP LYCAVI+K VD +TR+KT+IN LLRD
Sbjct: 244 GNLPGKPLPDGSPGPSLYCAVIVKTVDAQTRAKTAINDLLRD 285


>gi|297182646|gb|ADI18804.1| tetrahydrodipicolinate N-succinyltransferase [uncultured SAR11
           cluster bacterium HF4000_37C10]
          Length = 275

 Score =  329 bits (843), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 158/279 (56%), Positives = 203/279 (72%), Gaps = 6/279 (2%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           + + +++ID  +++    N    + + +A+  T+DLLD G IR+A + +N  W  +QWIK
Sbjct: 3   LKSFQKVIDEAWDKKGQVNSKSSRKLLNAISKTIDLLDSGEIRVAEKKNN-EWTVNQWIK 61

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KAILLSF++N  K+ +    Y+TW+DK+  K   W  K   +  FR +P  +VR  A+I 
Sbjct: 62  KAILLSFRVN--KMKTSKGPYATWYDKVEGKTQKWNEKKLIQAGFRSVPNGVVRKGAFIA 119

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSFVN+GAY+ EGSMIDTW++VGSCAQ+GKN HISGG GIGGVLEP+Q  P II
Sbjct: 120 KNVVLMPSFVNLGAYVDEGSMIDTWASVGSCAQVGKNCHISGGAGIGGVLEPLQANPVII 179

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGAR+E+ EG I+ +GSVL MGV+IG ST+IIDR TGE  YG+VP+YSVVVPGS 
Sbjct: 180 EDNCFIGARAEVAEGVIVEKGSVLSMGVYIGASTRIIDRATGETIYGKVPAYSVVVPGSM 239

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PS   K +  GP LYC +I+KKVDEKTRSKTSIN LLRD
Sbjct: 240 PS---KNNPDGPSLYCVIIVKKVDEKTRSKTSINDLLRD 275


>gi|188580919|ref|YP_001924364.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacterium populi BJ001]
 gi|226724179|sp|B1ZGG8|DAPD_METPB RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|179344417|gb|ACB79829.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacterium populi BJ001]
          Length = 280

 Score =  328 bits (842), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 154/277 (55%), Positives = 195/277 (70%), Gaps = 1/277 (0%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE+ I++ +EE    + +    V++AV   L+LLD G  R+A +  +  W  +QW+KK
Sbjct: 4   ANLEQTIEAAWEERAGISTATTGAVREAVDEALNLLDSGKARVAEKAGD-AWQVNQWLKK 62

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N    I  G G S WWDK+P+KF  W   +F    FR +PG  VR  +YI P
Sbjct: 63  AVLLSFRLNDMVPIEGGPGSSAWWDKVPSKFSGWGETEFRAAGFRAVPGCFVRRGSYIAP 122

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVLMPSF+N+GA++GEG+M+DTW T+GSCAQ+GKN HISGG GI GVLEP+Q  P IIE
Sbjct: 123 GAVLMPSFINLGAHVGEGTMVDTWVTIGSCAQVGKNCHISGGAGIAGVLEPLQANPVIIE 182

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGAR+E+ EG I+ EGSVL MGV+IG ST+IIDR TGE  YG VP YSVVV G+ P
Sbjct: 183 DNCFIGARAEVAEGVIVGEGSVLSMGVYIGASTRIIDRTTGETFYGRVPPYSVVVSGTTP 242

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
              L     GP LYCAVI+K+VD  TR+KT IN LLR
Sbjct: 243 GKPLPDGTPGPGLYCAVIVKRVDAGTRAKTGINELLR 279


>gi|40062657|gb|AAR37578.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [uncultured marine bacterium 313]
          Length = 275

 Score =  328 bits (842), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 160/277 (57%), Positives = 200/277 (72%), Gaps = 6/277 (2%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           + E II+  +      N    + + +A+  T+DLLD G IR+A + +N  W  +QWIKKA
Sbjct: 5   SFENIINEAWNNKGQVNSKSSRKLLNAISKTIDLLDSGEIRVAEKKNN-EWTANQWIKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           ILLSF++N  K+ +    Y+TW+DK+  K   W  K   +  FR +P   VR  A+I   
Sbjct: 64  ILLSFRVN--KMKTSKGPYATWYDKVEGKTQKWNEKKLIQAGFRSVPNGAVRKGAFIAKN 121

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPSFVN+GAY+ EGSMIDTW++VGSCAQ+GKN HISGG GIGGVLEP+Q  PTI+ED
Sbjct: 122 VVLMPSFVNIGAYVDEGSMIDTWASVGSCAQVGKNCHISGGAGIGGVLEPMQANPTIVED 181

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCF+GAR+EI EG I+ +GSVL MGV+IG ST+IIDR TGEI YG+VP+YSVVVPGS PS
Sbjct: 182 NCFVGARAEIAEGVIVEKGSVLSMGVYIGASTRIIDRATGEIIYGKVPAYSVVVPGSMPS 241

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              K +  GP LYC +I+KKVDEKTRSKTSIN LLRD
Sbjct: 242 ---KNNPDGPSLYCVIIVKKVDEKTRSKTSINDLLRD 275


>gi|218529828|ref|YP_002420644.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacterium chloromethanicum CM4]
 gi|254560694|ref|YP_003067789.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Methylobacterium extorquens DM4]
 gi|218522131|gb|ACK82716.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacterium chloromethanicum CM4]
 gi|254267972|emb|CAX23840.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Methylobacterium extorquens DM4]
          Length = 280

 Score =  328 bits (841), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 154/275 (56%), Positives = 195/275 (70%), Gaps = 1/275 (0%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           LE+ I++ +EE    + +    V++AV   L+LLD G  R+A +  +  W  +QW+KKA+
Sbjct: 6   LEKTIEAAWEERAGISTATTGAVREAVDEALNLLDSGQARVAEKAGD-SWQVNQWLKKAV 64

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++N    I  G G S WWDK+P+KF +W   +F    FR +PG  VR  +YI P A
Sbjct: 65  LLSFRLNDMVPIEGGPGSSAWWDKVPSKFANWGEAEFRAAGFRAVPGCFVRRGSYIAPGA 124

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPSF+N+GA++GEG+M+DTW T+GSCAQ+GKN HISGG GI GVLEP+Q  P IIEDN
Sbjct: 125 VLMPSFINLGAHVGEGTMVDTWVTIGSCAQVGKNCHISGGAGIAGVLEPLQANPVIIEDN 184

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CF+GAR+E+ EG II EGSVL MGV+IG ST+IIDR TGE  YG VP YSVVV G+ P  
Sbjct: 185 CFVGARAEVAEGVIIGEGSVLSMGVYIGASTRIIDRTTGETFYGRVPPYSVVVSGTTPGK 244

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            L     GP LYCAVI+K+VD  TR+KT IN LLR
Sbjct: 245 PLPDGTPGPGLYCAVIVKRVDAGTRAKTGINELLR 279


>gi|329848418|ref|ZP_08263446.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Asticcacaulis biprosthecum C19]
 gi|328843481|gb|EGF93050.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Asticcacaulis biprosthecum C19]
          Length = 282

 Score =  328 bits (840), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 157/285 (55%), Positives = 208/285 (72%), Gaps = 12/285 (4%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++  ++ I++ +E  ++ N       ++AVQ  L+LLD G  R+A + D G W+T+QW+K
Sbjct: 4   LAAFKDDIEAAWEVRDTLNPDYRGPYREAVQGALELLDSGRFRVADKVD-GVWHTNQWLK 62

Query: 65  KAILLSFQINPTKIISDGNGY------STWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVR 118
           KA+LLSF++   +++  G G         +WDK+P KF  W  +DF+K  FR +PG IVR
Sbjct: 63  KAVLLSFRLAANELMHTGRGLFEQAPLGPYWDKVPNKFAKWNAEDFQKAGFRAVPGAIVR 122

Query: 119 HSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQ 178
             AY+    VLMPSFVN+GAY+ EG+M+D WSTVGSCAQIGKNVH+SGGVGIGGVLEP+Q
Sbjct: 123 QGAYVARNVVLMPSFVNIGAYVDEGTMVDGWSTVGSCAQIGKNVHLSGGVGIGGVLEPLQ 182

Query: 179 TGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSV 238
             PTIIED+CFIGARSE+ EG ++ +GSVL MGV++  ST+I+DR TGE+  G VP+YSV
Sbjct: 183 ANPTIIEDDCFIGARSEVAEGVVVEQGSVLSMGVYLSASTRIVDRATGEVFRGRVPAYSV 242

Query: 239 VVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           VVPG+YP  + KG   GP LYCAVI+K+VD +TRSKT IN LLRD
Sbjct: 243 VVPGAYP--DPKG---GPSLYCAVIVKRVDAQTRSKTGINELLRD 282


>gi|300311477|ref|YP_003775569.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Herbaspirillum seropedicae SmR1]
 gi|124483580|emb|CAM32663.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Herbaspirillum seropedicae]
 gi|300074262|gb|ADJ63661.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           protein [Herbaspirillum seropedicae SmR1]
          Length = 277

 Score =  328 bits (840), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 208/280 (74%), Gaps = 6/280 (2%)

Query: 4   IVSTLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +  ++++IID  +E+  S + +S P D+++AV   +  L+ G +R+A+R   G W  +QW
Sbjct: 1   MTQSIQQIIDQAWEDRASLSPKSAPADIRNAVAEVIAGLNDGTLRVANRQGVGQWEVNQW 60

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKAILLSF++     +S G GY  ++DK+P KF ++  +DF K  FR++P  + RH ++
Sbjct: 61  VKKAILLSFRLEDNVPMSAGTGYPQFYDKVPTKFANYTAEDFAKGGFRVVPPAVARHGSF 120

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           IG   VLMPS+VN+GAY+ EG+M+DTW+TVGS AQIGKNVH+SGGVGIGGVLEP+Q GP 
Sbjct: 121 IGRNVVLMPSYVNIGAYVDEGTMVDTWATVGSAAQIGKNVHLSGGVGIGGVLEPVQAGPV 180

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEG II E SVL MGV+IG+STKI DR TGE+ YG VP+ SVVVPG
Sbjct: 181 IIEDNCFIGARSEVVEGVIIEENSVLSMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVPG 240

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           + PS + K       LY A+I+KKVD +TRSKTSIN LLR
Sbjct: 241 NLPSKDGK-----YSLYAAIIVKKVDAQTRSKTSINELLR 275


>gi|294085065|ref|YP_003551825.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664640|gb|ADE39741.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 286

 Score =  327 bits (839), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 160/283 (56%), Positives = 206/283 (72%), Gaps = 5/283 (1%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + LE+ ID+ ++  +S N      V+DAV   L++LD G +R+A    +  W  +QW+KK
Sbjct: 4   AQLEQEIDAAWDARDSVNADTKGAVRDAVTDVLEMLDNGTVRVAEPMGDHQWQVNQWLKK 63

Query: 66  AILLSFQINPTKIISDG-----NGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           A+LLSF++N   +I  G      G +T+WDK+P KF  W  K F    FR +PG +VRHS
Sbjct: 64  AVLLSFRLNDMTVIKGGVVHPQAGEATFWDKVPPKFSGWDEKRFRDAGFRAVPGCVVRHS 123

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           AY+ P  V+MP F+N+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGG GIGGVLEP+Q G
Sbjct: 124 AYVAPGVVIMPGFINLGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGAGIGGVLEPLQAG 183

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           P +IED+CFIGARSE+VEG ++ +G+VL MGVFIG STKII+R+TGE+  G VP+YSVVV
Sbjct: 184 PVVIEDDCFIGARSEVVEGVVVEKGAVLSMGVFIGASTKIINRHTGEVHMGRVPAYSVVV 243

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PGS P   L     GP L CAVIIK+VDEKTRSKTS+N LLRD
Sbjct: 244 PGSLPGKPLPDGSPGPSLSCAVIIKQVDEKTRSKTSVNDLLRD 286


>gi|225025109|ref|ZP_03714301.1| hypothetical protein EIKCOROL_02001 [Eikenella corrodens ATCC
           23834]
 gi|224942070|gb|EEG23279.1| hypothetical protein EIKCOROL_02001 [Eikenella corrodens ATCC
           23834]
          Length = 273

 Score =  327 bits (838), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 161/278 (57%), Positives = 206/278 (74%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE+ +     S+  +VK+AV  TL  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFEQRAEITPHSVSAEVKEAVLDTLYQLDSGSLRVAERQGVGQWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++ SDG   S ++DK+P KF DW  + F+   FR +PG + R  ++IG 
Sbjct: 62  AVLLSFRIADNEVSSDG--VSKYFDKVPTKFADWIPQQFQVAGFRAVPGAVARRGSFIGK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGSLP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           + +      G H LYCAVI+KKVD +TR+KTS+N LLR
Sbjct: 240 AKD------GTHSLYCAVIVKKVDAQTRAKTSVNELLR 271


>gi|148652704|ref|YP_001279797.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Psychrobacter sp. PRwf-1]
 gi|172048518|sp|A5WDV6|DAPD_PSYWF RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|148571788|gb|ABQ93847.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Psychrobacter sp. PRwf-1]
          Length = 273

 Score =  327 bits (837), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 163/278 (58%), Positives = 206/278 (74%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +LE+II+  FE+ +     ++PQ+VKDAV S LD LD G +R+A + D G W  +QW KK
Sbjct: 2   SLEQIIEQAFEKRAEYSPATMPQEVKDAVNSVLDQLDNGSLRVAEKKD-GEWIVNQWAKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N    +  G  +  ++DK+P KF +W  + F +   R++P  + R  ++I  
Sbjct: 61  AVLLSFRLNDNYPMQTGE-HVQFYDKVPTKFANWTEQQFVEAGVRVVPPAVARRGSFIAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+ N+GAY+ EG+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 GVVLMPSYTNIGAYVDEGAMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEITYG VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEITYGRVPAGSVVVSGSLP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+KKVD +TRSKTSIN LLR
Sbjct: 240 SKD------GSHSLYCAVIVKKVDAQTRSKTSINELLR 271


>gi|296535609|ref|ZP_06897789.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseomonas cervicalis ATCC 49957]
 gi|296264064|gb|EFH10509.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Roseomonas cervicalis ATCC 49957]
          Length = 275

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 196/276 (71%), Gaps = 3/276 (1%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           L   I + +E     + +     ++A++S L+LLD G  R+A  D  G W  +QW+K+A+
Sbjct: 3   LAATIAALWERRAELSPATRGAEREAIESALELLDSGRARVAEPDGQGGWKVNQWLKQAV 62

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++  +K++  G G    +DK+P KF DW    F +  FR +PG +VR SA+IG   
Sbjct: 63  LLSFRLEDSKVMPTGFGA---YDKVPLKFADWGENRFREAGFRAVPGAVVRRSAFIGKGV 119

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPSFVN+GAY+ E +M+DTW+T+GSCAQIGKN HISGG GIGGVLEP+Q  P +I DN
Sbjct: 120 VLMPSFVNLGAYVDENTMVDTWATIGSCAQIGKNCHISGGAGIGGVLEPLQANPVVIGDN 179

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CF+GARSE+ EG I+ EGSVL MGVF+G STKI+DR TGE+  G+VP YSVVVPGS P  
Sbjct: 180 CFVGARSEVAEGVIVGEGSVLSMGVFLGASTKIVDRATGEVFMGQVPPYSVVVPGSLPGK 239

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            L     GP LYCAVI+K+VD +TRSKTSIN LLRD
Sbjct: 240 ALPDGSQGPGLYCAVIVKRVDAQTRSKTSINELLRD 275


>gi|296775672|gb|ADH42949.1| tetrahydrodipicolinate N-succinyltransferase [uncultured SAR11
           cluster alpha proteobacterium H17925_23J24]
          Length = 274

 Score =  325 bits (834), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 158/279 (56%), Positives = 208/279 (74%), Gaps = 7/279 (2%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +  +E+ I+  F+ +  K +S  + + D V+ T++LLD G IR+A +  +G W  +QWIK
Sbjct: 3   LEKIEKTINEAFK-NKEKIDSSDKALNDVVRETINLLDNGKIRVAEKK-SGKWQVNQWIK 60

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           K+ILLSF++N  K+ +    YSTW+DK+  K   W  +  +K  FR +P  ++R  A+I 
Sbjct: 61  KSILLSFRVN--KMKASKGPYSTWYDKVDGKTQGWSEEQVKKAGFRYVPNGVIRKGAHIA 118

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPSF+N+GAY+ EG+MIDTW++VGSCAQ+GKN HISGG GIGGVLEP+Q  PTI+
Sbjct: 119 KNVVLMPSFINVGAYVDEGTMIDTWASVGSCAQVGKNCHISGGAGIGGVLEPMQANPTIV 178

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCF+GAR+EI EG I+ +GSVL MGV+IG ST+I+DR TGEI YG+VP+YSVVVPGS 
Sbjct: 179 EDNCFLGARAEIAEGVIVEKGSVLSMGVYIGASTRIVDRATGEIHYGKVPAYSVVVPGSM 238

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PS   K + +GP LYC VI+KKVDEKTRSKTSIN LLRD
Sbjct: 239 PS---KNNPSGPSLYCVVIVKKVDEKTRSKTSINDLLRD 274


>gi|256823137|ref|YP_003147100.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Kangiella koreensis DSM 16069]
 gi|256796676|gb|ACV27332.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylateN-succinyltransferase
           [Kangiella koreensis DSM 16069]
          Length = 274

 Score =  324 bits (830), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 160/277 (57%), Positives = 204/277 (73%), Gaps = 9/277 (3%)

Query: 7   TLEEIIDSFFEESNSKNE-SIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+  I+  FE  +  +  S PQDVK+AV   L+LLD G  R+A + D G W  HQW+KK
Sbjct: 2   SLQTTIEQAFENRDQLSPGSAPQDVKEAVSEALNLLDSGKARVAEKID-GDWVVHQWLKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N  K+I    G + ++DK+P K+ +   ++F+    R++P  I RH ++I  
Sbjct: 61  AVLLSFRLNDNKVID--TGLAQFYDKVPMKYQNMTEEEFKAGGTRVVPHAIARHGSFIAK 118

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+ N+GAYI EG+MIDTW+TVGSCAQIGKNVH+SGG GIGGVLEP+Q GPTIIE
Sbjct: 119 NVVLMPSYTNIGAYIDEGAMIDTWATVGSCAQIGKNVHLSGGAGIGGVLEPLQAGPTIIE 178

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+ EGSVL MGVF+G+STKI +R T E+TYG VP+ SVVVPGS P
Sbjct: 179 DNCFIGARSEVVEGIIVEEGSVLSMGVFLGQSTKIYNRLTDEVTYGRVPAGSVVVPGSLP 238

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S     D    +L CAVI+K+VD KTR+KTSIN LLR
Sbjct: 239 S-----DCGKYNLNCAVIVKQVDAKTRAKTSINDLLR 270


>gi|329118062|ref|ZP_08246774.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465722|gb|EGF11995.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria bacilliformis ATCC BAA-1200]
          Length = 273

 Score =  324 bits (830), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 205/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  +    +++  +VK AV+ TL  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRAQIAPQTVSAEVKQAVEETLRQLDSGTLRVAERRGVGQWQVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF  W   +F    FR +PG + R  +++G 
Sbjct: 62  AVLLSFRIADNEVLNDG--VNQYFDKVPTKFAGWSEDEFRAAGFRAVPGAVARRGSFVGK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q+ PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQSAPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGSLP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           + +      G H LYCAVI+KKVD +T +KTS+N LLR
Sbjct: 240 AKD------GSHSLYCAVIVKKVDAQTHTKTSVNELLR 271


>gi|260753054|ref|YP_003225947.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552417|gb|ACV75363.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 276

 Score =  324 bits (830), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 158/279 (56%), Positives = 197/279 (70%), Gaps = 6/279 (2%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S L +IID  FE+  +   +   +V +AV+  L LLD G  R+A   DNG W  +QW+K
Sbjct: 1   MSDLIKIIDQAFEDRANITPATKGEVVEAVEEALSLLDSGKRRVAELGDNGEWVVNQWLK 60

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++     ++ G      +DK+P KF +W    F++  FR +PG +VR  A+I 
Sbjct: 61  KAVLLSFRLTGNAPMNGG------YDKVPLKFANWSEDQFKQAGFRAVPGAVVRRGAFIS 114

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
             AVLMPSFVN+GAY+GE +M+DTW+TVGSCAQIG NVHISGG GIGGVLEP+Q GP II
Sbjct: 115 KGAVLMPSFVNIGAYVGENTMVDTWATVGSCAQIGANVHISGGAGIGGVLEPLQAGPVII 174

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
            DN FIGARSE+ EG  + EG+VL MGVFIG ST+IIDR TGEI  G+VP Y+VVVPGS 
Sbjct: 175 GDNAFIGARSEVAEGVTVGEGAVLSMGVFIGASTRIIDRATGEIHMGKVPPYAVVVPGSL 234

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   L     GP LYCAVI+K  DE+TRSKTSIN LLR+
Sbjct: 235 PGKPLPDGRPGPSLYCAVIVKTADERTRSKTSINQLLRE 273


>gi|325266971|ref|ZP_08133642.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Kingella denitrificans ATCC 33394]
 gi|324981712|gb|EGC17353.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Kingella denitrificans ATCC 33394]
          Length = 334

 Score =  324 bits (830), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 161/281 (57%), Positives = 206/281 (73%), Gaps = 16/281 (5%)

Query: 7   TLEEIIDSFFEESNSKNESIPQ----DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +L+ II++ FE   ++ E  PQ    +VK+AV  TL  LD G +R+A R   G W  ++W
Sbjct: 63  SLQNIIETAFE---NRAEITPQTVSPEVKEAVLETLRQLDNGSLRVAERLGVGQWKVNEW 119

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
            KKA+LLSF+I    ++  G+G + ++DK+P KF  W   DF+   FR +PG + R  ++
Sbjct: 120 AKKAVLLSFRIQDNVVL--GDGVNQFFDKVPTKFAQWTQADFQAAGFRAVPGAVARRGSF 177

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           +G   VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PT
Sbjct: 178 VGKNVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPT 237

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV G
Sbjct: 238 IIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSG 297

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S P+ +      G H LYCAVI+KKVD +TRSKTS+N LLR
Sbjct: 298 SLPAKD------GSHSLYCAVIVKKVDAQTRSKTSVNELLR 332


>gi|56551327|ref|YP_162166.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Zymomonas mobilis subsp. mobilis ZM4]
 gi|71153320|sp|Q5NQF0|DAPD_ZYMMO RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|56542901|gb|AAV89055.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 276

 Score =  323 bits (829), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 158/279 (56%), Positives = 197/279 (70%), Gaps = 6/279 (2%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S L +IID  FE+  +   +   +V +AV+  L LLD G  R+A   DNG W  +QW+K
Sbjct: 1   MSDLIKIIDQAFEDRANITPATKGEVVEAVEEALSLLDSGKRRVAELGDNGEWVVNQWLK 60

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++     ++ G      +DK+P KF +W    F++  FR +PG +VR  A+I 
Sbjct: 61  KAVLLSFRLTGNAPMNGG------YDKVPLKFTNWSEDQFKQAGFRAVPGAVVRRGAFIS 114

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
             AVLMPSFVN+GAY+GE +M+DTW+TVGSCAQIG NVHISGG GIGGVLEP+Q GP II
Sbjct: 115 KGAVLMPSFVNIGAYVGENTMVDTWATVGSCAQIGANVHISGGAGIGGVLEPLQAGPVII 174

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
            DN FIGARSE+ EG  + EG+VL MGVFIG ST+IIDR TGEI  G+VP Y+VVVPGS 
Sbjct: 175 GDNAFIGARSEVAEGVTVGEGAVLSMGVFIGASTRIIDRATGEIHMGKVPPYAVVVPGSL 234

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   L     GP LYCAVI+K  DE+TRSKTSIN LLR+
Sbjct: 235 PGKPLPDGRPGPSLYCAVIVKTADERTRSKTSINQLLRE 273


>gi|258541765|ref|YP_003187198.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256632843|dbj|BAH98818.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256635900|dbj|BAI01869.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256638955|dbj|BAI04917.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256642009|dbj|BAI07964.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256645064|dbj|BAI11012.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256648119|dbj|BAI14060.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256651172|dbj|BAI17106.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654163|dbj|BAI20090.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 282

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 202/279 (72%), Gaps = 3/279 (1%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           TL   I++ +E+ +  + +   + + A+++ L+ LD G +R+A   ++G W  ++W+KKA
Sbjct: 5   TLRAHIEALWEKRDQISSATTGEDRKAIETALEALDSGALRVAEPKEDG-WQVNEWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++N +  I  G   +  +DK+P KF  W    F+K  FR++PG +VR SA+I P 
Sbjct: 64  VLLSFRLNDSVAIPGGAAGAPAYDKVPLKFAGWDQARFDKAGFRVVPGAVVRRSAFIAPG 123

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           AVLMPSFVN+GA +  G+M+DTW+TVGSCAQIGKN HISGG GIGGVLEP+Q  P IIED
Sbjct: 124 AVLMPSFVNVGARVDSGTMVDTWATVGSCAQIGKNCHISGGAGIGGVLEPLQAAPVIIED 183

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+ EG I+  GSVL MGVF+G STKI+DR TGEI  G VP+YSVVVPG+ PS
Sbjct: 184 NCFIGARSEVAEGVIVERGSVLSMGVFLGASTKIVDRATGEIYMGRVPAYSVVVPGTMPS 243

Query: 247 INLKGDIAGPH--LYCAVIIKKVDEKTRSKTSINTLLRD 283
               G    P+  L CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 244 SKPVGPDGRPNPALACAVIVKRVDERTRSKTSINDLLRD 282


>gi|226327060|ref|ZP_03802578.1| hypothetical protein PROPEN_00921 [Proteus penneri ATCC 35198]
 gi|225204278|gb|EEG86632.1| hypothetical protein PROPEN_00921 [Proteus penneri ATCC 35198]
          Length = 274

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 160/279 (57%), Positives = 203/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ IID+ FE  ++    ++   ++DA+ S + LLD G +R+A +  NG W THQW+
Sbjct: 1   MQALQSIIDNAFEHRADLTPNNVEPHIRDAINSVIALLDSGKLRVAEKI-NGQWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  ++I+     S ++DK+P KF D+    FEK  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINHNQVINGSE--SRYFDKVPMKFADYDQARFEKEGFRVVPPAAVRQGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EG+V+ MGV+IG+STKI DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGAVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|71065298|ref|YP_264025.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Psychrobacter arcticus 273-4]
 gi|82592818|sp|Q4FTR7|DAPD_PSYA2 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|71038283|gb|AAZ18591.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Psychrobacter arcticus 273-4]
          Length = 273

 Score =  323 bits (828), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 206/278 (74%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L++ I+  FE  N  +  ++PQDV+DA+   L+ LD G +R+A + D G W  +QW KK
Sbjct: 2   SLQQTIEQAFENRNEYSPATMPQDVRDAINQVLEQLDNGTLRVAEKKD-GEWVVNQWAKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N   + + G  +  ++DK+P KF DW    F++   R++P  + R  +YI P
Sbjct: 61  AVLLSFRLNDNYVQAAGE-HIQFYDKVPTKFADWTEAQFKEAGVRVVPPAVARKGSYIAP 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVLMPS+VN+GAY+ +G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 GAVLMPSYVNIGAYVDQGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EG+V+ MGV+IG+ST+I DR TGEI  G VP+ SVVVPGS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGAVISMGVYIGQSTRIYDRETGEIHRGRVPAGSVVVPGSLP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 240 SED------GTHSLYAAIIVKKVDAQTRAKTSVNELLR 271


>gi|59801992|ref|YP_208704.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae FA 1090]
 gi|194099549|ref|YP_002002679.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae NCCP11945]
 gi|240118739|ref|ZP_04732801.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae PID1]
 gi|240126489|ref|ZP_04739375.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae SK-92-679]
 gi|254494541|ref|ZP_05107712.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae 1291]
 gi|260439728|ref|ZP_05793544.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae DGI2]
 gi|268595567|ref|ZP_06129734.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae 35/02]
 gi|268597602|ref|ZP_06131769.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae FA19]
 gi|268599853|ref|ZP_06134020.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae MS11]
 gi|268602188|ref|ZP_06136355.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae PID18]
 gi|268604453|ref|ZP_06138620.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae PID1]
 gi|268682907|ref|ZP_06149769.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae PID332]
 gi|268685073|ref|ZP_06151935.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae SK-92-679]
 gi|268687337|ref|ZP_06154199.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae SK-93-1035]
 gi|291042976|ref|ZP_06568714.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae DGI2]
 gi|293398320|ref|ZP_06642511.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae F62]
 gi|71153295|sp|Q5F695|DAPD_NEIG1 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724181|sp|B4RNN0|DAPD_NEIG2 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|59718887|gb|AAW90292.1| putative 2,3,4,5-tetrahydropyridine-2-carboxylate
           N-succinyltransferase [Neisseria gonorrhoeae FA 1090]
 gi|193934839|gb|ACF30663.1| DapD [Neisseria gonorrhoeae NCCP11945]
 gi|226513581|gb|EEH62926.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae 1291]
 gi|268548956|gb|EEZ44374.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae 35/02]
 gi|268551390|gb|EEZ46409.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae FA19]
 gi|268583984|gb|EEZ48660.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae MS11]
 gi|268586319|gb|EEZ50995.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae PID18]
 gi|268588584|gb|EEZ53260.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae PID1]
 gi|268623191|gb|EEZ55591.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae PID332]
 gi|268625357|gb|EEZ57757.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae SK-92-679]
 gi|268627621|gb|EEZ60021.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae SK-93-1035]
 gi|291013115|gb|EFE05084.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae DGI2]
 gi|291611244|gb|EFF40328.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria gonorrhoeae F62]
          Length = 273

 Score =  323 bits (827), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 206/278 (74%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPTTVAPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F+   FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFKNAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NAVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGAIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSLP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|294670553|ref|ZP_06735432.1| hypothetical protein NEIELOOT_02275 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307678|gb|EFE48921.1| hypothetical protein NEIELOOT_02275 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 273

 Score =  323 bits (827), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 157/278 (56%), Positives = 206/278 (74%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  TL  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPATVTPEVKEAVLETLRQLDSGSLRVAERLGVGQWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++ +DG   + ++DK+P KF DW  ++F    FR +PG + R  ++IG 
Sbjct: 62  AVLLSFRIQDNEVQNDG--VNKYFDKVPTKFADWSEEEFRAAGFRAVPGAVARRGSFIGK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NTVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGSLP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           + +      G H LYCA+I+KKVD +TR+KTS+N LLR
Sbjct: 240 AKD------GSHSLYCAIIVKKVDAQTRAKTSVNELLR 271


>gi|329114451|ref|ZP_08243213.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acetobacter pomorum DM001]
 gi|326696527|gb|EGE48206.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acetobacter pomorum DM001]
          Length = 282

 Score =  323 bits (827), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 202/279 (72%), Gaps = 3/279 (1%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           TL   I++ +E+ +  + +   + + A+++ L+ LD G +R+A   ++G W  ++W+KKA
Sbjct: 5   TLRAHIETLWEKRDQISSATTGEDRKAIETALEALDSGALRVAEPKEDG-WQVNEWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++N +  I  G   +  +DK+P KF  W    F+K  FR++PG +VR SA+I P 
Sbjct: 64  VLLSFRLNDSVAIPGGAAGAPAYDKVPLKFAGWDQARFDKAGFRVVPGAVVRRSAFIAPG 123

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           AVLMPSFVN+GA +  G+M+DTW+TVGSCAQIGKN HISGG GIGGVLEP+Q  P IIED
Sbjct: 124 AVLMPSFVNVGARVDSGTMVDTWATVGSCAQIGKNCHISGGAGIGGVLEPLQAAPVIIED 183

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+ EG I+  GSVL MGVF+G STKI+DR TGEI  G VP+YSVVVPG+ PS
Sbjct: 184 NCFIGARSEVAEGVIVERGSVLSMGVFLGASTKIVDRATGEIYMGRVPAYSVVVPGTMPS 243

Query: 247 INLKGDIAGPH--LYCAVIIKKVDEKTRSKTSINTLLRD 283
               G    P+  L CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 244 SKPVGPDGRPNPALACAVIVKRVDERTRSKTSINDLLRD 282


>gi|87199852|ref|YP_497109.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Novosphingobium aromaticivorans DSM 12444]
 gi|123489442|sp|Q2G798|DAPD_NOVAD RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|87135533|gb|ABD26275.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 279

 Score =  323 bits (827), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 152/278 (54%), Positives = 200/278 (71%), Gaps = 2/278 (0%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           ++LE  I++ +E+  +   +    V++ V++ L+LLD G  R+A + D G W  +QW+KK
Sbjct: 4   ASLEAAIEAAWEDRANVTPA-SDAVREVVEAALELLDSGKARVAEKID-GQWQVNQWLKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N   +I  G G +  +DK+P+KF  W    F +  FR++PG + R  A+IG 
Sbjct: 62  AVLLSFRLNDNAVIDHGAGGAPAFDKVPSKFSGWGENRFREAGFRVVPGAVARKGAHIGK 121

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GA++ EG+M+DTW+TVGSCAQIGKNVHISGG GIGGVLEP+Q GP IIE
Sbjct: 122 GVVLMPSFVNIGAFVDEGTMVDTWATVGSCAQIGKNVHISGGAGIGGVLEPLQAGPVIIE 181

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D  FIGARSE+ EG I+ EG+VL MGV++G STKI+DR TGE+  G VP Y+VVVPG+ P
Sbjct: 182 DGAFIGARSEVAEGVIVGEGAVLSMGVYLGASTKIVDRQTGEVHIGRVPPYAVVVPGAMP 241

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              L     GP LYCAVI+K VD +TRSKT IN LLRD
Sbjct: 242 GKPLPDGTPGPSLYCAVIVKTVDAQTRSKTGINELLRD 279


>gi|241760980|ref|ZP_04759069.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241374599|gb|EER64060.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 276

 Score =  323 bits (827), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 158/279 (56%), Positives = 196/279 (70%), Gaps = 6/279 (2%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S L +IID  FE+  +   +    V +AV+  L LLD G  R+A   DNG W  +QW+K
Sbjct: 1   MSDLIKIIDQAFEDRANITPATKGAVVEAVEEALSLLDSGKRRVAELGDNGEWVVNQWLK 60

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++     ++ G      +DK+P KF +W    F++  FR +PG +VR  A+I 
Sbjct: 61  KAVLLSFRLTGNAPMNGG------YDKVPLKFANWSEDQFKQAGFRAVPGAVVRRGAFIS 114

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
             AVLMPSFVN+GAY+GE +M+DTW+TVGSCAQIG NVHISGG GIGGVLEP+Q GP II
Sbjct: 115 KGAVLMPSFVNIGAYVGENTMVDTWATVGSCAQIGANVHISGGAGIGGVLEPLQAGPVII 174

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
            DN FIGARSE+ EG  + EG+VL MGVFIG ST+IIDR TGEI  G+VP Y+VVVPGS 
Sbjct: 175 GDNAFIGARSEVAEGVTVGEGAVLSMGVFIGASTRIIDRATGEIHMGKVPPYAVVVPGSL 234

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P   L     GP LYCAVI+K  DE+TRSKTSIN LLR+
Sbjct: 235 PGKPLPDGRPGPSLYCAVIVKTADERTRSKTSINQLLRE 273


>gi|303258047|ref|ZP_07344055.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderiales bacterium 1_1_47]
 gi|331000678|ref|ZP_08324330.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Parasutterella excrementihominis YIT 11859]
 gi|302859066|gb|EFL82149.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderiales bacterium 1_1_47]
 gi|329570831|gb|EGG52546.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Parasutterella excrementihominis YIT 11859]
          Length = 268

 Score =  322 bits (826), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 160/279 (57%), Positives = 207/279 (74%), Gaps = 11/279 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +  L++II+  F     + E  P +V+++V   + LL +G +R+A + D G W TH+WIK
Sbjct: 1   MEALKQIIEQSF---GLRPEHFPPEVQNSVDEVIKLLQQGKLRVAEKID-GEWVTHEWIK 56

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSFQ+ P K++  G+   +++DK+P++FD +   D+++   R +P  + RH +YI 
Sbjct: 57  KAVLLSFQLYPNKMVRAGD--LSFFDKVPSRFDHFSEADWKESGIRCVPTAVARHGSYIA 114

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P  VLMPSFVN+GAYIGE +M+DTWSTVGSCAQ+GKN H+SGGVGIGGVLEP+Q  PTII
Sbjct: 115 PSVVLMPSFVNIGAYIGENTMVDTWSTVGSCAQVGKNCHLSGGVGIGGVLEPLQATPTII 174

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSEIVEG I+ E SV+ MGVFIG+STKI DR TGEI  G VP+ SVVVPGS 
Sbjct: 175 EDNCFIGARSEIVEGVIVEENSVISMGVFIGQSTKIYDRTTGEIHRGRVPAGSVVVPGSL 234

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PS + K +     L CAVI+K+VD KTRSKTSIN LLRD
Sbjct: 235 PSADGKYN-----LNCAVIVKRVDAKTRSKTSINELLRD 268


>gi|93005555|ref|YP_579992.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Psychrobacter cryohalolentis K5]
 gi|122415756|sp|Q1QCU5|DAPD_PSYCK RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|92393233|gb|ABE74508.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Psychrobacter cryohalolentis K5]
          Length = 273

 Score =  322 bits (825), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 154/278 (55%), Positives = 206/278 (74%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L++ I+  FE  N  +  ++PQDV+DA+   L+ LD G +R+A + D G W  +QW KK
Sbjct: 2   SLQQTIEQAFENRNEYSPATMPQDVRDAINQVLEQLDNGTLRVAEKKD-GEWVVNQWAKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N   + + G  +  ++DK+P KF +W    F++   R++P  + R  +YI P
Sbjct: 61  AVLLSFRLNDNYVQAAGE-HVQFYDKVPTKFANWTEAQFKEAGVRVVPPAVARKGSYIAP 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVLMPS+VN+GAY+ +G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 GAVLMPSYVNIGAYVDQGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EG+V+ MGV+IG+ST+I DR TGEI  G VP+ SVVVPGS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGAVISMGVYIGQSTRIYDRETGEIHRGRVPAGSVVVPGSLP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 240 SED------GTHSLYAAIIVKKVDAQTRAKTSVNELLR 271


>gi|225077520|ref|ZP_03720719.1| hypothetical protein NEIFLAOT_02583 [Neisseria flavescens
           NRL30031/H210]
 gi|224951140|gb|EEG32349.1| hypothetical protein NEIFLAOT_02583 [Neisseria flavescens
           NRL30031/H210]
          Length = 273

 Score =  322 bits (824), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 204/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE     N  ++  +V++AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRAEINPNTVTPEVREAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   +I++DG   + ++DK+P KF DW   +F +  FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEILNDG--VNKYFDKVPTKFADWSEDEFRRAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|218458663|ref|ZP_03498754.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhizobium etli Kim 5]
          Length = 212

 Score =  321 bits (823), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 148/212 (69%), Positives = 175/212 (82%), Gaps = 2/212 (0%)

Query: 74  NPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSF 133
           N  +++  G+G STWWDK+P+KF++W    F    FR +P  +VR SAYI P A+LMPSF
Sbjct: 1   NDMEVVKGGSGNSTWWDKVPSKFENWGENQFRAAGFRAVPNCVVRRSAYIAPNAILMPSF 60

Query: 134 VNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGAR 193
           VN+GAY+GEG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPTIIEDNCFIGAR
Sbjct: 61  VNLGAYVGEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPTIIEDNCFIGAR 120

Query: 194 SEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSIN--LKG 251
           SE+VEGCIIREGSVLGMGV+IGKSTKI+DR TGE+ YGEVP YSVVV GS  S N  +  
Sbjct: 121 SEVVEGCIIREGSVLGMGVYIGKSTKIVDRATGEVMYGEVPPYSVVVAGSMASANATMAN 180

Query: 252 DIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
               PHLYCAVI+K+VDE+TRSKT IN LLRD
Sbjct: 181 GQPAPHLYCAVIVKRVDEQTRSKTGINELLRD 212


>gi|319639451|ref|ZP_07994201.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria mucosa C102]
 gi|317399346|gb|EFV80017.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria mucosa C102]
          Length = 273

 Score =  321 bits (823), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 204/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE     N  ++  +V++AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRAEINPNTVTPEVREAVLETIHQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   +I++DG   + ++DK+P KF DW   +F    FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEILNDG--VNKYFDKVPTKFADWSEDEFRSAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI+DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKILDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|239999754|ref|ZP_04719678.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae 35/02]
 gi|240014911|ref|ZP_04721824.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae DGI18]
 gi|240017359|ref|ZP_04723899.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae FA6140]
 gi|240081502|ref|ZP_04726045.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae FA19]
 gi|240113781|ref|ZP_04728271.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae MS11]
 gi|240116515|ref|ZP_04730577.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae PID18]
 gi|240121981|ref|ZP_04734943.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae PID24-1]
 gi|240124278|ref|ZP_04737234.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae PID332]
 gi|240128952|ref|ZP_04741613.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae SK-93-1035]
 gi|317165045|gb|ADV08586.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 353

 Score =  321 bits (823), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 156/280 (55%), Positives = 207/280 (73%), Gaps = 10/280 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           + +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W 
Sbjct: 80  IMSLQNIIETAFENRADITPTTVAPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWA 139

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I   ++++DG   + ++DK+P KF DW   +F+   FR +PG + R  +++
Sbjct: 140 KKAVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFKNAGFRAVPGAVARRGSFV 197

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
              AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 198 AKNAVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTI 257

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS
Sbjct: 258 IEDNCFIGARSEIVEGAIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGS 317

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 318 LPSKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 351


>gi|254670166|emb|CBA05228.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria meningitidis alpha153]
 gi|325205412|gb|ADZ00865.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis M04-240196]
          Length = 273

 Score =  321 bits (823), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 157/278 (56%), Positives = 204/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE     N  ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADINPTTVTPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   +I++DG   + ++DK+P KF DW   +F+   FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEILNDG--VNKYFDKVPTKFADWSEDEFKNAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|304386515|ref|ZP_07368803.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis ATCC 13091]
 gi|304339344|gb|EFM05416.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis ATCC 13091]
          Length = 273

 Score =  321 bits (822), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 205/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPSTVAPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F+   FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFKNAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|85709218|ref|ZP_01040283.1| tetrahydrodipicolinate N-succinyltransferase [Erythrobacter sp.
           NAP1]
 gi|85687928|gb|EAQ27932.1| tetrahydrodipicolinate N-succinyltransferase [Erythrobacter sp.
           NAP1]
          Length = 278

 Score =  321 bits (822), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 153/277 (55%), Positives = 198/277 (71%), Gaps = 2/277 (0%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           TL   I++ +EE ++       DV+ AV   L LLD G +R+A   ++G W+ +QW+KKA
Sbjct: 4   TLISQIEAAWEERDTVTPG--SDVRHAVGEALALLDSGEVRVAQPGEDGTWSVNQWLKKA 61

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++   +++  G+     +DK+P KF  W    F++  FR++PG IVR  ++IG  
Sbjct: 62  VLLSFRLQDNRVMEHGSAGEAAFDKVPLKFAGWGANRFKEAGFRVVPGAIVRRGSHIGKG 121

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           AVLMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGG GIGGVLEP+Q  P II D
Sbjct: 122 AVLMPSFVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGAGIGGVLEPLQAEPVIIGD 181

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
             FIGAR+E+ EG  + EG+VL MGV++G STKIIDR TGE+  GEVP Y+VVVPGS P 
Sbjct: 182 GAFIGARAEVAEGVRVGEGAVLSMGVYLGASTKIIDRATGEVHRGEVPPYAVVVPGSLPG 241

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
             L     GP LYCAVI+K VD +TRSKT IN LLRD
Sbjct: 242 KPLSDGTPGPSLYCAVIVKTVDAQTRSKTGINELLRD 278


>gi|298370630|ref|ZP_06981945.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281240|gb|EFI22730.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria sp. oral taxon 014 str. F0314]
          Length = 273

 Score =  321 bits (822), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 158/279 (56%), Positives = 205/279 (73%), Gaps = 12/279 (4%)

Query: 7   TLEEIIDSFFEESN--SKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +L+ II++ FE     S +  IP+ VK+AV  T+  LD G +R+A R   G W  ++W K
Sbjct: 2   SLQNIIETAFENRADISPSTVIPE-VKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAK 60

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF+I   ++++DG   + ++DK+P KF DW   +F    FR +PG + R  +++ 
Sbjct: 61  KAVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFRAAGFRAVPGAVARRGSFVA 118

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTII
Sbjct: 119 KNVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTII 178

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI+DR TGEI  G VP+ SVVV GS 
Sbjct: 179 EDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKILDRTTGEIYQGRVPAGSVVVSGSM 238

Query: 245 PSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           PS +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 239 PSKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|241759174|ref|ZP_04757282.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria flavescens SK114]
 gi|241320593|gb|EER56870.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria flavescens SK114]
          Length = 273

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 203/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE     N  ++  +V++AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRAEINPNTVTPEVREAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   +I++DG   + ++DK+P KF DW   +F    FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEILNDG--VNKYFDKVPTKFADWSEDEFRSAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|325143049|gb|EGC65400.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis 961-5945]
 gi|325198975|gb|ADY94431.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis G2136]
 gi|325203448|gb|ADY98901.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis M01-240355]
          Length = 273

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 205/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPSTVAPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F+   FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFKNAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|261381255|ref|ZP_05985828.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria subflava NJ9703]
 gi|284795887|gb|EFC51234.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria subflava NJ9703]
          Length = 273

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 203/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE     N  ++  +V++AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRAEINPNTVTPEVREAVLETIHQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   +I++DG   + ++DK+P KF DW   +F    FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEILNDG--VNKYFDKVPTKFADWSEDEFRSAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|257454240|ref|ZP_05619510.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Enhydrobacter aerosaccus SK60]
 gi|257448413|gb|EEV23386.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Enhydrobacter aerosaccus SK60]
          Length = 273

 Score =  320 bits (820), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 204/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L++II+  FE  +N        DV+ AV   L  LD G +R+A + D G W  +QW+KK
Sbjct: 2   SLQQIIEDAFENRANFNPNDSTDDVRAAVNDVLAQLDAGTLRVAEKKD-GEWIVNQWVKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N  +I++ G     ++DK+  KF DW  + F K   R++P  + R  +YI  
Sbjct: 61  AVLLSFRLNDNRIMNGGRDLQ-FFDKVETKFSDWGDEQFAKAGVRVVPPAVARKGSYIAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            A+LMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 GAILMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI+DR TGEI+YG +P+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKILDRETGEISYGRIPAGSVVVSGSLP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+KKVD +TRSKTSIN LLR
Sbjct: 240 SKD------GSHSLYCAVIVKKVDAQTRSKTSINDLLR 271


>gi|261401633|ref|ZP_05987758.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria lactamica ATCC 23970]
 gi|269208270|gb|EEZ74725.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria lactamica ATCC 23970]
          Length = 273

 Score =  320 bits (820), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 204/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPTTVTPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F    FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFRAAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|15676250|ref|NP_273384.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria meningitidis MC58]
 gi|254805630|ref|YP_003083851.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria meningitidis alpha14]
 gi|71153297|sp|Q9K152|DAPD_NEIMB RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|7225555|gb|AAF40778.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis MC58]
 gi|254669172|emb|CBA07894.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria meningitidis alpha14]
 gi|254672316|emb|CBA05447.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria meningitidis alpha275]
 gi|316984338|gb|EFV63312.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis H44/76]
 gi|325140984|gb|EGC63490.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis CU385]
 gi|325199529|gb|ADY94984.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis H44/76]
          Length = 273

 Score =  320 bits (820), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 205/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPTTVTPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F+   FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFKNAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|134094549|ref|YP_001099624.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Herminiimonas arsenicoxydans]
 gi|166224211|sp|A4G4R0|DAPD_HERAR RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|133738452|emb|CAL61497.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           (Tetrahydrodipicolinate N-succinyltransferase) (THP
           succinyltransferase) (Tetrahydropicolinate succinylase)
           [Herminiimonas arsenicoxydans]
          Length = 274

 Score =  320 bits (820), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 154/281 (54%), Positives = 206/281 (73%), Gaps = 8/281 (2%)

Query: 4   IVSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   LE+IID  +E  ++   ++ P D+++AV   +  L+ G +R+A +D +G W  +QW
Sbjct: 1   MTQQLEQIIDQAWENRADFSPKNAPADLRNAVAQVIAQLNEGTLRVAQKD-SGAWVVNQW 59

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++     +  G  Y  ++DK+P KF ++  +DF K  FR++P  + RH ++
Sbjct: 60  VKKAVLLSFRLEDNIAMPSGE-YMQFYDKVPTKFANYTAEDFAKGGFRVVPPAVARHGSF 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           IG   V+MPSFVN+GAY+ EGSM+D W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PT
Sbjct: 119 IGKNVVMMPSFVNIGAYVDEGSMVDAWATVGSCAQIGKNVHLSGGVGIGGVLEPMQANPT 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSEIVEG I+ E SV+ MGV+IG+STKI DR TGE+TYG +P+ SVVV G
Sbjct: 179 IIEDNCFIGARSEIVEGVIVEENSVISMGVYIGQSTKIYDRATGEVTYGRIPAGSVVVSG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           + PS + K       LYCAVI+K+VD KTR+KT IN LLRD
Sbjct: 239 NLPSADGK-----YSLYCAVIVKRVDAKTRAKTGINELLRD 274


>gi|296313609|ref|ZP_06863550.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria polysaccharea ATCC 43768]
 gi|296839844|gb|EFH23782.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria polysaccharea ATCC 43768]
          Length = 273

 Score =  320 bits (820), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 204/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPTTVAPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F    FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFRAAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|325134916|gb|EGC57548.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis M13399]
          Length = 273

 Score =  320 bits (820), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 205/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPTTVAPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F+   FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFKNAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|309378658|emb|CBX22729.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 273

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 204/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPTTVAPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F    FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFRSAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|121635529|ref|YP_975774.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria meningitidis FAM18]
 gi|161870735|ref|YP_001599908.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria meningitidis 053442]
 gi|166224215|sp|A1KVU9|DAPD_NEIMF RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|189082816|sp|A9M2Y6|DAPD_NEIM0 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|120867235|emb|CAM11004.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria meningitidis FAM18]
 gi|161596288|gb|ABX73948.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria meningitidis 053442]
 gi|261391860|emb|CAX49319.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           (tetrahydrodipicolinate N-succinyltransferase; THP
           succinyltransferase; tetrahydropicolinate succinylase)
           [Neisseria meningitidis 8013]
 gi|325132890|gb|EGC55567.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis M6190]
 gi|325138875|gb|EGC61425.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis ES14902]
          Length = 273

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 205/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPTTVTPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F+   FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFKNAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPTGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|313667737|ref|YP_004048021.1| 2,3,4,5-tetrahydropyridine-2-carboxylateN-succinyltransferase
           [Neisseria lactamica ST-640]
 gi|313005199|emb|CBN86632.1| 2,3,4,5-tetrahydropyridine-2-carboxylateN-succinyltransferase
           [Neisseria lactamica 020-06]
          Length = 273

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 205/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPSTVAPEVKEAVLGTIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F+   FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFKNAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|255068335|ref|ZP_05320190.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria sicca ATCC 29256]
 gi|255047384|gb|EET42848.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria sicca ATCC 29256]
          Length = 298

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 205/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 27  SLQNIIETAFENRADITPTTVTPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 86

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F    FR +PG + R  +++  
Sbjct: 87  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFRAAGFRAVPGAVARRGSFVAK 144

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 145 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 204

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI+DR TGEI  G VP+ SVVV GS P
Sbjct: 205 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKILDRTTGEIYQGRVPAGSVVVSGSMP 264

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 265 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 296


>gi|209965577|ref|YP_002298492.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodospirillum centenum SW]
 gi|209959043|gb|ACI99679.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodospirillum centenum SW]
          Length = 292

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 161/292 (55%), Positives = 202/292 (69%), Gaps = 9/292 (3%)

Query: 1   MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGH---- 56
           M T    L   ID  +E  +    +    V+ AV+  L LLD GI+R+A   D G     
Sbjct: 1   MSTAPDRLARTIDQAWEVRDGLTPATTGPVRAAVEEALGLLDAGILRVAEPVDGGSQGGG 60

Query: 57  WNTHQWIKKAILLSFQINPTKIISDGNGY-----STWWDKIPAKFDDWKTKDFEKHNFRI 111
           W  +QW+KKA+LLSF++N   +I  G G      +TW+DK+P+KF  W    ++   FR 
Sbjct: 61  WRVNQWLKKAVLLSFRLNDNAVIPGGPGLPGGDSATWFDKVPSKFAGWDEVRWKAAGFRA 120

Query: 112 IPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIG 171
           +PG IVRHSA++ P  VLMPSFVN+GA++  G+M+DTW TVGSCAQIG+NVH+SGGVGIG
Sbjct: 121 VPGAIVRHSAHVAPGVVLMPSFVNLGAHVDRGTMVDTWVTVGSCAQIGRNVHLSGGVGIG 180

Query: 172 GVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYG 231
           GVLEP+Q  P IIED+CFIGARSE+VEG I+  GSVL MGVFI  ST+IIDR TGE+  G
Sbjct: 181 GVLEPLQANPVIIEDDCFIGARSEVVEGVIVERGSVLSMGVFISASTRIIDRATGEVFIG 240

Query: 232 EVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            VP++SVVVPG+ P   L     GP L CAVI+K+VDEKTR+KTSIN LLRD
Sbjct: 241 RVPAWSVVVPGTLPGRPLLDGSPGPGLSCAVIVKRVDEKTRAKTSINDLLRD 292


>gi|218768889|ref|YP_002343401.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Neisseria meningitidis Z2491]
 gi|71153296|sp|Q9JSS7|DAPD_NEIMA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|121052897|emb|CAM09249.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Neisseria meningitidis Z2491]
 gi|308388543|gb|ADO30863.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase
           [Neisseria meningitidis alpha710]
 gi|319411190|emb|CBY91595.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           (tetrahydrodipicolinate N-succinyltransferase; THP
           succinyltransferase; tetrahydropicolinate succinylase)
           [Neisseria meningitidis WUE 2594]
 gi|325128921|gb|EGC51775.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis N1568]
 gi|325130914|gb|EGC53643.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis OX99.30304]
 gi|325136910|gb|EGC59507.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis M0579]
 gi|325145130|gb|EGC67412.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis M01-240013]
          Length = 273

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 205/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPTTVTPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F+   FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFKNAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|94496038|ref|ZP_01302617.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sphingomonas sp. SKA58]
 gi|94424730|gb|EAT09752.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sphingomonas sp. SKA58]
          Length = 281

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 200/282 (70%), Gaps = 1/282 (0%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +T+   L  IID+ +E+  +       DV+ AV   L +LD+G +R+A   + G W  +Q
Sbjct: 1   MTMSQDLIAIIDAAWEDRANVTLQTQGDVRQAVDRALGMLDKGELRVAEPTEAG-WQVNQ 59

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W KKA+LLSF++N   +I +G G   WWDK+P+KF  W    F    FR +PG+  R  +
Sbjct: 60  WAKKAVLLSFRLNDNALIENGPGAGHWWDKVPSKFAGWDEAAFRAAGFRAVPGSFARAGS 119

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           +I    +LMPSFVN+GA++ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P
Sbjct: 120 HIAKNVILMPSFVNIGAFVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQADP 179

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
            IIED+CFIGARSE+VEG  I +GSVL MGVFIG+STKI+DR TGEI  G+VP YSVVVP
Sbjct: 180 VIIEDDCFIGARSEVVEGVRIGKGSVLSMGVFIGQSTKIVDRTTGEIFMGQVPPYSVVVP 239

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           GS P   L     GP LYCAVI+K+VD +TRSKT IN LLRD
Sbjct: 240 GSLPGKPLPDGTPGPSLYCAVIVKRVDAQTRSKTGINELLRD 281


>gi|71083169|ref|YP_265888.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Candidatus Pelagibacter ubique HTCC1062]
 gi|91762402|ref|ZP_01264367.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Pelagibacter ubique HTCC1002]
 gi|82592817|sp|Q4FNF4|DAPD_PELUB RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|71062282|gb|AAZ21285.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Pelagibacter ubique HTCC1062]
 gi|91718204|gb|EAS84854.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Pelagibacter ubique HTCC1002]
          Length = 275

 Score =  319 bits (818), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 161/279 (57%), Positives = 208/279 (74%), Gaps = 10/279 (3%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
            E II++ +E  +S N    + + DA+  T++L+D+G +R+A ++ N  W  +QW+KKAI
Sbjct: 4   FESIINTAWENKDSINGQSDKSILDAINQTIELVDKGELRVAEKNGN-EWVVNQWVKKAI 62

Query: 68  LLSFQINPTKIISDGNGYSTWWDK---IPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           +LSF+ +    +S    YS+W+DK   +  K  +W  +D  K  FR++P + VR  ++IG
Sbjct: 63  MLSFRTHDMDSLS--GPYSSWYDKSHLLKGKTANWTKEDHIKAGFRMVPNSPVRKGSFIG 120

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
             AVLMP FVN+GAY+ EG+M+DTW++VGSCAQIGKN HISGG GIGGVLEP+Q  PTII
Sbjct: 121 KNAVLMPCFVNIGAYVDEGTMVDTWASVGSCAQIGKNCHISGGAGIGGVLEPMQANPTII 180

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSEIVEG I+ EGSVL MGVFIG+STKI+ R TGE+ YG++P YSV+VPGS 
Sbjct: 181 EDNCFIGARSEIVEGVIVGEGSVLSMGVFIGQSTKIVYRETGEVIYGKIPPYSVIVPGSI 240

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PS + K    GP LYCAVIIK+VDEKTRSKTSIN LLRD
Sbjct: 241 PSKDGK----GPALYCAVIIKQVDEKTRSKTSINDLLRD 275


>gi|152980070|ref|YP_001353759.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Janthinobacterium sp. Marseille]
 gi|166224212|sp|A6SZR2|DAPD_JANMA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|151280147|gb|ABR88557.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Janthinobacterium sp. Marseille]
          Length = 274

 Score =  319 bits (818), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 154/281 (54%), Positives = 207/281 (73%), Gaps = 8/281 (2%)

Query: 4   IVSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   LE+IID  +E  ++   ++ P DV++AV   +  L+ G +R+A +D +G W  +QW
Sbjct: 1   MTQQLEQIIDQAWENRADFSPKNAPADVRNAVAQVIAQLNEGTLRVAQKD-SGAWVVNQW 59

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++     +  G+ +  ++DK+P KF ++  +DF K  FR++P  + RH ++
Sbjct: 60  VKKAVLLSFRLEDNITMPSGD-HMQFYDKVPTKFANYTAEDFAKGGFRVVPPAVARHGSF 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           IG   V+MPSFVN+GAY+ EGSM+D W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PT
Sbjct: 119 IGKNVVMMPSFVNIGAYVDEGSMVDAWATVGSCAQIGKNVHLSGGVGIGGVLEPMQANPT 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSEIVEG I+ E SV+ MGV+IG+STKI DR TGE+TYG +P+ SVVV G
Sbjct: 179 IIEDNCFIGARSEIVEGVIVEENSVISMGVYIGQSTKIYDRATGEVTYGRIPAGSVVVSG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           + PS + K       LYCAVI+K+VD KTR+KT IN LLRD
Sbjct: 239 NLPSADGK-----YSLYCAVIVKRVDAKTRAKTGINELLRD 274


>gi|261378356|ref|ZP_05982929.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria cinerea ATCC 14685]
 gi|269145464|gb|EEZ71882.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria cinerea ATCC 14685]
          Length = 273

 Score =  319 bits (818), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 204/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPTTVTPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F    FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFRSAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|288576115|ref|ZP_05978214.2| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria mucosa ATCC 25996]
 gi|288566267|gb|EFC87827.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria mucosa ATCC 25996]
          Length = 298

 Score =  319 bits (818), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/278 (55%), Positives = 204/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 27  SLQNIIETAFENRADITPTTVTPEVKEAVLETIRQLDSGKLRVAERLGVGEWKVNEWAKK 86

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F    FR +PG + R  +++  
Sbjct: 87  AVLLSFRIQDNEVLNDG--VNKYYDKVPTKFADWSEDEFRAAGFRAVPGAVARRGSFVAK 144

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 145 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIE 204

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 205 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 264

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 265 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 296


>gi|260913994|ref|ZP_05920468.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pasteurella dagmatis ATCC 43325]
 gi|260632081|gb|EEX50258.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pasteurella dagmatis ATCC 43325]
          Length = 274

 Score =  319 bits (818), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 161/280 (57%), Positives = 203/280 (72%), Gaps = 15/280 (5%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +L+ II++ FE+   + E  P+ V    + A++  ++ LD G  R+A + D G W THQW
Sbjct: 2   SLQNIIEAAFEK---RAEITPKTVDAQTRAAIEEAIEGLDSGKYRVAEKID-GEWVTHQW 57

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF+IN  +++S G   + ++DK+P KF D+    F++  FR++P   VR  AY
Sbjct: 58  LKKAVLLSFRINDNELVSGGE--TNYYDKVPMKFADYDEARFQQEGFRVVPPAAVRKGAY 115

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I    VLMPS+VN+GA + EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PT
Sbjct: 116 IAKNTVLMPSYVNIGARVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPT 175

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEITYG VP+ SVVV G
Sbjct: 176 IIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIYDRETGEITYGRVPAGSVVVSG 235

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S PS           LYCAVI+KKVDEKTR K  IN LLR
Sbjct: 236 SLPS-----KCGKYSLYCAVIVKKVDEKTRGKVGINELLR 270


>gi|197286134|ref|YP_002152006.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Proteus mirabilis HI4320]
 gi|227357254|ref|ZP_03841611.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Proteus mirabilis ATCC 29906]
 gi|226724183|sp|B4F2D6|DAPD_PROMH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|194683621|emb|CAR44525.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Proteus mirabilis HI4320]
 gi|227162517|gb|EEI47506.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Proteus mirabilis ATCC 29906]
          Length = 274

 Score =  319 bits (817), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 161/279 (57%), Positives = 206/279 (73%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ IID+ FE+ +    +++   V+DA+ + +  LD G +R+A +  NG W THQW+
Sbjct: 1   MQALQSIIDNAFEQRAEITPDNVEPQVRDAINNVIAQLDSGKLRVAEKI-NGQWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I+  ++I DG+  S ++DK+P KF ++    FEK  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRISHNQVI-DGS-ESRYFDKVPMKFANYDQARFEKEGFRVVPPAAVRQGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + +       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 238 LPSKDGR-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|255021224|ref|ZP_05293274.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidithiobacillus caldus ATCC 51756]
 gi|254969339|gb|EET26851.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidithiobacillus caldus ATCC 51756]
          Length = 273

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 158/281 (56%), Positives = 205/281 (72%), Gaps = 11/281 (3%)

Query: 5   VSTLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L EII+  +EE +  +  + P +++DAV   ++ LD+G++R+A + D G W+THQWI
Sbjct: 1   MAQLAEIIEGAWEERDRFSPRNAPNELRDAVGQVIEGLDKGVLRVAEKRD-GQWHTHQWI 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++     I      + ++DK+P KF D+ + DF    FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRLQDNVRIPGAE--TQYFDKVPGKFSDYNSNDFRTGGFRVVPPATVRKGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNCVLMPSFVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IED+CFIGARSE+VEG I+  GSV+ MGVFIG ST+I DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDDCFIGARSEVVEGVIVESGSVISMGVFIGASTRIFDRETGEILYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLRD 283
            P+ +      G H LYCAVI+KKVD KTRSK  IN LLR+
Sbjct: 238 LPAKD------GSHSLYCAVIVKKVDAKTRSKVGINQLLRE 272


>gi|323137572|ref|ZP_08072649.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylocystis sp. ATCC 49242]
 gi|322397198|gb|EFX99722.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylocystis sp. ATCC 49242]
          Length = 285

 Score =  318 bits (816), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 164/280 (58%), Positives = 203/280 (72%), Gaps = 4/280 (1%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASR----DDNGHWNTHQWI 63
           LE +I + FE+  + N     D++ AV S L LLD G +R+A +    D    W  +QW+
Sbjct: 6   LETLITAAFEDRANINAETQGDIRRAVDSALRLLDSGKLRVAEKIEGKDGPDSWKVNQWL 65

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N   +I+ G G +TWWDK+P+KF  W   +     FR +PG IVRHSA++
Sbjct: 66  KKAVLLSFRLNDMSVIAGGPGGATWWDKVPSKFVGWGAGEHSAAGFRSVPGAIVRHSAFV 125

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P A+LMPSFVN+GAY+  G+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 126 APGAILMPSFVNLGAYVDAGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 185

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IED+CFIGARSE+VEG ++ +GSVL MGVFIG STKIIDR TG++  G VP YSVVV GS
Sbjct: 186 IEDDCFIGARSEVVEGVVVGKGSVLSMGVFIGASTKIIDRATGKVHMGYVPPYSVVVSGS 245

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            P   L     GP LYCAVI+K VD +TRSKT IN LLRD
Sbjct: 246 LPGKPLPDGTPGPSLYCAVIVKTVDAQTRSKTGINELLRD 285


>gi|56479087|ref|YP_160676.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Aromatoleum aromaticum EbN1]
 gi|71153270|sp|Q5NYT9|DAPD_AZOSE RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|56315130|emb|CAI09775.1| Tetrahydrodipicolinate succinylase [Aromatoleum aromaticum EbN1]
          Length = 273

 Score =  318 bits (816), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 154/276 (55%), Positives = 205/276 (74%), Gaps = 9/276 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID  FE  +N    + P  V+DAV S +  LD G +R+A + D G+W  +QWIKKA
Sbjct: 4   LQKIIDDAFENRANLSPSAAPAAVRDAVASVIAGLDAGRLRVAEKID-GNWTVNQWIKKA 62

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +L+SF++   ++++ G   + ++DK+P KF D+  + F +  FR++P  + R  ++IG  
Sbjct: 63  VLISFRLADNEVMAGGT--NQYFDKVPTKFGDYTPEQFREGGFRVVPPAVARRGSFIGRN 120

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GP IIED
Sbjct: 121 VVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQAGPVIIED 180

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           N F+GARSE+VEG II E +VL MGV+IG+STKI DR TGE+TYG VPS +VVVPGS PS
Sbjct: 181 NVFVGARSEVVEGVIIEENAVLSMGVYIGQSTKIYDRATGEVTYGRVPSGAVVVPGSLPS 240

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            + K       LYCAVI+K+VD +TR+KT IN LLR
Sbjct: 241 ADGK-----YSLYCAVIVKRVDAQTRAKTGINELLR 271


>gi|74317238|ref|YP_314978.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Thiobacillus denitrificans ATCC 25259]
 gi|123611950|sp|Q3SJI4|DAPD_THIDA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|74056733|gb|AAZ97173.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Thiobacillus denitrificans ATCC 25259]
          Length = 274

 Score =  318 bits (815), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 157/277 (56%), Positives = 200/277 (72%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFEESN--SKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           L+ II+  FE     +   + PQ VKDAV + +DLLD G +R+A R D  +W T+QW+KK
Sbjct: 4   LQPIIEEAFERRADITPRNATPQ-VKDAVMAVIDLLDMGQLRVAERTDGQNWTTNQWVKK 62

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++     I    GY+ ++DK+P+KF D+ +KDF +  FR++P    R  +YIG 
Sbjct: 63  AVLLSFRLEDNAFIK--GGYTNYYDKVPSKFADFNSKDFREGGFRVVPPAAARKGSYIGK 120

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTII 
Sbjct: 121 NVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQANPTIIG 180

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+ +  V+ MGV+IG+STKI DR TGEI YG VP+ SVVV G+ P
Sbjct: 181 DNCFIGARSEVVEGVIVEDNCVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGNLP 240

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S +         LYCAVI+KKVD KT SK  IN LLR
Sbjct: 241 SKD-----GSYSLYCAVIVKKVDAKTLSKVGINELLR 272


>gi|82702972|ref|YP_412538.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Nitrosospira multiformis ATCC 25196]
 gi|123544267|sp|Q2Y7X5|DAPD_NITMU RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|82411037|gb|ABB75146.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrosospira multiformis ATCC 25196]
          Length = 273

 Score =  318 bits (815), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 155/282 (54%), Positives = 204/282 (72%), Gaps = 11/282 (3%)

Query: 1   MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           M  + ST+EE   +F   +     ++   +K+++   L++LD G +R+A + D G W TH
Sbjct: 1   MDQLQSTIEE---AFERRAEMTPRNVEAKLKESITQVLEMLDSGKLRVAEKTD-GEWKTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QWIKKA+LLSF+I     I    G+S ++DK+P+KF D+ ++DF    FR++P   VR  
Sbjct: 57  QWIKKAVLLSFRIEDNSFIK--GGFSNYFDKVPSKFADYSSRDFRNGGFRVVPPATVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIASNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ E SV+ MGV+IG+ST+I +R TGEI+YG +P  SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVGENSVISMGVYIGQSTRIYNRETGEISYGRIPPGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            GS PS + K       LYCAVI+K+VD KTR+KT IN LLR
Sbjct: 235 SGSLPSADGK-----YSLYCAVIVKQVDAKTRAKTGINELLR 271


>gi|37524670|ref|NP_928014.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Photorhabdus luminescens subsp. laumondii TTO1]
 gi|71153300|sp|Q7N8Q0|DAPD_PHOLL RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|36784095|emb|CAE12964.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 274

 Score =  318 bits (815), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 161/279 (57%), Positives = 201/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ II+S FE   +    ++  + +DAV   ++LLD G +R+A + D G W THQW+
Sbjct: 1   MQQLQSIIESAFENRATLTPATVNHETRDAVTQVINLLDSGKLRVAEKID-GQWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           K A+LLSF+IN  +II DG   S ++DK+P KF D+    FEK  FR++P    R  A+I
Sbjct: 60  KMAVLLSFRINENQII-DGT-ESRYFDKVPMKFSDYDQTRFEKEGFRVVPPAAARQGAFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNCVLMPSYVNIGAYVDEGTMVDTWTTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG II EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIIEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KT+ K  IN LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTQGKVGINELLR 271


>gi|290473654|ref|YP_003466526.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xenorhabdus bovienii SS-2004]
 gi|289172959|emb|CBJ79730.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xenorhabdus bovienii SS-2004]
          Length = 274

 Score =  318 bits (815), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 201/280 (71%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ IID+ FE  +N    ++ +  + AV   + +LD G +R+A +   G W THQW+
Sbjct: 1   MQQLQSIIDNAFENRTNITPGTVDEATRSAVNQVIQMLDSGKLRVAEKI-AGQWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  ++I      S ++DK+P KF D+    FEK  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDQARFEKEGFRVVPPAAVRQGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
              +VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNSVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EG+V+ MGV+IG+STKI DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGAVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS +         LYCAVI+KKVD KTR K  +N LLR+
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTRGKVGLNELLRN 272


>gi|332978361|gb|EGK15085.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Psychrobacter sp. 1501(2011)]
          Length = 286

 Score =  318 bits (815), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 160/278 (57%), Positives = 203/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +LE+II+  FE+ +     ++PQDVKDAV   L+ LD G +R+A + D G W  +QW KK
Sbjct: 15  SLEQIIEQAFEKRAEYSPTTMPQDVKDAVNDVLEQLDNGSLRVAEKKD-GEWVVNQWAKK 73

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N    +     +  ++DK+P KF DW  + F +   R++P  + R  ++I  
Sbjct: 74  AVLLSFRMNDNYQMPSCE-HLQFYDKVPTKFADWTEQQFIESGVRVVPPAVARRGSFIAK 132

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+ N+GAYI EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 133 GVVLMPSYTNIGAYIDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIE 192

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV G+ P
Sbjct: 193 DNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGNLP 252

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+KKVD +TRSKTSIN LLR
Sbjct: 253 SKD------GSHSLYCAVIVKKVDAQTRSKTSINELLR 284


>gi|161898746|ref|YP_192226.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Gluconobacter oxydans 621H]
 gi|71153287|sp|Q5FPX6|DAPD_GLUOX RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
          Length = 276

 Score =  318 bits (815), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 153/278 (55%), Positives = 196/278 (70%), Gaps = 5/278 (1%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + L   I++ +E   + +     + +D V+  L  LD G +R+A    +G W  H+W+KK
Sbjct: 4   APLRTAIEALWERRATLSARTEGEDRDVVEKVLSALDAGTLRVAEPFADG-WTVHEWLKK 62

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N ++++  G G    +DK+P KFD W    F +  FR +PG IVR SA+I P
Sbjct: 63  AVLLSFRLNDSRVMERGCGGEPAFDKVPLKFDGWDQFRFAEAGFRAVPGAIVRRSAFIAP 122

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GA +  G+MIDTW+TVGSCAQIGKN HISGG GIGGVLEP+Q  P IIE
Sbjct: 123 NVVLMPSFVNVGARVDSGTMIDTWATVGSCAQIGKNCHISGGAGIGGVLEPLQAAPVIIE 182

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D+CFIGARSE+ EG I+ +GSVL MGVF+G STKI+DR TGEI  G VP+YSVVVPG+ P
Sbjct: 183 DDCFIGARSEVAEGVIVEKGSVLSMGVFLGASTKIVDRATGEIFMGRVPAYSVVVPGTLP 242

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
                 +   P L CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 243 P----KEPGMPSLACAVIVKRVDERTRSKTSINDLLRD 276


>gi|94310365|ref|YP_583575.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Cupriavidus metallidurans CH34]
 gi|166224218|sp|Q1LNH0|DAPD_RALME RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|93354217|gb|ABF08306.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Cupriavidus metallidurans CH34]
          Length = 274

 Score =  318 bits (815), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 155/281 (55%), Positives = 205/281 (72%), Gaps = 8/281 (2%)

Query: 4   IVSTLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L+ +ID  +E+  S + +S P D+++AV + +  LD G +R+A +     W  +QW
Sbjct: 1   MTQALQALIDQAWEDRTSLSPKSAPNDIREAVANVISQLDSGALRVAEKQGK-DWVVNQW 59

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF++     +S G G++ ++DK+P KF +W   DF K  FR++P  + R  +Y
Sbjct: 60  IKKAVLLSFRLEDNAPMSAG-GFAQFYDKVPTKFANWTGDDFAKAGFRVVPPAVARRGSY 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P 
Sbjct: 119 IARNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPV 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEG II E SV+ MGV++G+STKI DR TGEI YG VP+ SVVV G
Sbjct: 179 IIEDNCFIGARSEVVEGVIIEENSVISMGVYLGQSTKIYDRETGEIHYGRVPAGSVVVAG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           + PS + K       LYCAVI+KKVD +TR+KTS+N LLRD
Sbjct: 239 NLPSKDGK-----YSLYCAVIVKKVDAQTRAKTSLNDLLRD 274


>gi|183597601|ref|ZP_02959094.1| hypothetical protein PROSTU_00886 [Providencia stuartii ATCC 25827]
 gi|188023099|gb|EDU61139.1| hypothetical protein PROSTU_00886 [Providencia stuartii ATCC 25827]
          Length = 274

 Score =  318 bits (814), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 161/279 (57%), Positives = 202/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNES-IPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ II+  FE+  +   S +   V+ AV  T+ LLD G +R+A +  +G W THQW+
Sbjct: 1   MQQLQAIIEQAFEDRAAITPSTVTPAVRQAVTETIALLDSGKLRVAEKI-SGVWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I+  ++I      S ++DK+P KF D+    FE+  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRIHDNQLIEGAE--SRYFDKVPMKFADYDQARFEREGFRVVPPAAVRQGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
              +VLMPS+VN+GAYI EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNSVLMPSYVNIGAYIDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG II EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIIEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD+KTR K  IN LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDDKTRGKVGINELLR 271


>gi|58002676|gb|AAW61570.1| 2,3,4,5-Tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Gluconobacter oxydans 621H]
          Length = 297

 Score =  317 bits (813), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 153/278 (55%), Positives = 196/278 (70%), Gaps = 5/278 (1%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + L   I++ +E   + +     + +D V+  L  LD G +R+A    +G W  H+W+KK
Sbjct: 25  APLRTAIEALWERRATLSARTEGEDRDVVEKVLSALDAGTLRVAEPFADG-WTVHEWLKK 83

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N ++++  G G    +DK+P KFD W    F +  FR +PG IVR SA+I P
Sbjct: 84  AVLLSFRLNDSRVMERGCGGEPAFDKVPLKFDGWDQFRFAEAGFRAVPGAIVRRSAFIAP 143

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GA +  G+MIDTW+TVGSCAQIGKN HISGG GIGGVLEP+Q  P IIE
Sbjct: 144 NVVLMPSFVNVGARVDSGTMIDTWATVGSCAQIGKNCHISGGAGIGGVLEPLQAAPVIIE 203

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D+CFIGARSE+ EG I+ +GSVL MGVF+G STKI+DR TGEI  G VP+YSVVVPG+ P
Sbjct: 204 DDCFIGARSEVAEGVIVEKGSVLSMGVFLGASTKIVDRATGEIFMGRVPAYSVVVPGTLP 263

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
                 +   P L CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 264 P----KEPGMPSLACAVIVKRVDERTRSKTSINDLLRD 297


>gi|218547621|ref|YP_002381412.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia fergusonii ATCC 35469]
 gi|226724175|sp|B7LWA5|DAPD_ESCF3 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|218355162|emb|CAQ87769.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia fergusonii ATCC 35469]
 gi|324112423|gb|EGC06400.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia fergusonii B253]
          Length = 274

 Score =  317 bits (812), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|91776218|ref|YP_545974.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Methylobacillus flagellatus KT]
 gi|122985457|sp|Q1H054|DAPD_METFK RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|91710205|gb|ABE50133.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacillus flagellatus KT]
          Length = 274

 Score =  317 bits (812), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 158/279 (56%), Positives = 200/279 (71%), Gaps = 8/279 (2%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQ-DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II+  FE       S    ++KDAV S L  LD G +R+A R D  +W THQWI
Sbjct: 1   MSNLQTIIEDAFERRAEITPSTASAEIKDAVFSVLADLDSGKLRVAERTDGQNWVTHQWI 60

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++    ++ DG   + ++DK+P KF ++   DF+   FR++P  IVR  ++I
Sbjct: 61  KKAVLLSFRLEDNVLLDDG--VTKYFDKVPPKFANYTEADFKAGGFRVVPNAIVRRGSFI 118

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
              AVLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTI
Sbjct: 119 AKNAVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQAGPTI 178

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +  V+ MGV+IG+STKI DR TGEI YG VP+ SVVV G+
Sbjct: 179 IGDNCFIGARSEVVEGVIVEDNCVISMGVYIGQSTKIYDRETGEIHYGRVPTGSVVVSGN 238

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVDEKT  K  IN LLR
Sbjct: 239 LPSKD-----GSYSLYCAVIVKKVDEKTLGKVGINELLR 272


>gi|325202845|gb|ADY98299.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis M01-240149]
 gi|325208838|gb|ADZ04290.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Neisseria meningitidis NZ-05/33]
          Length = 273

 Score =  317 bits (812), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 154/278 (55%), Positives = 204/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  ++    ++  +VK+AV  T+  LD G +R+A     G W  ++W KK
Sbjct: 2   SLQNIIETAFENRADITPSTVAPEVKEAVLETIRQLDSGKLRVAECLGVGEWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++++DG   + ++DK+P KF DW   +F+   FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNEVLNDG--VNKYFDKVPTKFADWSEDEFKNAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI  G VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRTTGEIYQGRVPAGSVVVSGSMP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+K+VD +TR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKRVDAQTRAKTSVNELLR 271


>gi|253988122|ref|YP_003039478.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253779572|emb|CAQ82733.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Photorhabdus asymbiotica]
          Length = 274

 Score =  317 bits (812), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 159/279 (56%), Positives = 201/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ II+S FE   +    ++  + +DAV   ++LLD G +R+A + D G W THQW+
Sbjct: 1   MQQLKSIIESAFENRAAITPATVNSETRDAVTQVINLLDSGKLRVAEKID-GQWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           K A+LLSF+IN  +II DG   S ++DK+P KF D+    FE+  FR++P    R  ++I
Sbjct: 60  KMAVLLSFRINENRII-DG-AESRYFDKVPMKFSDYDQTRFEQEGFRVVPPAAARQGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNCVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|58416366|emb|CAI27479.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ehrlichia ruminantium str. Gardel]
 gi|58417318|emb|CAI26522.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ehrlichia ruminantium str. Welgevonden]
          Length = 289

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 158/283 (55%), Positives = 202/283 (71%), Gaps = 15/283 (5%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           S  +EII++ +   +  N S    +   +   +DLLD+G +R+ S   NG W  ++WIKK
Sbjct: 10  SDFKEIIENAW--CDIANISTNTSITGVIDEIMDLLDQGKVRV-SEKINGQWIVNEWIKK 66

Query: 66  AILLSFQINPTKIISDGN-----GYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           AILLSF+I   K +         G  +W+DKIP KF  W   +F++   R++PG IVR S
Sbjct: 67  AILLSFRIYDMKFVYTNCHDSIIGNFSWFDKIPLKFGQWNADNFKQAKIRVVPGAIVRKS 126

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           AYI P AVLMPSFVN+GAY+GEG+M+DTW++VGSCAQ+GKN HISGG GIGGVLEP+   
Sbjct: 127 AYIAPGAVLMPSFVNVGAYVGEGTMVDTWASVGSCAQVGKNCHISGGAGIGGVLEPLTAS 186

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           P IIEDNCFIGARSEIVEG I+ EG+V+ MGV+IG STKIIDR +GE+ +G VP+YSVVV
Sbjct: 187 PVIIEDNCFIGARSEIVEGVIVEEGAVVSMGVYIGASTKIIDRTSGEVFFGRVPAYSVVV 246

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PGSY S N+        +YCA+I+KKVD+ TR+K SIN LLRD
Sbjct: 247 PGSYSSGNVS-------IYCAIIVKKVDQNTRNKVSINELLRD 282


>gi|57238769|ref|YP_179905.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Ehrlichia ruminantium str. Welgevonden]
 gi|161598457|ref|YP_196904.2| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ehrlichia ruminantium str. Welgevonden]
 gi|161986613|ref|YP_195953.2| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ehrlichia ruminantium str. Gardel]
 gi|229462846|sp|Q5FF20|DAPD_EHRRG RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|57160848|emb|CAH57748.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ehrlichia ruminantium str. Welgevonden]
          Length = 284

 Score =  316 bits (810), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 158/283 (55%), Positives = 202/283 (71%), Gaps = 15/283 (5%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           S  +EII++ +   +  N S    +   +   +DLLD+G +R+ S   NG W  ++WIKK
Sbjct: 5   SDFKEIIENAW--CDIANISTNTSITGVIDEIMDLLDQGKVRV-SEKINGQWIVNEWIKK 61

Query: 66  AILLSFQINPTKIISDGN-----GYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           AILLSF+I   K +         G  +W+DKIP KF  W   +F++   R++PG IVR S
Sbjct: 62  AILLSFRIYDMKFVYTNCHDSIIGNFSWFDKIPLKFGQWNADNFKQAKIRVVPGAIVRKS 121

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           AYI P AVLMPSFVN+GAY+GEG+M+DTW++VGSCAQ+GKN HISGG GIGGVLEP+   
Sbjct: 122 AYIAPGAVLMPSFVNVGAYVGEGTMVDTWASVGSCAQVGKNCHISGGAGIGGVLEPLTAS 181

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           P IIEDNCFIGARSEIVEG I+ EG+V+ MGV+IG STKIIDR +GE+ +G VP+YSVVV
Sbjct: 182 PVIIEDNCFIGARSEIVEGVIVEEGAVVSMGVYIGASTKIIDRTSGEVFFGRVPAYSVVV 241

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PGSY S N+        +YCA+I+KKVD+ TR+K SIN LLRD
Sbjct: 242 PGSYSSGNVS-------IYCAIIVKKVDQNTRNKVSINELLRD 277


>gi|300724798|ref|YP_003714123.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xenorhabdus nematophila ATCC 19061]
 gi|297631340|emb|CBJ92035.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xenorhabdus nematophila ATCC 19061]
          Length = 274

 Score =  316 bits (810), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 155/280 (55%), Positives = 199/280 (71%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+  I++ FE  +N    ++    +D +   + +LD G +R+A + D G W THQW+
Sbjct: 1   MQQLQATIENAFENRANMTPVTVDGATRDTINQVIQMLDSGKLRVAEKID-GQWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +++      S ++DK+P KF D+    FE+  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINDNQVMEGAE--SRYFDKVPMKFADYDQTRFEQEGFRVVPPAAVRQGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS +         LYCAVI+KKVD KTR K  IN LLR+
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLRN 272


>gi|56459956|ref|YP_155237.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Idiomarina loihiensis L2TR]
 gi|71153289|sp|Q5QXS9|DAPD_IDILO RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|56178966|gb|AAV81688.1| Tetrahydrodipicolinate N-succinyltransferase [Idiomarina loihiensis
           L2TR]
          Length = 274

 Score =  316 bits (810), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 200/275 (72%), Gaps = 10/275 (3%)

Query: 9   EEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAIL 68
           + IID+F +       +   D+++AV+  +D +DRG +R+A +  +G W  HQW+KKA+L
Sbjct: 6   QRIIDAFEQRDQINARTENDDLREAVRYVIDEIDRGELRVAEKV-SGEWVVHQWLKKAVL 64

Query: 69  LSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAV 128
           LSF++N   +I  G   + +WDK+PAKF D+ +  F     R++P  +VR  A+IG   V
Sbjct: 65  LSFRLNDNDLIEGGE--TRFWDKVPAKFADYDSARFRAEGMRVVPPAMVRKGAFIGRNVV 122

Query: 129 LMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNC 188
           +MPS+VN+GA++GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIEDNC
Sbjct: 123 VMPSYVNIGAHVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDNC 182

Query: 189 FIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSIN 248
           FIGARSEIVEG I+ EG+V+ MGV+IG+ST+I DR    I YG VPS SVVVPGS PS N
Sbjct: 183 FIGARSEIVEGVIVEEGAVISMGVYIGQSTRIYDRENDRILYGRVPSGSVVVPGSLPSAN 242

Query: 249 LKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
                 G H LY A+I+K+VD KTR+K  IN LLR
Sbjct: 243 ------GTHSLYAAIIVKRVDAKTRAKVGINALLR 271


>gi|307294831|ref|ZP_07574673.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sphingobium chlorophenolicum L-1]
 gi|306879305|gb|EFN10523.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sphingobium chlorophenolicum L-1]
          Length = 279

 Score =  316 bits (809), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 158/272 (58%), Positives = 195/272 (71%), Gaps = 1/272 (0%)

Query: 12  IDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSF 71
           ID+ +E+  + N S    V+ AV   L +LD G +R+A     G W  +QW KKA+LLSF
Sbjct: 9   IDAAWEDRANVNLSTQGAVRQAVDKALAMLDSGELRVAEPTAEG-WQVNQWAKKAVLLSF 67

Query: 72  QINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMP 131
           ++N   +I +G G   WWDK+P+KF  W    F    FR +PG+  R  ++I    +LMP
Sbjct: 68  RLNDNVMIDNGPGAGHWWDKVPSKFAGWDEAAFRAAGFRAVPGSFARAGSHIAKNVILMP 127

Query: 132 SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIG 191
           SFVN+GA++ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED+CFIG
Sbjct: 128 SFVNIGAFVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQADPVIIEDDCFIG 187

Query: 192 ARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKG 251
           ARSE+VEG  I +GSVL MGVFIG+STKIIDR TGE+  GEVP YSVVVPGS P  +L  
Sbjct: 188 ARSEVVEGVRIGKGSVLSMGVFIGQSTKIIDRATGEVFMGEVPPYSVVVPGSLPGKSLPD 247

Query: 252 DIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              GP LYCAVI+K+VD +TRSKT IN LLRD
Sbjct: 248 GTPGPSLYCAVIVKRVDAQTRSKTGINELLRD 279


>gi|325496098|gb|EGC93957.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia fergusonii ECD227]
          Length = 274

 Score =  315 bits (808), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 200/282 (70%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II+  FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIEIAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|82775556|ref|YP_401903.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shigella dysenteriae Sd197]
 gi|309787162|ref|ZP_07681774.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella dysenteriae 1617]
 gi|123563478|sp|Q32JU3|DAPD_SHIDS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|81239704|gb|ABB60414.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Shigella dysenteriae Sd197]
 gi|308924740|gb|EFP70235.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella dysenteriae 1617]
          Length = 274

 Score =  315 bits (808), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTITREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF ++    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFANYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|145589639|ref|YP_001156236.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|189082817|sp|A4SYV8|DAPD_POLSQ RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|145048045|gb|ABP34672.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 275

 Score =  315 bits (807), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 159/276 (57%), Positives = 207/276 (75%), Gaps = 7/276 (2%)

Query: 9   EEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           + II+  +E  +N   ES P D++ AV + L+ L+ G IR+A R D G W  +QW+KKA+
Sbjct: 6   QSIIEQAWENRANLSPESAPADIRSAVNAVLEGLNAGTIRVAERRDVGKWEVNQWVKKAV 65

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++   K +  G GY+ ++DK+P+KF+++   DF    FR++P  + R  ++IG  A
Sbjct: 66  LLSFRLEDNKPMGAG-GYTQFYDKVPSKFENYTAADFAAGGFRVVPPAVARRGSFIGKNA 124

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEPIQ GP IIEDN
Sbjct: 125 VLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPIQAGPVIIEDN 184

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGARSE+VEG +I E +VL MGV+IG+STKI DR TGE+ YG VP+ SVVVPGS PS 
Sbjct: 185 CFIGARSEVVEGVVIEENAVLSMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVPGSLPSA 244

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
             K       LY A+I+KKVD +TR+KT+IN LLRD
Sbjct: 245 CGK-----YSLYAAIIVKKVDAQTRAKTAINELLRD 275


>gi|77165590|ref|YP_344115.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Nitrosococcus oceani ATCC 19707]
 gi|254434709|ref|ZP_05048217.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrosococcus oceani AFC27]
 gi|123593837|sp|Q3J9B1|DAPD_NITOC RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|76883904|gb|ABA58585.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrosococcus oceani ATCC 19707]
 gi|207091042|gb|EDZ68313.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrosococcus oceani AFC27]
          Length = 273

 Score =  315 bits (807), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 156/278 (56%), Positives = 204/278 (73%), Gaps = 11/278 (3%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + +EE  +   E S  K E++   VKDAV+  L LLD G  R+A +  NG W  ++W+KK
Sbjct: 6   AIIEEAFERRAEISPRKAETL---VKDAVEEALHLLDTGEARVAEKQ-NGEWIVNEWLKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+++    I    GY+ ++DK+P+K+ D+ ++DF +   RI+P   VR  A+I P
Sbjct: 62  AVLLSFRLSDNVFIK--GGYTNYFDKVPSKYADYSSRDFRQDEVRIVPPASVRKGAFIAP 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 SVVLMPSYVNIGAYVDRGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAKPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGVFIG+ST+I  R TG I+YG VP+ SVVVPG+ P
Sbjct: 180 DNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTRIYHRETGTISYGRVPAGSVVVPGNLP 239

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S + K       LYCA+I+K+VDE+TRSK  IN LLR+
Sbjct: 240 SQDGK-----YSLYCAIIVKQVDERTRSKVGINELLRN 272


>gi|188533033|ref|YP_001906830.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Erwinia tasmaniensis Et1/99]
 gi|226724174|sp|B2VE16|DAPD_ERWT9 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|188028075|emb|CAO95932.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erwinia tasmaniensis Et1/99]
          Length = 274

 Score =  315 bits (806), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 156/279 (55%), Positives = 201/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ +I++ FE  ++    +    +++AV   + LLD G +R+A + D G W THQW+
Sbjct: 1   MQQLQNVIEAAFERRADITPVNADTAIREAVSQVIALLDSGALRVAEKID-GQWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  ++I      S ++DK+P KF D+    F+K  FR++P   VR  ++I
Sbjct: 60  KKAVLLSFRINDNQVIEGAE--SRFYDKVPMKFADYDEARFKKEGFRVVPPAAVRQGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KT SKT IN LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTLSKTGINELLR 271


>gi|329912954|ref|ZP_08275848.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327545476|gb|EGF30679.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 274

 Score =  315 bits (806), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 151/281 (53%), Positives = 207/281 (73%), Gaps = 8/281 (2%)

Query: 4   IVSTLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L+ IID  +E+  S + ++ P  +++AV   L+ L+ G +R+A +D +G W  +QW
Sbjct: 1   MTQALQNIIDQAWEDRASLSPQAAPAAIREAVAHVLEQLNDGSLRVAQKD-SGSWVVNQW 59

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++    ++  G+ +  ++DK+P KF ++  +DF K  FR++P  + R  ++
Sbjct: 60  VKKAVLLSFRLEDNIVMPSGD-HMQFYDKVPTKFANYTAEDFAKGGFRVVPPAVARRGSF 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           IG   ++MPSFVN+GAY+ EG+M+D W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PT
Sbjct: 119 IGRNVIMMPSFVNIGAYVDEGTMVDAWATVGSCAQIGKNVHLSGGVGIGGVLEPMQANPT 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSEIVEG I+ E SV+ MGV+IG+STKI DR TGE+TYG +PS SVVV G
Sbjct: 179 IIEDNCFIGARSEIVEGVIVEENSVISMGVYIGQSTKIYDRATGEVTYGRIPSGSVVVAG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           + PS + K       LYCAVI+K+VD KTR+KT IN LLRD
Sbjct: 239 NLPSADGK-----YSLYCAVIVKRVDAKTRAKTGINELLRD 274


>gi|292489231|ref|YP_003532118.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erwinia amylovora CFBP1430]
 gi|292898536|ref|YP_003537905.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erwinia amylovora ATCC 49946]
 gi|291198384|emb|CBJ45491.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erwinia amylovora ATCC 49946]
 gi|291554665|emb|CBA22363.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erwinia amylovora CFBP1430]
 gi|312173392|emb|CBX81646.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erwinia amylovora ATCC BAA-2158]
          Length = 274

 Score =  315 bits (806), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 156/279 (55%), Positives = 199/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ +I++ FE  +N    +    ++DAV   + LLD G +R+A + D G W  HQW+
Sbjct: 1   MQQLQNVIEAAFEHRANITPTNADAAIRDAVNQAIALLDSGTLRVAEKID-GQWVIHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +++      S ++DK+P KF ++    F+K  FR++P   VR  A+I
Sbjct: 60  KKAVLLSFRINDNQVMEGAE--SRFYDKVPMKFANYDEARFKKEGFRVVPPAAVRQGAFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EGSMIDTW+TVGSC QIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAYVDEGSMIDTWATVGSCVQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KT SKT +N LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTLSKTGLNELLR 271


>gi|320179907|gb|EFW54851.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella boydii ATCC 9905]
          Length = 274

 Score =  315 bits (806), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 157/282 (55%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ +GSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEKGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|254455765|ref|ZP_05069194.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082767|gb|EDZ60193.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Pelagibacter sp. HTCC7211]
          Length = 276

 Score =  314 bits (805), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 160/283 (56%), Positives = 208/283 (73%), Gaps = 11/283 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S +E+II+  +E  ++ N+   Q +KD +   +D LD G +R+A + D G W THQ IK
Sbjct: 1   MSDIEKIINDAWENRDNVNQDSDQSLKDTINQMIDDLDSGKVRVAEKID-GEWVTHQHIK 59

Query: 65  KAILLSFQINPTKIISDGNG-YSTWWDK---IPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           KAI+LSF+I P + +   NG YS+W+DK   +  K   W  +D EK  FR++P + VR  
Sbjct: 60  KAIMLSFRIYPMENL---NGPYSSWYDKAHLLKGKTAGWTKEDHEKAGFRMVPNSPVRKG 116

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           +++G  AVLMP +VN+GAYI EG+M+DT+S  GSC QIGKN HIS G GIGGVLEP Q  
Sbjct: 117 SFVGKNAVLMPCYVNIGAYIDEGTMMDTFSRAGSCCQIGKNCHISAGSGIGGVLEPAQAL 176

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGA SE+VEG I+ EGSVL MG++IG+STKI++RNTGE+TYG++P YSVVV
Sbjct: 177 PTIIEDNCFIGAMSEVVEGVIVGEGSVLSMGMYIGQSTKIVNRNTGEVTYGKIPPYSVVV 236

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PGS P    K + + P LYCAVIIK+VDEKTRSKTS+N LLR+
Sbjct: 237 PGSLPD---KNNSSAPSLYCAVIIKQVDEKTRSKTSVNDLLRE 276


>gi|325982603|ref|YP_004295005.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrosomonas sp. AL212]
 gi|325532122|gb|ADZ26843.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrosomonas sp. AL212]
          Length = 273

 Score =  314 bits (805), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 205/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +S L+ II+  FE    + E  P++V    K+AV   L +LD G +R+A + D G W TH
Sbjct: 1   MSELKTIIEEAFER---RAEITPRNVDASLKEAVTQVLAMLDNGKLRVAEKID-GDWITH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QWIKKA+LLSF+I     I    G+S ++DK+P+KF D+ ++DF    FR++P   VR  
Sbjct: 57  QWIKKAVLLSFRIEDNNFIK--GGFSNYFDKVPSKFADYSSRDFRDGGFRVVPPAAVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           ++I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 SFIANNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSEIVEG I+ E SV+ MGV+IG+STKI +R +GE++YG +P  SVVV
Sbjct: 175 PTIIEDNCFIGARSEIVEGVIVGENSVISMGVYIGQSTKIYNRESGEVSYGRIPPGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ P+ N K       LYCAVI+K+VD KTRSKT IN LLR
Sbjct: 235 SGNLPAENGK-----YSLYCAVIVKQVDAKTRSKTGINELLR 271


>gi|326387693|ref|ZP_08209299.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207739|gb|EGD58550.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 278

 Score =  314 bits (805), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 147/255 (57%), Positives = 185/255 (72%), Gaps = 1/255 (0%)

Query: 29  DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTW 88
           DV++ V + L LLD G  R+A + D G W  +QW+KKA+LLSF++    +I  G   +  
Sbjct: 25  DVREVVDAALALLDSGKARVAEKVD-GEWRVNQWLKKAVLLSFRLQDNVVIDGGAAGAPA 83

Query: 89  WDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDT 148
           +DK+P+KF  W    F    FR++PG + R  A+IG   VLMPSFVN+GA++ EG+M+DT
Sbjct: 84  FDKVPSKFAGWDDARFRDAGFRVVPGAVARRGAHIGKGVVLMPSFVNIGAFVDEGTMVDT 143

Query: 149 WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208
           W+TVGSCAQIGKNVHISGG GIGGVLEP+Q GP IIED  FIGARSE+ EG I+ EG+VL
Sbjct: 144 WATVGSCAQIGKNVHISGGAGIGGVLEPLQAGPVIIEDGAFIGARSEVAEGVIVGEGAVL 203

Query: 209 GMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVD 268
            MGV++G STKI+DR TGE+  G+VP Y+VVVPG+ P   L     GP LYCAVI+K VD
Sbjct: 204 SMGVYLGASTKIVDRTTGEVHIGKVPPYAVVVPGAMPGKPLPDGTPGPSLYCAVIVKTVD 263

Query: 269 EKTRSKTSINTLLRD 283
            +TRSKT IN LLRD
Sbjct: 264 AQTRSKTGINELLRD 278


>gi|332283978|ref|YP_004415889.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Pusillimonas sp. T7-7]
 gi|330427931|gb|AEC19265.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Pusillimonas sp. T7-7]
          Length = 273

 Score =  314 bits (805), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 201/278 (72%), Gaps = 13/278 (4%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           ST+EE  D+  + S     +   DV+ AVQ+TL  LD G +R+A +  +G W  HQW+KK
Sbjct: 7   STIEEAWDNRADLSPISGHA---DVRAAVQATLAALDAGQLRVAEKI-SGDWVVHQWVKK 62

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++   K++  G G   ++DK+  KF D+    F +  FR++P  + R  A+IG 
Sbjct: 63  AVLLSFRLEDNKVM--GQGSLQFYDKVDTKFQDYDAAAFAQGGFRVVPPAVARRGAFIGK 120

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 121 NVVLMPSYVNVGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIE 180

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ E SVL MGVF+ +STKI DR TG +TYG VPS SVVVPGS P
Sbjct: 181 DNCFIGARSEIVEGVIVEENSVLAMGVFLSQSTKIYDRVTGTVTYGRVPSGSVVVPGSLP 240

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           + +      G H L CAVI+K+VD +TRSKTSIN LLR
Sbjct: 241 AAD------GSHSLACAVIVKRVDAQTRSKTSINDLLR 272


>gi|88812374|ref|ZP_01127624.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrococcus mobilis Nb-231]
 gi|88790381|gb|EAR21498.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrococcus mobilis Nb-231]
          Length = 272

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 151/281 (53%), Positives = 209/281 (74%), Gaps = 13/281 (4%)

Query: 5   VSTLEEIIDSFFEESN--SKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +  L+ +I++ FE+    S   + P+ ++DAV   LDLLD G +R+A + D G W  +QW
Sbjct: 1   MEQLKNVIEAAFEKRTELSPRAATPE-LRDAVAEVLDLLDTGKVRVAQQID-GEWRVNQW 58

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LL F+++  +++ DG   + ++DK+P KF D+ +++   ++ R++P  + R  AY
Sbjct: 59  LKKAVLLHFRLHDNEVMRDG--LTQYFDKVPLKFTDYNSRELAANSVRVVPPAMARRGAY 116

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I P AVLMPS+VN+GAY+  G+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q  PT
Sbjct: 117 IAPGAVLMPSYVNIGAYVDAGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPLQANPT 176

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEG I+  G+V+ MGV+IG+STKI +R TGE++YG VP  +VVVPG
Sbjct: 177 IIEDNCFIGARSEVVEGVIVGAGAVISMGVYIGQSTKIYNRETGEVSYGRVPPGAVVVPG 236

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S P+ +      G H LYCAVIIK+VDEKTR+K  IN LLR
Sbjct: 237 SLPARD------GSHSLYCAVIIKQVDEKTRAKVGINELLR 271


>gi|292492782|ref|YP_003528221.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrosococcus halophilus Nc4]
 gi|291581377|gb|ADE15834.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrosococcus halophilus Nc4]
          Length = 273

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 157/283 (55%), Positives = 206/283 (72%), Gaps = 11/283 (3%)

Query: 1   MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           M  I + +EE  +   E +  K E++   VKDAV+  L  LD G  R+A +  NG W  +
Sbjct: 1   MSDIHTIIEEAFERRAEINPRKAETL---VKDAVEEALHRLDTGEARVAEKQ-NGEWVVN 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           +W+KKA+LLSF+++    +    GY+ ++DK+P+K+ D+ ++DF +   R++P   VR  
Sbjct: 57  EWLKKAVLLSFRLSDNVFVK--GGYTNYFDKVPSKYADYSSRDFRQDGVRVVPPASVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I P  VLMPS+VN+GAY+ +G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIAPSVVLMPSYVNIGAYVDQGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAK 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI +R T EI+YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIYNRETDEISYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PG+ PS + K       LYCAVI K+VDEKTRSK  IN LLR+
Sbjct: 235 PGNLPSQDGK-----YSLYCAVIAKRVDEKTRSKVGINELLRN 272


>gi|310764953|gb|ADP09903.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Erwinia sp. Ejp617]
          Length = 274

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 155/279 (55%), Positives = 200/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ +I++ FE  ++    +     +DAV   + LLD G +R+A + D G W THQW+
Sbjct: 1   MQQLQNVIEAAFERRADITPANADTATRDAVNQAIALLDSGALRVAEKID-GQWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  ++I      S ++DK+P KF ++    F+K  FR++P   VR  ++I
Sbjct: 60  KKAVLLSFRINDNQVIEGAE--SRFYDKVPMKFANYDEARFKKEGFRVVPPAAVRQGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KT SKT +N LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTLSKTGLNELLR 271


>gi|323143549|ref|ZP_08078226.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Succinatimonas hippei YIT 12066]
 gi|322416612|gb|EFY07269.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Succinatimonas hippei YIT 12066]
          Length = 281

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 158/278 (56%), Positives = 201/278 (72%), Gaps = 9/278 (3%)

Query: 6   STLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           + L EII++ F+   +    S+  +V+DA+   +  LD G +R+A + D G W T+QWIK
Sbjct: 4   TKLIEIIENAFDNRAAISATSVDANVRDAINDVIAGLDDGSLRVAEKVD-GEWVTNQWIK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF+I    +     G   ++DK+P KFD +  + F K   R++PG +VR  +YI 
Sbjct: 63  KAVLLSFRIQDNFVTEAPGG--AFYDKVPLKFDGYTAERFAKEGLRVVPGAVVRRGSYIE 120

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P AVLMPSFVN+GA +G G+M+DTW+TVGSCAQ+GK+VH+SGG GIGGVLEP+Q GPTII
Sbjct: 121 PNAVLMPSFVNIGARVGSGTMVDTWATVGSCAQVGKHVHLSGGAGIGGVLEPVQAGPTII 180

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSEIVEG I+ EGSV+ MGVFIGKSTKI DR TGEI YG+VP YSVVV G+ 
Sbjct: 181 EDNCFIGARSEIVEGVIVGEGSVISMGVFIGKSTKIYDRTTGEIMYGKVPPYSVVVSGNL 240

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           PS + K       LY A+I+K VDEKTRSK  +N LLR
Sbjct: 241 PSKDGK-----YSLYAAIIVKHVDEKTRSKIGLNELLR 273


>gi|284008523|emb|CBA75048.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Arsenophonus nasoniae]
          Length = 278

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 159/286 (55%), Positives = 199/286 (69%), Gaps = 15/286 (5%)

Query: 1   MITIVSTLEEIIDSFFEESNSKNESIPQ----DVKDAVQSTLDLLDRGIIRIASRDDNGH 56
           M   +  L+ II++ FE    + E  P      + DA+   ++ LD+G +R+A + D G 
Sbjct: 1   MSNFMEQLKTIIENAFEH---RAEITPATTDIQLSDAINQVINQLDKGQLRVADKID-GQ 56

Query: 57  WNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTI 116
           W THQW+KKA+LLSF IN  ++I      S ++DK+  KF D+    F++  FR++P   
Sbjct: 57  WITHQWLKKAVLLSFLINDNRLIEGAE--SCYFDKVAMKFADYDHARFQQEGFRVVPPAT 114

Query: 117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP 176
            R  AYI    VLMPS+VN+GAYI EGSMIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP
Sbjct: 115 ARKGAYIARNTVLMPSYVNIGAYIDEGSMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEP 174

Query: 177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY 236
           +Q  PTIIEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG +P+ 
Sbjct: 175 LQANPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRQTGEILYGRIPAG 234

Query: 237 SVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           SVVV G+ P+ N         LYCA+I+KKVDEKTR K  IN LLR
Sbjct: 235 SVVVAGNLPAKN-----GNYSLYCAIIVKKVDEKTRKKVGINELLR 275


>gi|171463265|ref|YP_001797378.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171192803|gb|ACB43764.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 275

 Score =  313 bits (803), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 159/276 (57%), Positives = 208/276 (75%), Gaps = 7/276 (2%)

Query: 9   EEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           + II+  +E  +N   +S P DV++AV + L+ L+ G IR+A R D G W  +QW+KKA+
Sbjct: 6   QNIIEQAWENRTNLSPDSAPVDVRNAVNAVLEGLNAGTIRVAERRDVGKWEVNQWVKKAV 65

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++   K +  G GY+ ++DK+P+KF+++   DF    FR++P  + R  ++IG  A
Sbjct: 66  LLSFRLEDNKPMGAG-GYTQFYDKVPSKFENYTAADFAAGGFRVVPPAVARRGSFIGKNA 124

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEPIQ GP IIEDN
Sbjct: 125 VLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPIQAGPVIIEDN 184

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGARSE+VEG +I E +VL MGV+IG+STKI DR TGE+ YG VP+ SVVVPGS PS 
Sbjct: 185 CFIGARSEVVEGVVIEENAVLSMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVPGSLPSA 244

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
             K       LY A+I+KKVD +TR+KT+IN LLRD
Sbjct: 245 CGK-----YSLYAAIIVKKVDAQTRTKTAINELLRD 275


>gi|253996073|ref|YP_003048137.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Methylotenera mobilis JLW8]
 gi|253982752|gb|ACT47610.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylotenera mobilis JLW8]
          Length = 275

 Score =  313 bits (803), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 154/276 (55%), Positives = 201/276 (72%), Gaps = 9/276 (3%)

Query: 9   EEIIDSFFEESNSKNE-SIPQDVKDAVQSTLDLLDRGIIRIASR-DDNGHWNTHQWIKKA 66
           + II++ FE+  + N  +   ++K  V S L  LD G +R+ASR  D   W THQW+KKA
Sbjct: 5   QSIIEAAFEDRANINPGNASAEIKSTVASVLADLDSGTLRVASRIADTQQWETHQWLKKA 64

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++   +++ DG   + ++DK+P KF D+  +DF+   FR++P  IVR  ++IG  
Sbjct: 65  VLLSFRLKDNELMDDG--VTKYFDKVPPKFADYTEEDFKAGGFRVVPNAIVRRGSFIGKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           AVLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII D
Sbjct: 123 AVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQAGPTIIGD 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ +  V+ MGV+IG+STKI DR TGE+ YG VP+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEDNCVISMGVYIGQSTKIYDRETGEVFYGRVPAGSVVVSGNLPS 242

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            +         LYCAVI+KKVD KT  K  IN LLR
Sbjct: 243 KD-----GSYSLYCAVIVKKVDAKTLGKVGINELLR 273


>gi|317046979|ref|YP_004114627.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pantoea sp. At-9b]
 gi|316948596|gb|ADU68071.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pantoea sp. At-9b]
          Length = 274

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/279 (55%), Positives = 199/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ +I+S FE  ++    S+    ++A+   + LLD G +R+ S   NG W THQW+
Sbjct: 1   MQQLQSVIESAFERRADITPTSVDSVTREAINQVIGLLDSGELRV-SEKINGEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +++      + ++DK+P KF +W    F+K  FR++P   VR  A+I
Sbjct: 60  KKAVLLSFRINDNQVMEGAE--TRFYDKVPMKFANWDEARFKKEGFRVVPPAAVRQGAFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|294010143|ref|YP_003543603.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Sphingobium japonicum UT26S]
 gi|292673473|dbj|BAI94991.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Sphingobium japonicum UT26S]
          Length = 279

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 194/272 (71%), Gaps = 1/272 (0%)

Query: 12  IDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSF 71
           ID+ +E+  + + S    V+ AV   L +LD G +R+A     G W  +QW KKA+LLSF
Sbjct: 9   IDAAWEDRANVSLSTQGAVRQAVDKALAMLDSGELRVAEPTAEG-WRVNQWAKKAVLLSF 67

Query: 72  QINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMP 131
           ++N   +I +G G   WWDK+P+KF  W    F    FR +PG+  R  A+I    +LMP
Sbjct: 68  RLNDNVMIDNGPGAGHWWDKVPSKFAGWDEAAFRAAGFRAVPGSFARAGAHIAKNVILMP 127

Query: 132 SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIG 191
           SFVN+GA++ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED+CFIG
Sbjct: 128 SFVNIGAFVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQADPVIIEDDCFIG 187

Query: 192 ARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKG 251
           ARSE+VEG  + +GSVL MGVFIG+STKI+DR TGE+  GEVP YSVVVPGS P   L  
Sbjct: 188 ARSEVVEGVRVGKGSVLSMGVFIGQSTKIVDRATGEVFMGEVPPYSVVVPGSLPGKPLPD 247

Query: 252 DIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              GP LYCAVI+K+VD +TRSKT IN LLRD
Sbjct: 248 GTPGPSLYCAVIVKRVDAQTRSKTGINELLRD 279


>gi|30250383|ref|NP_842453.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Nitrosomonas europaea ATCC 19718]
 gi|71153298|sp|Q82S90|DAPD_NITEU RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|30181178|emb|CAD86374.1| Bacterial transferase hexapeptide repeat [Nitrosomonas europaea
           ATCC 19718]
          Length = 273

 Score =  313 bits (802), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 155/282 (54%), Positives = 205/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + E  P++V    K++V   +++LD G +R+A +  NG W  H
Sbjct: 1   MEQLQAVIENAFER---RAEITPRNVEANLKESVAQVINMLDTGKLRVAEKI-NGEWVVH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QWIKKA+LLSF++     I    G+S ++DKIP+KF D+ ++DF    FR++P   VR  
Sbjct: 57  QWIKKAVLLSFRMEDNSFIK--GGFSNYFDKIPSKFADYSSRDFRDGGFRVVPPAAVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           ++I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 SFIASNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQAS 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSEIVEG ++ E SV+ MGV+IG+STKI +R TGEITYG +P  SVVV
Sbjct: 175 PTIIEDNCFIGARSEIVEGVVVGENSVISMGVYIGQSTKIYNRETGEITYGRIPPGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ P+ N +       LYCAVI+K+VD KTRSKT IN LLR
Sbjct: 235 SGNLPAENGR-----YSLYCAVIVKQVDAKTRSKTGINELLR 271


>gi|270157422|ref|ZP_06186079.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Legionella longbeachae D-4968]
 gi|289164184|ref|YP_003454322.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Legionella longbeachae NSW150]
 gi|269989447|gb|EEZ95701.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Legionella longbeachae D-4968]
 gi|288857357|emb|CBJ11185.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Legionella longbeachae NSW150]
          Length = 273

 Score =  313 bits (801), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 153/277 (55%), Positives = 202/277 (72%), Gaps = 9/277 (3%)

Query: 7   TLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           TL+ +I+  FE+  + + ++   ++  A+   L  LD G +R+A + +N  W  HQWIKK
Sbjct: 3   TLQTLIEQAFEQRQTLSIDTATPELIAAINEVLSCLDSGQLRVAEKINN-DWFVHQWIKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++NP +II   +G+  ++DK+P K+ ++  + F++   R++P  IVR  AYI  
Sbjct: 62  AVLLSFKLNPNQIID--SGFCQFYDKVPLKYTNYSEEQFKQTGVRVVPHAIVRKGAYIAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAYI EG M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NCVLMPSYVNIGAYIDEGVMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+   SVL MGV++G+STKI +R TGEITYG +P  SVVV GS P
Sbjct: 180 DNCFIGARSEVVEGVIVERNSVLSMGVYLGQSTKIYNRLTGEITYGRIPEGSVVVAGSLP 239

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S     +     LYCAVI+K+VDEKTR+K SIN LLR
Sbjct: 240 S-----EDKSYSLYCAVIVKQVDEKTRAKVSINELLR 271


>gi|237808860|ref|YP_002893300.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Tolumonas auensis DSM 9187]
 gi|259586144|sp|C4L868|DAPD_TOLAT RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|237501121|gb|ACQ93714.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Tolumonas auensis DSM 9187]
          Length = 275

 Score =  313 bits (801), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 160/279 (57%), Positives = 202/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ IID  FE  +S    S+   V++AV  T+D+LD G IR+A +   G W  HQW+
Sbjct: 1   MSDLQHIIDDAFERRDSITPNSVDPIVREAVLQTIDMLDAGQIRVAEKI-AGEWVVHQWV 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LL F+IN   ++  G G + ++DK+P KF D+  + F++ + R++P   VR  ++I
Sbjct: 60  KKAVLLYFRINDNAVLQ-GAG-TQYYDKVPLKFADYTPERFKQESIRVVPPATVRKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
              AVL+PS+VN+GAY+GEGSM+DTW+TVGSCAQIG NVH+SGGVGIGGVLEP+Q GPTI
Sbjct: 118 ARNAVLLPSYVNIGAYVGEGSMVDTWATVGSCAQIGANVHLSGGVGIGGVLEPLQAGPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGEI YG VP  SVVV GS
Sbjct: 178 IEDNCFIGARSEVVEGVIVGEGSVISMGVFIGQSTRIYDRETGEIHYGRVPPGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LY AVI+KKVD KTRSK  IN LLR
Sbjct: 238 LPS-----KCGKYSLYAAVIVKKVDAKTRSKVGINALLR 271


>gi|259907539|ref|YP_002647895.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Erwinia pyrifoliae Ep1/96]
 gi|224963161|emb|CAX54645.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erwinia pyrifoliae Ep1/96]
 gi|283477379|emb|CAY73295.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erwinia pyrifoliae DSM 12163]
          Length = 274

 Score =  312 bits (800), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 199/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ +I++ FE  ++    +     +DAV   + LLD G +R+A + D G W THQW+
Sbjct: 1   MQQLQNVIEAAFEHRADITPANADTATRDAVNQAIALLDSGALRVAEKID-GQWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  ++I      S ++DK+P KF  +    F+K  FR++P   VR  ++I
Sbjct: 60  KKAVLLSFRINDNQVIEGAE--SRFYDKVPMKFAHYDEARFKKEGFRVVPPAAVRQGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               +LMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTILMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KT SKT +N LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTLSKTGLNELLR 271


>gi|224827290|ref|ZP_03700383.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Lutiella nitroferrum 2002]
 gi|224600503|gb|EEG06693.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Lutiella nitroferrum 2002]
          Length = 273

 Score =  312 bits (800), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 152/273 (55%), Positives = 201/273 (73%), Gaps = 10/273 (3%)

Query: 11  IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I D+F + +     ++  ++K A+   +D LD G +R+A + D G W  +QW+KKA+LLS
Sbjct: 8   IEDAFEKRAEITPATVSAELKAAIGQVIDELDAGRLRVADKID-GDWVVNQWVKKAVLLS 66

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F+I    ++ DG   S ++DK+  KF DW  + F++  FR++PG + R  ++I    VLM
Sbjct: 67  FRIRDNAVLDDG--VSRYFDKVDTKFADWNQERFQQAGFRVVPGAVARKGSFIAKNTVLM 124

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIEDNCFI
Sbjct: 125 PSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDNCFI 184

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG I+ EGSV+ MGV+IG+STKI DR TGE++YG +P  SVVV G+ PS +  
Sbjct: 185 GARSEVVEGVIVGEGSVISMGVYIGQSTKIYDRETGEVSYGRIPPGSVVVSGNLPSKD-- 242

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+KKVD +TRSKTSIN LLR
Sbjct: 243 ----GSHSLYCAVIVKKVDAQTRSKTSINDLLR 271


>gi|312796234|ref|YP_004029156.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia rhizoxinica HKI 454]
 gi|312168009|emb|CBW75012.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase (EC
           2.3.1.117) [Burkholderia rhizoxinica HKI 454]
          Length = 314

 Score =  312 bits (799), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 201/276 (72%), Gaps = 8/276 (2%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    +S P D+++AV   +  LDRG +R+A + D G W  +QW+KKA
Sbjct: 44  LQQIIDTAWENRAELSPKSAPADIREAVAHVIGELDRGTLRVAEKKD-GDWVVNQWLKKA 102

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     ++ G GYS ++DK+P+KF ++  +DF    FR++P  I R  +YI   
Sbjct: 103 VLLSFRLEDNVPMAAG-GYSQFYDKVPSKFANYTPEDFAAGGFRVVPPAIARRGSYIAKN 161

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 162 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 221

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+ YG VP  SVVV G+ PS
Sbjct: 222 NCFIGARSEVVEGVIVGENSVISMGVYLGQSTKIYDRETGEVMYGRVPPGSVVVAGNLPS 281

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            + K       LYCAVI+KKVD KTRSK  IN LLR
Sbjct: 282 ADGKYS-----LYCAVIVKKVDAKTRSKVGINELLR 312


>gi|319779616|ref|YP_004130529.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Taylorella equigenitalis MCE9]
 gi|317109640|gb|ADU92386.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Taylorella equigenitalis MCE9]
          Length = 271

 Score =  312 bits (799), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 157/278 (56%), Positives = 209/278 (75%), Gaps = 15/278 (5%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVK--DAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
            E++I+S ++   +K+E  PQ+ +    V+  +D LD+G IR+A +  N  W  +QW+KK
Sbjct: 5   FEDLINSAWD---NKSELTPQNTELFQTVEQVIDDLDKGKIRVAEKI-NSEWRVNQWVKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++   K+I++      ++DK+P KF+++ ++DF+   FR++P  + R  A+I  
Sbjct: 61  AVLLSFKLRENKVINEVP--LQYFDKVPLKFENFTSEDFKNSGFRVVPPAVARRGAFIDK 118

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAYIGEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 119 NVVLMPSYVNIGAYIGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIE 178

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ E SVL MGV++ +STKI +R+TGEI+YG VPS SVVVPGS P
Sbjct: 179 DNCFIGARSEIVEGVIVEENSVLSMGVYLSQSTKIYNRDTGEISYGRVPSGSVVVPGSLP 238

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H L CAVI+K+VD KTRSKTSIN LLR
Sbjct: 239 SKD------GSHSLACAVIVKRVDAKTRSKTSINDLLR 270


>gi|300113652|ref|YP_003760227.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrosococcus watsonii C-113]
 gi|299539589|gb|ADJ27906.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrosococcus watsonii C-113]
          Length = 273

 Score =  311 bits (798), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 153/278 (55%), Positives = 204/278 (73%), Gaps = 11/278 (3%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + +EE  +   E S  K E++   VKDAV+  L LLD G  R+A +   G W  ++W+KK
Sbjct: 6   AIIEEAFERRAEISPRKAETL---VKDAVEEALYLLDTGKARVAEKQ-KGEWIVNEWLKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+++    +    GY+ ++DK+P+K+ D+ ++DF +   R++P   VR  A+I P
Sbjct: 62  AVLLSFRLSDNVFMK--GGYTNYFDKVPSKYADYSSRDFRQDEVRVVPPASVRKGAFIAP 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ +G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 SVVLMPSYVNIGAYVDQGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAKPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           +NCF+GARSEIVEG I+ EGSV+ MGVFIG+ST+I DR T  I+YG VP+ SVVVPG+ P
Sbjct: 180 NNCFVGARSEIVEGVIVEEGSVISMGVFIGQSTRIYDRETDTISYGRVPAGSVVVPGNLP 239

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S + K       LYCAVI+K+VDEKTRSK  IN LLR+
Sbjct: 240 SQDGK-----YSLYCAVIVKQVDEKTRSKVGINELLRN 272


>gi|53804425|ref|YP_113947.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Methylococcus capsulatus str. Bath]
 gi|71153294|sp|Q608K0|DAPD_METCA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|53758186|gb|AAU92477.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylococcus capsulatus str. Bath]
          Length = 271

 Score =  311 bits (798), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 158/279 (56%), Positives = 204/279 (73%), Gaps = 11/279 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +LE II+  FE  +     ++  +V++AV   L LLD G  R+A + D G W  +QW+KK
Sbjct: 2   SLENIINEAFENRAQISPGTVGAEVREAVAEALRLLDSGAARVAEKKDGG-WVVNQWLKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+IN  +++ DG G + ++DK+  KF  +  ++F     R++P   VR  AYI P
Sbjct: 61  AVLLSFRINDNRVM-DG-GETRYFDKVEPKFGGFGPEEFRAAGVRVVPPAAVRRGAYIAP 118

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             +LMPS+VN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTIIE
Sbjct: 119 GVILMPSYVNIGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTIIE 178

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI +R TGEI+YG VP+ SVVV G+ P
Sbjct: 179 DNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYNRMTGEISYGRVPAGSVVVSGNLP 238

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLRD 283
           + +      G H LYCAVIIK+VDEKTR K  IN LLRD
Sbjct: 239 ARD------GSHSLYCAVIIKQVDEKTRGKVGINELLRD 271


>gi|296106467|ref|YP_003618167.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Legionella pneumophila 2300/99 Alcoy]
 gi|295648368|gb|ADG24215.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Legionella pneumophila 2300/99 Alcoy]
 gi|307609679|emb|CBW99187.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Legionella pneumophila 130b]
          Length = 276

 Score =  311 bits (797), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 154/280 (55%), Positives = 202/280 (72%), Gaps = 11/280 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +++L+ +I+  FE   N    ++  D+ +A+   L  LD G  R+A +  NG W  HQW+
Sbjct: 1   MNSLQALIEQAFENRQNLSLNTVSSDLINAINEVLSGLDNGQFRVAEKI-NGEWTVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++ P +II  G  +  ++DKIP K+ D   + F++   R++P  +VR  AYI
Sbjct: 60  KKAVLLSFKLFPNQIIDAG--FCKFYDKIPLKYTDSSNEQFQQSGVRVVPHAMVRRGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAYI EG M+DTW+TVGSCAQIGKNVHISGG GIGGVLEP+Q  PTI
Sbjct: 118 AKNTVLMPSYVNIGAYIDEGVMVDTWATVGSCAQIGKNVHISGGAGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ + SV+ MGVF+G+STKI +R TGE++YG +P+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEKNSVISMGVFLGQSTKIYNRITGEVSYGRIPAGSVVVAGN 237

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +      G H LYCAVI+K+VDEKTR+K SIN LLR
Sbjct: 238 LPSHD------GSHSLYCAVIVKQVDEKTRAKVSINDLLR 271


>gi|114799814|ref|YP_759151.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Hyphomonas neptunium ATCC 15444]
 gi|114739988|gb|ABI78113.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Hyphomonas neptunium ATCC 15444]
          Length = 275

 Score =  311 bits (797), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 156/280 (55%), Positives = 205/280 (73%), Gaps = 5/280 (1%)

Query: 4   IVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +   L  +ID+ +E  +  + S   +V+DAV + + LLD G  R+AS++ +G W  HQW+
Sbjct: 1   MTDALARVIDAAWEGRDLLSTSTTGEVRDAVDAAISLLDSGEARVASKEADGSWTVHQWL 60

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N   ++        WWDK+P+KF+ W  K+F++  FR +P   VR  A++
Sbjct: 61  KKAVLLSFRLNANGVMGGSPAGGNWWDKVPSKFEGWGEKEFQEAGFRAVPPAAVRRGAFV 120

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
              AVLMPS+VN+GAY+GEG+MIDTW++VGSCAQ+G N HIS G GIGGVLEP+Q  PTI
Sbjct: 121 AKNAVLMPSYVNIGAYVGEGTMIDTWASVGSCAQVGANCHISAGTGIGGVLEPLQANPTI 180

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG ++ EGSVL MGVFI +STKI+ R+TGEI YG+VP YSVVVPG+
Sbjct: 181 IEDNCFIGARSEVVEGVVVGEGSVLAMGVFITQSTKIVYRSTGEIIYGKVPPYSVVVPGT 240

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            P  + KG   GP L CAVI+K VD +TRSKT +N LLRD
Sbjct: 241 LP--DPKG---GPSLACAVIVKTVDAQTRSKTGVNELLRD 275


>gi|308185737|ref|YP_003929868.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase
           [Pantoea vagans C9-1]
 gi|308056247|gb|ADO08419.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase
           [Pantoea vagans C9-1]
          Length = 274

 Score =  311 bits (797), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 153/279 (54%), Positives = 199/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ +I+S FE  ++    S+  + +DA+   + LLD G +R++ + D G W THQW+
Sbjct: 1   MQQLQSVIESAFERRADITPASVDSETRDAINQVISLLDSGELRVSEKID-GEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +++      + ++DK+P KF  W    F+   FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINDNQVMEGSE--TRFYDKVPMKFAGWDEARFKAAGFRVVPPAAVRQGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KT  KT IN LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTLGKTGINELLR 271


>gi|304396641|ref|ZP_07378522.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pantoea sp. aB]
 gi|304356150|gb|EFM20516.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pantoea sp. aB]
          Length = 274

 Score =  311 bits (797), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 153/279 (54%), Positives = 199/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ +I+S FE  ++    S+  + +DA+   + LLD G +R+A + D G W THQW+
Sbjct: 1   MQQLQSVIESAFERRADITPASVDSETRDAINQVISLLDSGELRVAEKID-GEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +++      + ++DK+P KF  W    F++  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINDNQVMEGSE--TRFYDKVPMKFAGWDEARFKEAGFRVVPPAAVRQGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+  GSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEAGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KT  KT IN LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTLGKTGINELLR 271


>gi|332288588|ref|YP_004419440.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Gallibacterium anatis UMN179]
 gi|330431484|gb|AEC16543.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Gallibacterium anatis UMN179]
          Length = 275

 Score =  311 bits (796), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 161/283 (56%), Positives = 203/283 (71%), Gaps = 17/283 (6%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +S L++II+  FE    + E  P  V    + AV+  +  LD+G  R+A +  NG W  +
Sbjct: 1   MSNLQQIIEEAFER---RAEITPTTVDAATRAAVEEVIQDLDKGKRRVAEKV-NGEWVVN 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +I+ DG   + ++DK+P KF ++    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQIV-DG-AETKYYDKVPMKFANYDEARFKQEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIAKNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            GS PS +      G H LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGSLPSKD------GSHSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|295691221|ref|YP_003594914.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Caulobacter segnis ATCC 21756]
 gi|295433124|gb|ADG12296.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Caulobacter segnis ATCC 21756]
          Length = 281

 Score =  311 bits (796), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 164/282 (58%), Positives = 201/282 (71%), Gaps = 9/282 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +S L+  I++ +E     + +    V+ AV+  L LLD G  R++ + D G W THQW+K
Sbjct: 6   LSDLQTEIEAAWEARADVSAATTGPVRTAVEEALLLLDSGKARVSEKID-GEWVTHQWLK 64

Query: 65  KAILLSFQINPTKIISDGN---GYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           KA+LLSF++NP  ++  G        WWDK+P KFD W    FE   FR +PG IVR  A
Sbjct: 65  KAVLLSFRLNPNTVMRAGTLGGAVGPWWDKVPNKFDGWDAPQFEAGGFRAVPGAIVRRGA 124

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           +IG   +LMPSFVN+G Y+ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P
Sbjct: 125 HIGKNVILMPSFVNIGGYVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANP 184

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIEDNCFIGARSE+VEG ++ EGSVL MGVFI  STKI+DR TG++  G+VP YSVVVP
Sbjct: 185 TIIEDNCFIGARSEVVEGVVVGEGSVLSMGVFISASTKIVDRKTGQVHIGKVPPYSVVVP 244

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           GS P  N      GP LYCAVI+K VD +TRSKTSIN LLRD
Sbjct: 245 GSLPDPN-----GGPSLYCAVIVKTVDAQTRSKTSINDLLRD 281


>gi|52841123|ref|YP_094922.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|54296908|ref|YP_123277.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Legionella pneumophila str. Paris]
 gi|71153290|sp|Q5X6L6|DAPD_LEGPA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|71153291|sp|Q5ZX45|DAPD_LEGPH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|52628234|gb|AAU26975.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase DapD
           [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|53750693|emb|CAH12100.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Legionella pneumophila str. Paris]
          Length = 276

 Score =  311 bits (796), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 154/280 (55%), Positives = 203/280 (72%), Gaps = 11/280 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +++L+++I+  FE   N   ++   D+ +A+   L  LD G  R+A +  NG W  HQW+
Sbjct: 1   MNSLQDLIEQAFENRQNLSLDTASSDLINAINEVLSGLDNGQFRVAEKI-NGEWTVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++ P +II  G  +  ++DKIP K+ D   + F++   R++P  +VR  AYI
Sbjct: 60  KKAVLLSFKLFPNQIIDAG--FCKFYDKIPLKYTDCSNEQFQQSGVRVVPHAMVRRGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAYI EG M+DTW+TVGSCAQIGKNVHISGG GIGGVLEP+Q  PTI
Sbjct: 118 AKNTVLMPSYVNIGAYIDEGVMVDTWATVGSCAQIGKNVHISGGAGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ + SV+ MGVF+G+STKI +R TGE++YG +P+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEKNSVISMGVFLGQSTKIYNRITGEVSYGRIPAGSVVVAGN 237

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +      G H LYCAVI+K+VDEKTR+K SIN LLR
Sbjct: 238 LPSHD------GSHSLYCAVIVKQVDEKTRAKVSINDLLR 271


>gi|149185593|ref|ZP_01863909.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erythrobacter sp. SD-21]
 gi|148830813|gb|EDL49248.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erythrobacter sp. SD-21]
          Length = 274

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 149/280 (53%), Positives = 197/280 (70%), Gaps = 10/280 (3%)

Query: 6   STLEEIIDSFFEESNSKNESIPQ--DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           + LE  I++ +E+   +    PQ  DV++AV + L++LD G  R+A  D  G W  +QW+
Sbjct: 3   ADLETRIEAAWED---RANVTPQSSDVREAVDAALEMLDSGTGRVAEPDGKGAWTVNQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  +++  G+     +DK+P+KF  W    F +  FR++PG + R  AYI
Sbjct: 60  KKAVLLSFRLNDNRVMEGGSAGHPAFDKVPSKFAGWDDARFREAGFRVVPGAVAREGAYI 119

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPSFVN+GAY+G+G+M+DTW+++GSCAQIG+N HIS G GIGGVLEP+Q  PTI
Sbjct: 120 APGCVLMPSFVNIGAYVGKGTMVDTWASIGSCAQIGENCHISAGAGIGGVLEPMQANPTI 179

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ EG V+ MGVFI +STKI+ R TGE+  G +P YSVVVPG+
Sbjct: 180 IGDNCFIGARSELVEGVIVGEGCVVSMGVFITQSTKIVYRETGEVIRGHLPPYSVVVPGT 239

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            P     G   GP L CAVI+K VD +TR KT IN LLRD
Sbjct: 240 LP-----GKDGGPGLACAVIVKTVDAQTREKTGINDLLRD 274


>gi|114330256|ref|YP_746478.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Nitrosomonas eutropha C91]
 gi|122314691|sp|Q0AJF8|DAPD_NITEC RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|114307270|gb|ABI58513.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Nitrosomonas eutropha C91]
          Length = 273

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 203/279 (72%), Gaps = 15/279 (5%)

Query: 8   LEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           L+ +I+  FE    + E  P++V    K++V   +++LD G +R+A +  N  W T QW+
Sbjct: 4   LQAVIEDAFER---RAEITPRNVEANLKESVAQVINMLDTGKLRVAEKI-NDEWVTRQWV 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++     I    G+S ++DKIP+KF D+ ++DF    FR++P   VR  A+I
Sbjct: 60  KKAVLLSFRMEDNYFIK--GGFSNYFDKIPSKFADYSSRDFRDGGFRVVPPAAVRKGAFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQ+GKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ANNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQVGKNVHLSGGVGIGGVLEPVQASPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ E SV+ MGV+IG+ST+I +R TGE+TYG +PS SVVV GS
Sbjct: 178 IEDNCFIGARSEIVEGVIVGENSVISMGVYIGQSTRIYNRETGEVTYGRIPSGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            P+ N +       LYCAVI+K+VD KTRSKT IN LLR
Sbjct: 238 LPADNGR-----YSLYCAVIVKQVDAKTRSKTGINELLR 271


>gi|167648515|ref|YP_001686178.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Caulobacter sp. K31]
 gi|167350945|gb|ABZ73680.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Caulobacter sp. K31]
          Length = 286

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 161/282 (57%), Positives = 204/282 (72%), Gaps = 9/282 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++ L   +++ +E  +  + +    V+ AV+ TL L+D G +R++ + D G W THQW+K
Sbjct: 11  LADLRTEVEAAWEARDGVSTATTGPVRTAVEETLLLIDAGKVRVSEKLD-GEWTTHQWLK 69

Query: 65  KAILLSFQINPTKIISDGN---GYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           KA+LLSF++NP  I+  G        WWDK+P KFD W+   FE   FR +PG+IVR  A
Sbjct: 70  KAVLLSFRLNPNAIMRAGTMGGAVGPWWDKVPNKFDGWEAPQFEAAGFRAVPGSIVRRGA 129

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YIG   +LMPSFVN+GAY+ + +M+DTW TVGSCAQIGK VH+SGGVG+GGVLEP+Q  P
Sbjct: 130 YIGKNVILMPSFVNIGAYVDDSTMVDTWVTVGSCAQIGKRVHLSGGVGVGGVLEPLQANP 189

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           T+IED+CFIGARSE+VEG +I EGSVL MGVFI  STKI+DR TG +  G+VP YSVVVP
Sbjct: 190 TVIEDDCFIGARSEVVEGVVIGEGSVLSMGVFISMSTKIVDRATGAVHIGKVPPYSVVVP 249

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           GS P  + KG   GP L CAVI+K VD KTRSKTSIN LLRD
Sbjct: 250 GSLP--DPKG---GPSLSCAVIVKTVDAKTRSKTSINDLLRD 286


>gi|329296139|ref|ZP_08253475.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Plautia stali symbiont]
          Length = 274

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 156/279 (55%), Positives = 200/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ +I+S FE  ++    S+    ++A+   + LLD G +R+ S   NG W THQW+
Sbjct: 1   MQQLQSVIESAFERRADITPTSVDSATREAINQVIGLLDSGELRV-SEKINGEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  ++I DG   + ++DK+P KF  W    F+   FR++P   VR  A+I
Sbjct: 60  KKAVLLSFRINDNQVI-DG-AETRFYDKVPMKFSGWDEARFKSAGFRVVPPAAVRQGAFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KT +KT IN LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTLAKTCINELLR 271


>gi|302878937|ref|YP_003847501.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Gallionella capsiferriformans ES-2]
 gi|302581726|gb|ADL55737.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Gallionella capsiferriformans ES-2]
          Length = 273

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 152/276 (55%), Positives = 199/276 (72%), Gaps = 9/276 (3%)

Query: 8   LEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++II++ FE  ++    +    +K+AV + +  LD G +R+A + D G W THQW+KKA
Sbjct: 4   LQQIIEAAFERRADITPRNADAQLKEAVDAVISKLDNGTLRVAEKID-GEWVTHQWLKKA 62

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     I    G++ ++DK+P+KF D+ ++DF +  FR++P    R  AYI   
Sbjct: 63  VLLSFRLEDNAFIK--GGFTNYYDKVPSKFADYNSRDFREGGFRVVPPAAARKGAYIAKN 120

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTII D
Sbjct: 121 VVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQANPTIIGD 180

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCF+GARSEIVEG I+ +  V+ MGVFIG+STKI DR TG +TYG VP+ SVVV GS PS
Sbjct: 181 NCFVGARSEIVEGVILEDNVVISMGVFIGQSTKIYDRETGTVTYGRVPAGSVVVSGSLPS 240

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            + K       LYCAVI+KKVD KT SK  IN LLR
Sbjct: 241 ADGK-----YSLYCAVIVKKVDAKTLSKVGINELLR 271


>gi|113460928|ref|YP_718995.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus somnus 129PT]
 gi|170717481|ref|YP_001784576.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus somnus 2336]
 gi|123132023|sp|Q0I2K0|DAPD_HAES1 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|189082815|sp|B0UTX7|DAPD_HAES2 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|112822971|gb|ABI25060.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus somnus 129PT]
 gi|168825610|gb|ACA30981.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus somnus 2336]
          Length = 275

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 200/279 (71%), Gaps = 8/279 (2%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II+  FE  +     +   +++ AV   ++ LD+GI R+A +++ G W  +QW+
Sbjct: 1   MSNLQNIIECAFERVAEITPTNAEAELRAAVDEAIEGLDKGIYRVAEKNEQGEWIVNQWL 60

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N   ++ DG   + ++DK+P KF D+  + F+   FR +PG +VR  ++I
Sbjct: 61  KKAVLLSFRLNDN-VVVDG-AETKYYDKVPVKFADYDVERFKTEGFRAVPGAVVRKGSHI 118

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPSFVN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 119 SKGVVLMPSFVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 178

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSEIVEG I+ EG V+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 179 IGDNCFIGARSEIVEGVIVEEGCVISMGVFIGQSTKIYDRETGEIFYGRVPAGSVVVSGS 238

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS          +LYCAVI+KKVD KT  K  IN LLR
Sbjct: 239 LPS-----KCGKYNLYCAVIVKKVDAKTLGKVGINELLR 272


>gi|85059924|ref|YP_455626.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Sodalis glossinidius str. 'morsitans']
 gi|123518936|sp|Q2NRK4|DAPD_SODGM RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|84780444|dbj|BAE75221.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Sodalis glossinidius str. 'morsitans']
          Length = 274

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 152/279 (54%), Positives = 200/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           + +L++ I++ FE+  +    ++    +DAV   +  LD G +R+A +  NG W THQW+
Sbjct: 1   MQSLQQNIETAFEQRAAITPANVDATTRDAVNQVIAALDSGTLRVAEKI-NGEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I   ++I  G   + ++DK+P KF  W ++ F++  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRIADNQLIEGGE--TRFFDKVPMKFAGWDSERFQREGFRVVPPASVRQGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ E +M+DTW+TVGSCAQIGKNVH+SGG GIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAYVDESTMVDTWATVGSCAQIGKNVHLSGGAGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGVFIG+STKI DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEMVEGVIVEEGSVISMGVFIGQSTKIYDRETGEVHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + +       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 238 LPSKDGR-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|54293863|ref|YP_126278.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Legionella pneumophila str. Lens]
 gi|71153292|sp|Q5WY20|DAPD_LEGPL RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|53753695|emb|CAH15153.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Legionella pneumophila str. Lens]
          Length = 276

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESI---PQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           +++L+ +I+  FE  N +N S+     D+ +A+   L  LD G  R+A +  NG W  HQ
Sbjct: 1   MNSLQALIEQAFE--NRQNLSLNTASSDLINAINEVLSGLDNGQFRVAEKI-NGEWTVHQ 57

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+LLSF++ P +II  G  +  ++DKIP K+ D   + F++   R++P  +VR  A
Sbjct: 58  WLKKAVLLSFKLFPNQIIDAG--FCKFYDKIPLKYTDSSNEQFQQSGVRVVPHAMVRRGA 115

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YI    VLMPS+VN+GAYI EG M+DTW+TVGSCAQIGKNVHISGG GIGGVLEP+Q  P
Sbjct: 116 YIAKNTVLMPSYVNIGAYIDEGVMVDTWATVGSCAQIGKNVHISGGAGIGGVLEPLQANP 175

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIEDNCFIGARSEIVEG I+ + SV+ MGVF+G+STKI +R TGE++YG +P+ SVVV 
Sbjct: 176 TIIEDNCFIGARSEIVEGVIVEKNSVISMGVFLGQSTKIYNRITGEVSYGRIPAGSVVVA 235

Query: 242 GSYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           G+ PS +      G H LYCAVI+K+VDEKTR+K SIN LLR
Sbjct: 236 GNLPSHD------GSHSLYCAVIVKQVDEKTRAKVSINDLLR 271


>gi|217970596|ref|YP_002355830.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Thauera sp. MZ1T]
 gi|217507923|gb|ACK54934.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Thauera sp. MZ1T]
          Length = 273

 Score =  310 bits (794), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 152/277 (54%), Positives = 200/277 (72%), Gaps = 9/277 (3%)

Query: 7   TLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
            L+ IID+ FE   S +  S P ++++AV+  +  LD G +R+A + D G W  +QWIKK
Sbjct: 3   ALQSIIDTAFENRASLSPTSAPAEIRNAVEEVIAGLDAGTLRVAEKKD-GQWVVNQWIKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+L+SF++   +++  G     ++DK+  KF D+  + F +  FR++P  + R  ++IG 
Sbjct: 62  AVLISFRLRDNELVQAGG--LNFFDKVATKFGDYTPEQFREGGFRVVPPAVARKGSFIGR 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GP IIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQAGPVIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DN F+GARSE+VEG II E +VL MGV+IG STKI DR TGEITYG VP+ +VVVPGS P
Sbjct: 180 DNVFVGARSEVVEGVIIEENAVLSMGVYIGMSTKIYDRETGEITYGRVPAGAVVVPGSLP 239

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S   K       LYCAVI+KKVD +TR+KT IN LLR
Sbjct: 240 SACGK-----YSLYCAVIVKKVDAQTRAKTGINELLR 271


>gi|221233222|ref|YP_002515658.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Caulobacter crescentus NA1000]
 gi|220962394|gb|ACL93750.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Caulobacter crescentus NA1000]
          Length = 286

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 164/282 (58%), Positives = 200/282 (70%), Gaps = 9/282 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++ L+  I++ +E     + +    V+ AV   L LLD G  R+A + D G W THQW+K
Sbjct: 11  LADLQTEIEAAWEARADISAATTGPVRTAVDEALRLLDSGEARVAEKID-GEWFTHQWLK 69

Query: 65  KAILLSFQINPTKIISDG---NGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           KA+LLSF++NP  ++  G    G   WWDK+P KFD W    FE   FR +PG IVR  A
Sbjct: 70  KAVLLSFRLNPNTVMRSGALGGGVGPWWDKVPNKFDGWDAPQFEAGGFRAVPGAIVRRGA 129

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           +IG   +LMPSFVN+G Y+ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P
Sbjct: 130 HIGKNVILMPSFVNIGGYVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANP 189

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIEDNCFIGARSE+VEG ++ EGSVL MGVFI  STKI+DR TG +  G+VP YSVVVP
Sbjct: 190 TIIEDNCFIGARSEVVEGVVVGEGSVLSMGVFISASTKIVDRKTGAVHIGKVPPYSVVVP 249

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           G+ P  N      GP LYCAVI+K VD +TRSKTSIN LLRD
Sbjct: 250 GNLPDPN-----GGPGLYCAVIVKTVDAQTRSKTSINDLLRD 286


>gi|72393805|gb|AAZ68082.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ehrlichia canis str. Jake]
          Length = 281

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 161/290 (55%), Positives = 201/290 (69%), Gaps = 16/290 (5%)

Query: 1   MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           MI +    E I D++   SN  N S    +K  V   +DLLD+G IR+  +  +  W  +
Sbjct: 3   MIDVCDFKEVIEDAW---SNLANLSSNTSIKKVVDDVMDLLDQGRIRVCEKVGD-QWVVN 58

Query: 61  QWIKKAILLSFQINPTKI--ISDGN---GYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGT 115
           +W KKAILL F++    +  I+  N   G   W+DK+  KF  W   DF +   R +PG+
Sbjct: 59  EWAKKAILLCFRVYDMNLAEINTSNSMLGNLCWFDKVQLKFGKWSADDFRRAKIRAVPGS 118

Query: 116 IVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLE 175
           +VR SAYI P  VLMPSFVN+GAY+GEG+MIDTW++VGSCAQIGK+ HISGG GIGGVLE
Sbjct: 119 MVRKSAYIAPNVVLMPSFVNVGAYVGEGTMIDTWASVGSCAQIGKHCHISGGAGIGGVLE 178

Query: 176 PIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPS 235
           P+ + P +IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG ST+I+DR +GEI+YG +P 
Sbjct: 179 PLSSRPVVIEDNCFIGARSEIVEGVIVGEGSVISMGVYIGASTRIVDRESGEISYGRIPP 238

Query: 236 YSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS 285
           YSVVVPGSY S NL        LYCAVI+KKVD+ TRSK SIN LLRD S
Sbjct: 239 YSVVVPGSYGSGNL-------SLYCAVIVKKVDDNTRSKVSINELLRDDS 281


>gi|16124536|ref|NP_419100.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Caulobacter crescentus CB15]
 gi|13421418|gb|AAK22268.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Caulobacter crescentus CB15]
          Length = 283

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 164/282 (58%), Positives = 200/282 (70%), Gaps = 9/282 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++ L+  I++ +E     + +    V+ AV   L LLD G  R+A + D G W THQW+K
Sbjct: 8   LADLQTEIEAAWEARADISAATTGPVRTAVDEALRLLDSGEARVAEKID-GEWFTHQWLK 66

Query: 65  KAILLSFQINPTKIISDG---NGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           KA+LLSF++NP  ++  G    G   WWDK+P KFD W    FE   FR +PG IVR  A
Sbjct: 67  KAVLLSFRLNPNTVMRSGALGGGVGPWWDKVPNKFDGWDAPQFEAGGFRAVPGAIVRRGA 126

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           +IG   +LMPSFVN+G Y+ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P
Sbjct: 127 HIGKNVILMPSFVNIGGYVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANP 186

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIEDNCFIGARSE+VEG ++ EGSVL MGVFI  STKI+DR TG +  G+VP YSVVVP
Sbjct: 187 TIIEDNCFIGARSEVVEGVVVGEGSVLSMGVFISASTKIVDRKTGAVHIGKVPPYSVVVP 246

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           G+ P  N      GP LYCAVI+K VD +TRSKTSIN LLRD
Sbjct: 247 GNLPDPN-----GGPGLYCAVIVKTVDAQTRSKTSINDLLRD 283


>gi|260582160|ref|ZP_05849954.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus influenzae NT127]
 gi|260094792|gb|EEW78686.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus influenzae NT127]
          Length = 297

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 156/279 (55%), Positives = 201/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II++ FE+ +    +++  + + A++  ++ LD G  R+A + D G W THQW+
Sbjct: 23  MSNLQAIIEAAFEKRAEITPKTVDAETRAAIEEVIEGLDSGKYRVAEKID-GEWVTHQWL 81

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI
Sbjct: 82  KKAVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFTEEGFRVVPSATVRKGAYI 139

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 140 SKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 199

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 200 IGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGS 259

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LYCAVI+KKVD KT  K SIN LLR
Sbjct: 260 LPS-----KCGKYSLYCAVIVKKVDAKTLGKVSINELLR 293


>gi|315634121|ref|ZP_07889410.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Aggregatibacter segnis ATCC 33393]
 gi|315477371|gb|EFU68114.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Aggregatibacter segnis ATCC 33393]
          Length = 275

 Score =  310 bits (793), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 202/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +S L++II++ FE+   + E  P+ V    + A++  ++ LD G  R+A + D G W TH
Sbjct: 1   MSNLQQIIENAFEK---RAEITPKTVDAQTRAAIEEVIEGLDCGKYRVAEKID-GEWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINENQII-DG-AETKYYDKVALKFADYTEERFQQEGFRVVPSATVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           AYI    VLMPS+VN+GAY+GEGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AYIAKNTVLMPSYVNIGAYVGEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTII DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            GS PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 235 SGSLPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|145712|gb|AAA23667.1| tetrahydrodipicolinate N-succinyltransferase (dapD) [Escherichia
           coli]
          Length = 274

 Score =  309 bits (792), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 155/282 (54%), Positives = 199/282 (70%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++A    + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREADNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGV IGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVRIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PT+IEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTMIEDNCFIGARSELVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|15602523|ref|NP_245595.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Pasteurella multocida subsp. multocida str. Pm70]
 gi|71153299|sp|Q9CMZ2|DAPD_PASMU RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|12720935|gb|AAK02742.1| DapD [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 274

 Score =  309 bits (792), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 155/280 (55%), Positives = 200/280 (71%), Gaps = 15/280 (5%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +L+ II++ FE+   + E  P+ V    + A++  ++ LD G  R+A + D G W THQW
Sbjct: 2   SLQHIIEAAFEK---RAEITPKTVDAQTRAAIEEAIEGLDSGKYRVAEKID-GEWVTHQW 57

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF+IN  ++++     + ++DK+P KF ++    F++  FR++P   VR  AY
Sbjct: 58  LKKAVLLSFRINDNELVAGSE--TNYYDKVPMKFAEYDAARFQQEGFRVVPPAAVRKGAY 115

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I    VLMPS+VN+GA + EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PT
Sbjct: 116 IAKNTVLMPSYVNIGARVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPT 175

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGE+TYG VP+ SVVV G
Sbjct: 176 IIEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIYDRETGEVTYGRVPAGSVVVSG 235

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 236 SLPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 270


>gi|229462845|sp|Q9ABE7|DAPD_CAUCR RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
          Length = 276

 Score =  309 bits (792), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 164/282 (58%), Positives = 200/282 (70%), Gaps = 9/282 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           ++ L+  I++ +E     + +    V+ AV   L LLD G  R+A + D G W THQW+K
Sbjct: 1   MADLQTEIEAAWEARADISAATTGPVRTAVDEALRLLDSGEARVAEKID-GEWFTHQWLK 59

Query: 65  KAILLSFQINPTKIISDG---NGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           KA+LLSF++NP  ++  G    G   WWDK+P KFD W    FE   FR +PG IVR  A
Sbjct: 60  KAVLLSFRLNPNTVMRSGALGGGVGPWWDKVPNKFDGWDAPQFEAGGFRAVPGAIVRRGA 119

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           +IG   +LMPSFVN+G Y+ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P
Sbjct: 120 HIGKNVILMPSFVNIGGYVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANP 179

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIEDNCFIGARSE+VEG ++ EGSVL MGVFI  STKI+DR TG +  G+VP YSVVVP
Sbjct: 180 TIIEDNCFIGARSEVVEGVVVGEGSVLSMGVFISASTKIVDRKTGAVHIGKVPPYSVVVP 239

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           G+ P  N      GP LYCAVI+K VD +TRSKTSIN LLRD
Sbjct: 240 GNLPDPN-----GGPGLYCAVIVKTVDAQTRSKTSINDLLRD 276


>gi|161702949|ref|YP_302680.2| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ehrlichia canis str. Jake]
          Length = 279

 Score =  309 bits (792), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 161/290 (55%), Positives = 201/290 (69%), Gaps = 16/290 (5%)

Query: 1   MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           MI +    E I D++   SN  N S    +K  V   +DLLD+G IR+  +  +  W  +
Sbjct: 1   MIDVCDFKEVIEDAW---SNLANLSSNTSIKKVVDDVMDLLDQGRIRVCEKVGD-QWVVN 56

Query: 61  QWIKKAILLSFQINPTKI--ISDGN---GYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGT 115
           +W KKAILL F++    +  I+  N   G   W+DK+  KF  W   DF +   R +PG+
Sbjct: 57  EWAKKAILLCFRVYDMNLAEINTSNSMLGNLCWFDKVQLKFGKWSADDFRRAKIRAVPGS 116

Query: 116 IVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLE 175
           +VR SAYI P  VLMPSFVN+GAY+GEG+MIDTW++VGSCAQIGK+ HISGG GIGGVLE
Sbjct: 117 MVRKSAYIAPNVVLMPSFVNVGAYVGEGTMIDTWASVGSCAQIGKHCHISGGAGIGGVLE 176

Query: 176 PIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPS 235
           P+ + P +IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG ST+I+DR +GEI+YG +P 
Sbjct: 177 PLSSRPVVIEDNCFIGARSEIVEGVIVGEGSVISMGVYIGASTRIVDRESGEISYGRIPP 236

Query: 236 YSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS 285
           YSVVVPGSY S NL        LYCAVI+KKVD+ TRSK SIN LLRD S
Sbjct: 237 YSVVVPGSYGSGNL-------SLYCAVIVKKVDDNTRSKVSINELLRDDS 279


>gi|50085672|ref|YP_047182.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acinetobacter sp. ADP1]
 gi|71153267|sp|Q6F9A5|DAPD_ACIAD RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|49531648|emb|CAG69360.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acinetobacter sp. ADP1]
          Length = 273

 Score =  309 bits (791), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 153/279 (54%), Positives = 198/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L  II+  FE  +N      P D++ AV+  L  LD G +R+A + D G W  HQW+
Sbjct: 1   MSQLSTIIEQAFENRANFTAADCPADIRQAVEEALSGLDNGTLRVAEKID-GEWIVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  K I  G+    ++DK+  KF  W  + F++   R++P  + R  +Y 
Sbjct: 60  KKAVLLSFKLNDNKPIESGD--LAFYDKVDTKFAGWTEEQFKEAGVRVVPPAVARRGSYQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ E +M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYVNIGAYVDENTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EG+V+ MGV+IG+ST+I DR TGEI YG VP+ SVVVPGS
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGAVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVPGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 238 LPSKDGK-----YSLYAAIIVKKVDAQTRAKTSLNDLLR 271


>gi|322831585|ref|YP_004211612.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rahnella sp. Y9602]
 gi|321166786|gb|ADW72485.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rahnella sp. Y9602]
          Length = 274

 Score =  309 bits (791), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 154/282 (54%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+  FE    + +  P +V    +DA+   +  +D G +R+A + D G W TH
Sbjct: 1   MQQLQTVIEQAFER---RADITPANVDSVTRDAITEVISKIDSGELRVAEKID-GEWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++  G   S ++DK+P KF D+    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVMEGGE--SRYFDKVPMKFADYDEARFQREGFRVVPPAAVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KT  KT +N LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTLGKTGLNELLR 271


>gi|226939608|ref|YP_002794681.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Laribacter hongkongensis HLHK9]
 gi|254767077|sp|C1DD37|DAPD_LARHH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226714534|gb|ACO73672.1| DapD [Laribacter hongkongensis HLHK9]
          Length = 273

 Score =  309 bits (791), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 150/272 (55%), Positives = 194/272 (71%), Gaps = 8/272 (2%)

Query: 11  IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I D+F   ++    ++  + K A+ + +  +D G +R+A +   G W THQW+KKA+LLS
Sbjct: 8   IEDAFERRADITPATVTPETKAAIDAVIADIDAGRLRVAEKI-AGEWVTHQWLKKAVLLS 66

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F+I    ++ DG   S ++DK+  KF DW    F+   FR +PG +VR  +YI    VLM
Sbjct: 67  FRIRDNAVLDDG--VSRYFDKVDTKFADWDAARFQAAGFRAVPGAVVRKGSYIAKNTVLM 124

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSFVN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIEDNCFI
Sbjct: 125 PSFVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDNCFI 184

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSEIVEG I+ EGSV+ MGV+IG+ST+I DR TGE++YG VP+ SVVV G+ PS +  
Sbjct: 185 GARSEIVEGVIVEEGSVISMGVYIGQSTRIFDRETGEVSYGRVPAGSVVVSGNLPSKD-- 242

Query: 251 GDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
                  LYCAVI+KKVD KTR K  IN LLR
Sbjct: 243 ---GSYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|327392793|dbj|BAK10215.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           DapD [Pantoea ananatis AJ13355]
          Length = 274

 Score =  309 bits (791), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 152/279 (54%), Positives = 201/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ +I+S FE  ++    S+  + ++A+   +  LD G +R++ + D G W THQW+
Sbjct: 1   MQQLQSVIESAFERRADITPTSVDTETREAINQVIAKLDSGELRVSEKID-GEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +++      + ++DK+P KF DW    F++  FR++P   VR  A+I
Sbjct: 60  KKAVLLSFRINDNQVMEGAE--TRFYDKVPMKFADWDDARFKEAGFRVVPPAAVRKGAFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KT +KT IN LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDAKTLAKTGINELLR 271


>gi|291616342|ref|YP_003519084.1| DapD [Pantoea ananatis LMG 20103]
 gi|291151372|gb|ADD75956.1| DapD [Pantoea ananatis LMG 20103]
          Length = 274

 Score =  309 bits (791), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 152/279 (54%), Positives = 202/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ +I+S FE  ++    S+  + ++A+   +  LD G +R++ + D G W THQW+
Sbjct: 1   MQQLQSVIESAFERRADITPTSVDTETREAINQVIAKLDSGELRVSEKID-GEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +++      + ++DK+P KF DW    F++  FR++P   VR  A+I
Sbjct: 60  KKAVLLSFRINDNQVMEGAE--TRFYDKVPMKFADWDDARFKEAGFRVVPPAAVRKGAFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + +       LYCAVI+KKVD KT +KT IN LLR
Sbjct: 238 LPSKDGR-----YSLYCAVIVKKVDAKTLAKTGINELLR 271


>gi|297538019|ref|YP_003673788.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylotenera sp. 301]
 gi|297257366|gb|ADI29211.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylotenera sp. 301]
          Length = 275

 Score =  309 bits (791), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 154/276 (55%), Positives = 204/276 (73%), Gaps = 9/276 (3%)

Query: 9   EEIIDSFFEESNSKNES-IPQDVKDAVQSTLDLLDRGIIRIASR-DDNGHWNTHQWIKKA 66
           + II++ FE+  + N S    ++K  V S +  LD G +R+ASR  D+ +W THQW+KKA
Sbjct: 5   QSIIEAAFEDRANINPSNASAEIKATVASLIADLDAGKLRVASRIGDSQNWETHQWLKKA 64

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++    ++ DG G + ++DK+P KF ++  +DF+   FR++P  +VR  ++IG  
Sbjct: 65  VLLSFRLEDNTLL-DG-GCTKYYDKVPPKFANYTEEDFKAGGFRVVPNAMVRRGSFIGKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           AVL+PS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEPIQ GPTII D
Sbjct: 123 AVLLPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPIQAGPTIIGD 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ +  V+ MGV+IG+STKI DR TG +TYG +PS SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEDNCVISMGVYIGQSTKIYDRETGTVTYGRIPSGSVVVSGNLPS 242

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            +         LYCAVI+KKVDEKT  K  IN LLR
Sbjct: 243 KD-----GSYSLYCAVIVKKVDEKTLGKVGINELLR 273


>gi|148360466|ref|YP_001251673.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase
           DapD [Legionella pneumophila str. Corby]
 gi|166224214|sp|A5IG27|DAPD_LEGPC RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|148282239|gb|ABQ56327.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase
           DapD [Legionella pneumophila str. Corby]
          Length = 276

 Score =  308 bits (790), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 154/280 (55%), Positives = 201/280 (71%), Gaps = 11/280 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +++L+ +I+  FE   N   ++   D+ +A+   L  LD G  R+A +  NG W  HQW+
Sbjct: 1   MNSLQALIEQAFENRQNLSLDTASSDLINAINEVLSGLDNGQFRVAEKI-NGEWTVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++ P +II  G  +  ++DKIP K+ D   + F +   R++P  +VR  AYI
Sbjct: 60  KKAVLLSFKLFPNQIIDAG--FCQFYDKIPLKYTDCSNEQFSQSGVRVVPHGMVRRGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAYI EG M+DTW+TVGSCAQIGKNVHISGG GIGGVLEP+Q  PTI
Sbjct: 118 AKNTVLMPSYVNIGAYIDEGVMVDTWATVGSCAQIGKNVHISGGAGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ + SV+ MGVF+G+STKI +R TGE++YG +P+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEKNSVISMGVFLGQSTKIYNRITGEVSYGRIPAGSVVVAGN 237

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +      G H LYCAVI+K+VDEKTR+K SIN LLR
Sbjct: 238 LPSHD------GSHSLYCAVIVKQVDEKTRAKVSINDLLR 271


>gi|307822151|ref|ZP_07652383.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacter tundripaludum SV96]
 gi|307736717|gb|EFO07562.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylobacter tundripaludum SV96]
          Length = 272

 Score =  308 bits (789), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 163/280 (58%), Positives = 210/280 (75%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S LE+II+  FE  ++     +  +V+ AV+  ++LLD G  R+A +  +G W  +QW+
Sbjct: 1   MSQLEQIINDAFENRADISPAGVSAEVRAAVEDAINLLDSGKARVAEKT-SGEWVVNQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  ++I  GN  S ++DK+ AKF  +   DF K   R++P  IVRH AYI
Sbjct: 60  KKAVLLSFRINENRVIEGGN--SRYYDKVEAKFSTYSPDDFAKSGVRVVPNAIVRHGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P AVLMPSFVN+G Y+  G+M+DTW++VGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTI
Sbjct: 118 APGAVLMPSFVNIGGYVDSGTMVDTWASVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG ++ EGSV+ MGV+IG+STKI +R TGE++YG VP+ SVVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTKIFNRMTGEVSYGRVPAGSVVVPGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS +         LYCA+IIK+VDEKTRSKT IN LLRD
Sbjct: 238 LPSAD-----GTYSLYCAIIIKQVDEKTRSKTGINELLRD 272


>gi|261867925|ref|YP_003255847.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Aggregatibacter actinomycetemcomitans D11S-1]
 gi|261413257|gb|ACX82628.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 275

 Score =  308 bits (788), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 153/279 (54%), Positives = 203/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+++I++ FE+      ++I    + AV+  ++ LD G  R+A + D G W THQW+
Sbjct: 1   MSNLQQLIENAFEKRTEITPKTIDVQTRAAVEEVIEGLDSGKYRVAEKID-GEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +++ DG   + ++DK+P KF D+  + F++  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINDNQLV-DG-AETKYYDKVPLKFADYTEERFQQEGFRVVPSATVRKGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GA++GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNCVLMPSYVNIGAHVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGE+ YG VP+ SVVV GS
Sbjct: 178 IGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEVYYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + +       LYCAVI+KKVD KT  K  IN LLR
Sbjct: 238 LPSKDGR-----YSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|145633035|ref|ZP_01788767.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae 3655]
 gi|145639247|ref|ZP_01794853.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae PittII]
 gi|319776528|ref|YP_004139016.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae F3047]
 gi|144986261|gb|EDJ92840.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae 3655]
 gi|145271550|gb|EDK11461.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae PittII]
 gi|309751127|gb|ADO81111.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae R2866]
 gi|317451119|emb|CBY87352.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae F3047]
          Length = 275

 Score =  308 bits (788), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 155/279 (55%), Positives = 201/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II++ FE+ +    +++  + + A++  ++ LD G  R+A + D G W THQW+
Sbjct: 1   MSNLQAIIEAAFEKRAEITPKTVDAETRAAIEEVIEGLDSGKYRVAEKID-GEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F + +FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFAEESFRVVPSATVRKGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 SKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 178 IGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 238 LPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|319760406|ref|YP_004124344.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Blochmannia vafer str. BVAF]
 gi|318039120|gb|ADV33670.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Blochmannia vafer str. BVAF]
          Length = 278

 Score =  308 bits (788), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 154/280 (55%), Positives = 206/280 (73%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIID-SFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L++II+ +F ++ +    +I   + +A+Q  +  LD GI RI+ + +N  W THQW+
Sbjct: 6   ISNLKKIIENAFLKKEDILQHNIDSILNNAIQEIIHNLDNGIFRISEKLNN-KWITHQWL 64

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKAI+L F+I   K+++ GN +  ++DK P KF+ W   DF+K+  RI+P   VR+ AYI
Sbjct: 65  KKAIILFFKITGNKLMTWGNAH--FFDKCPTKFETWNETDFQKNKIRIVPPATVRYGAYI 122

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               ++MPS++N+GAYI  G+MIDTW+T+GSCAQIGK  HISGG GIGGVLEPIQ  PTI
Sbjct: 123 SHNTIIMPSYINIGAYIDTGTMIDTWATIGSCAQIGKYTHISGGAGIGGVLEPIQNNPTI 182

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DRNT +I YG VP+ SVV+PGS
Sbjct: 183 IEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIYDRNTEQIYYGRVPAGSVVIPGS 242

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS++ K      + YCA+IIK+VD KT++KT IN LLR+
Sbjct: 243 IPSLDNK-----INTYCAIIIKQVDSKTKNKTQINDLLRE 277


>gi|293390207|ref|ZP_06634541.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290950741|gb|EFE00860.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 275

 Score =  307 bits (787), Expect = 9e-82,   Method: Compositional matrix adjust.
 Identities = 152/279 (54%), Positives = 202/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+++I++ FE+      +++    + AV+  ++ LD G  R+A + D G W THQW+
Sbjct: 1   MSNLQQLIENAFEKRTEITPKTVETQTRAAVEEAIEGLDSGKYRVAEKID-GEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +++ DG   + ++DK+P KF D+  + F++  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINDNQLV-DG-AETKYYDKVPLKFADYTEERFQQEGFRVVPSATVRKGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GA++GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNCVLMPSYVNIGAHVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGE+ YG VP+ SVVV GS
Sbjct: 178 IGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEVYYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LYC VI+KKVD KT  K  IN LLR
Sbjct: 238 LPSKDGK-----YSLYCTVIVKKVDAKTLGKVGINELLR 271


>gi|301156170|emb|CBW15641.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus parainfluenzae T3T1]
          Length = 275

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 157/282 (55%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +S L++II++ FE+   + E  P+ V    + A++  ++ LD G  R+A + D G W TH
Sbjct: 1   MSNLQQIIEAAFEK---RAEITPKTVDAQTRAAIEEVIEGLDSGKYRVAEKID-GEWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFAQEGFRVVPSATVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           AYI    VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AYISKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTII DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEVFYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            GS PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 235 SGSLPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|325578267|ref|ZP_08148402.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus parainfluenzae ATCC 33392]
 gi|325160003|gb|EGC72132.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus parainfluenzae ATCC 33392]
          Length = 275

 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +S L+++I++ FE+   + E  P+ V    + A++  ++ LD G  R+A + D G W TH
Sbjct: 1   MSNLQQVIEAAFEK---RAEITPKTVDAQTRAAIEEVIEGLDSGKYRVAEKID-GEWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFAQEGFRVVPSATVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           AYI    VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AYISKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTII DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEVFYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            GS PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 235 SGSLPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|326562539|gb|EGE12854.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Moraxella catarrhalis 46P47B1]
          Length = 273

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 151/279 (54%), Positives = 204/279 (73%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +STL  II++ F++ +N   +++  +++ AV   ++ LD G +R+A + D G W  HQW+
Sbjct: 1   MSTLATIIETAFDDRANFTTQTVSPEIRAAVDEVIEALDNGSLRVAQKID-GEWVVHQWV 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  K ++ G     ++DK+  KF+ W  +DF+    R++P  + R  ++I
Sbjct: 60  KKAVLLSFKINDNKPMNAGE--LGFYDKVDTKFNGWTEEDFKNAGVRVVPPAVARKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               +LMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKDVILMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIFYGRVPAGSVVVPGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS   K       LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 238 LPSPCGK-----YSLYAAIIVKKVDAQTRAKTSLNDLLR 271


>gi|152979053|ref|YP_001344682.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Actinobacillus succinogenes 130Z]
 gi|171704335|sp|A6VP50|DAPD_ACTSZ RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|150840776|gb|ABR74747.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus succinogenes 130Z]
          Length = 275

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 155/279 (55%), Positives = 200/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ +I+  FE  ++   +++    + A++  ++ LD G  R+A + D G W THQW+
Sbjct: 1   MSNLQAVIEEAFERRADITPKTVDAATRAAIEEVIEGLDSGKFRVAEKID-GEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINENEII-DG-AETKYYDKVALKFADYSEERFAQEGFRVVPSATVRKGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 SKNTVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 178 IGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LYCAVI+KKVD KT  K  IN LLR
Sbjct: 238 LPSKDGK-----YSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|301170392|emb|CBW29998.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae 10810]
          Length = 275

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 155/279 (55%), Positives = 200/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II++ FE+ +    +++  + + A++  ++ LD G  R+A + D G W THQW+
Sbjct: 1   MSNLQAIIEAAFEKRAEITPKTVDAETRAAIEEVIEGLDSGKYRVAEKID-GEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFTEEGFRVVPSATVRKGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 SKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 178 IGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 238 LPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|88657848|ref|YP_506889.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ehrlichia chaffeensis str. Arkansas]
 gi|88599305|gb|ABD44774.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ehrlichia chaffeensis str. Arkansas]
          Length = 279

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 157/272 (57%), Positives = 197/272 (72%), Gaps = 13/272 (4%)

Query: 19  SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQI---NP 75
           +N  N S    +K  V   +DLLD+G IRI  +  +  W  ++W KKAILL F++   N 
Sbjct: 16  NNLANLSSNTSIKKVVDDVMDLLDQGKIRICEKVGD-QWVVNEWAKKAILLCFRVYDMNL 74

Query: 76  TKIISDGN--GYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSF 133
            +I S  +  G   W+DK+  KF  W   DF     R +PG++VR SAYI P  VLMPSF
Sbjct: 75  AEISSADSMLGNLCWFDKVQLKFGRWSADDFRAAKVRAVPGSMVRKSAYIAPNVVLMPSF 134

Query: 134 VNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGAR 193
           VN+GAY+GEG+MIDTW++VGSCAQIGK+ HISGG GIGGVLEP+ + P +IEDNCFIGAR
Sbjct: 135 VNVGAYVGEGTMIDTWASVGSCAQIGKHCHISGGAGIGGVLEPLSSRPVVIEDNCFIGAR 194

Query: 194 SEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDI 253
           SEIVEG ++ EGSV+ MGV+IG ST+I+DR +GEI+YG++P YSVVVPGSY S    GD+
Sbjct: 195 SEIVEGVVVGEGSVIAMGVYIGASTRIVDRASGEISYGKIPPYSVVVPGSYGS----GDL 250

Query: 254 AGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS 285
           +   LYCAVI+KKVD+KTRSK SIN LLRD S
Sbjct: 251 S---LYCAVIVKKVDDKTRSKVSINELLRDDS 279


>gi|68171555|ref|ZP_00544932.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999021|gb|EAM85695.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ehrlichia chaffeensis str. Sapulpa]
          Length = 289

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 157/272 (57%), Positives = 197/272 (72%), Gaps = 13/272 (4%)

Query: 19  SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQI---NP 75
           +N  N S    +K  V   +DLLD+G IRI  +  +  W  ++W KKAILL F++   N 
Sbjct: 26  NNLANLSSNTSIKKVVDDVMDLLDQGKIRICEKVGD-QWVVNEWAKKAILLCFRVYDMNL 84

Query: 76  TKIISDGN--GYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSF 133
            +I S  +  G   W+DK+  KF  W   DF     R +PG++VR SAYI P  VLMPSF
Sbjct: 85  AEISSADSMLGNLCWFDKVQLKFGRWSADDFRAAKVRAVPGSMVRKSAYIAPNVVLMPSF 144

Query: 134 VNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGAR 193
           VN+GAY+GEG+MIDTW++VGSCAQIGK+ HISGG GIGGVLEP+ + P +IEDNCFIGAR
Sbjct: 145 VNVGAYVGEGTMIDTWASVGSCAQIGKHCHISGGAGIGGVLEPLSSRPVVIEDNCFIGAR 204

Query: 194 SEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDI 253
           SEIVEG ++ EGSV+ MGV+IG ST+I+DR +GEI+YG++P YSVVVPGSY S    GD+
Sbjct: 205 SEIVEGVVVGEGSVIAMGVYIGASTRIVDRASGEISYGKIPPYSVVVPGSYGS----GDL 260

Query: 254 AGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS 285
           +   LYCAVI+KKVD+KTRSK SIN LLRD S
Sbjct: 261 S---LYCAVIVKKVDDKTRSKVSINELLRDDS 289


>gi|326564091|gb|EGE14331.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Moraxella catarrhalis 12P80B1]
          Length = 273

 Score =  306 bits (785), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 151/279 (54%), Positives = 204/279 (73%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +STL  II++ F++ +N   +++  +++ AV   ++ LD G +R+A + D G W  HQW+
Sbjct: 1   MSTLATIIETAFDDRANFTAQTVSPEIRAAVDEVIEALDNGSLRVAQKID-GEWVVHQWV 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  K ++ G     ++DK+  KF+ W  +DF+    R++P  + R  ++I
Sbjct: 60  KKAVLLSFKINDNKPMNAGE--LGFYDKVDTKFNGWTEEDFKNAGVRVVPPAVARKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               +LMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKDVILMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIFYGRVPAGSVVVPGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS   K       LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 238 LPSPCGK-----YSLYAAIIVKKVDAQTRAKTSLNDLLR 271


>gi|254497105|ref|ZP_05109926.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Legionella drancourtii LLAP12]
 gi|254353685|gb|EET12399.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Legionella drancourtii LLAP12]
          Length = 273

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 198/277 (71%), Gaps = 9/277 (3%)

Query: 7   TLEEIIDSFFEESNSKNESIPQ-DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           TL+ II+  FE+  + + S    ++  AV   L  LD G  R+A +  N  W  HQWIKK
Sbjct: 3   TLQTIIEQAFEQRQTLSMSTATPELLAAVNEVLSCLDSGQYRVAEKI-NDDWVVHQWIKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++ P +I+  G  +  ++DK+P K+  +  + F++   R++P  +VR  A++  
Sbjct: 62  AVLLSFKLFPNQIVDAG--FCQFYDKVPLKYQGYTEEQFQQTGVRVVPHAMVRQGAFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            +VLMPS+VN+GAYI EG M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NSVLMPSYVNIGAYIDEGVMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+   SVL MGV++G+STKI +R TGEI+YG +P+ SVVV GS P
Sbjct: 180 DNCFIGARSEVVEGVIVERNSVLSMGVYLGQSTKIYNRMTGEISYGRIPAGSVVVAGSLP 239

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S     +     LYCAVI+K+VDEKTR+K SIN LLR
Sbjct: 240 S-----EDKSHSLYCAVIVKQVDEKTRAKVSINELLR 271


>gi|262368581|ref|ZP_06061910.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acinetobacter johnsonii SH046]
 gi|262316259|gb|EEY97297.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acinetobacter johnsonii SH046]
          Length = 273

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 154/280 (55%), Positives = 196/280 (70%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L  II+  FE+ +N      P +V+ AV+  +  LD G +R+A + D G W  HQW+
Sbjct: 1   MSQLSTIIEQAFEDRANFTAADCPAEVRAAVEEVIAGLDNGTLRVAEKID-GEWVVHQWV 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  K I   +    ++DK+  KF  W  + F+    R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNKPIESCD--LQFYDKVDTKFTGWTEEQFKAAGVRVVPPAVARKGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRATGEIHYGRVPAGSVVVAGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS           LY A+I+KKVD +TRSKTS+N LLRD
Sbjct: 238 LPS-----KCGTYSLYAAIIVKKVDAQTRSKTSLNDLLRD 272


>gi|326561314|gb|EGE11672.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Moraxella catarrhalis 7169]
 gi|326562565|gb|EGE12878.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Moraxella catarrhalis 103P14B1]
 gi|326566184|gb|EGE16338.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Moraxella catarrhalis BC1]
 gi|326569102|gb|EGE19165.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Moraxella catarrhalis BC8]
 gi|326571684|gb|EGE21699.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Moraxella catarrhalis BC7]
 gi|326573527|gb|EGE23490.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Moraxella catarrhalis 101P30B1]
 gi|326577776|gb|EGE27649.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Moraxella catarrhalis O35E]
          Length = 273

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 204/279 (73%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +STL  II++ F++ +N   +++  +++ AV   ++ LD G +R+A + D G W  HQW+
Sbjct: 1   MSTLATIIETAFDDRANFTAQTVSPEIRAAVDEVIEALDNGSLRVAQKID-GEWVVHQWV 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  K ++ G     ++DK+  KF+ W  +DF+    R++P  + R  ++I
Sbjct: 60  KKAVLLSFKINDNKPMNAGE--LGFYDKVDTKFNGWTEEDFKNAGVRVVPPAVARKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               +LMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKDVILMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIFYGRVPAGSVVVPGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS   K       LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 238 LPSPCGK-----YSLYAAIIVKKVDAQTRAKTSLNDLLR 271


>gi|85374755|ref|YP_458817.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Erythrobacter litoralis HTCC2594]
 gi|84787838|gb|ABC64020.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erythrobacter litoralis HTCC2594]
          Length = 273

 Score =  305 bits (782), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 151/282 (53%), Positives = 201/282 (71%), Gaps = 11/282 (3%)

Query: 4   IVSTLEEIIDSFFEESNSKNESIP--QDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           + S L+  I+  +E   ++ E  P  ++V +AV+  + ++D G  R+A  D  G W  +Q
Sbjct: 1   MTSDLQATIEKAWE---NRTEVTPGSREVAEAVEQAIAMIDDGSARVAQPDGAGGWQVNQ 57

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           W+KKA+LLSF++    I+ +G   +  +DK+P+KF+ W    F +  FR++PG I R  +
Sbjct: 58  WLKKAVLLSFRLRENAIM-EGAVAAPAFDKVPSKFEGWDEARFREAGFRVVPGAIARRGS 116

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YIG  AVLMPSFVN+GAY+GEG+MIDTW++VGSCAQ+G N HIS G GIGGVLEP+Q  P
Sbjct: 117 YIGKGAVLMPSFVNIGAYVGEGTMIDTWASVGSCAQVGTNCHISAGAGIGGVLEPLQANP 176

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TII DNCFIGARSEIVEG I+ EGSV+ MGVFI +STKI+ R++GE+  G++P YSVVVP
Sbjct: 177 TIIGDNCFIGARSEIVEGVIVGEGSVVAMGVFITQSTKIVYRDSGEVIRGQIPPYSVVVP 236

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           G+ P  + KG   GP L CAVI+K VD +TR KT IN LLRD
Sbjct: 237 GTLP--DPKG---GPSLACAVIVKTVDAQTREKTGINDLLRD 273


>gi|85712035|ref|ZP_01043089.1| Tetrahydrodipicolinate N-succinyltransferase [Idiomarina baltica
           OS145]
 gi|85694221|gb|EAQ32165.1| Tetrahydrodipicolinate N-succinyltransferase [Idiomarina baltica
           OS145]
          Length = 282

 Score =  305 bits (782), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 202/276 (73%), Gaps = 11/276 (3%)

Query: 9   EEIIDSFFEESNSKNESIPQD-VKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           +++I+  FE+ +  +     D +++ V+  +D +DRG +R+A +  +G W  HQW+KKA+
Sbjct: 13  KKLINEAFEQRDQISPRTDDDELREVVRYIIDEIDRGELRVAEKV-SGEWIVHQWLKKAV 71

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++N   +I  G   + +WDK+PAKF D+ +  F     R++P  +VR  A+IG   
Sbjct: 72  LLSFRLNDNDLIEGGE--TRFWDKVPAKFADYDSARFRAEGMRVVPPAMVRKGAFIGRNV 129

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           V+MPS+VN+GAY+G+GSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIEDN
Sbjct: 130 VVMPSYVNIGAYVGDGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDN 189

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGARSEIVEG I+ EG+V+ MGV+IG+ST+I DR   +I YG VP+ +VVVPG+ PS 
Sbjct: 190 CFIGARSEIVEGVIVEEGAVISMGVYIGQSTRIYDRENDKIIYGRVPAGAVVVPGALPSA 249

Query: 248 NLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           +      G H LY A+I+K+VD KTR+K  IN LLR
Sbjct: 250 D------GTHSLYAAIIVKRVDAKTRAKVGINALLR 279


>gi|296112547|ref|YP_003626485.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Moraxella catarrhalis RH4]
 gi|295920241|gb|ADG60592.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Moraxella catarrhalis RH4]
 gi|326576330|gb|EGE26240.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Moraxella catarrhalis CO72]
          Length = 273

 Score =  305 bits (782), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 204/279 (73%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +STL  II++ F++ +N   +++  +++ AV   ++ LD G +R+A + D G W  HQW+
Sbjct: 1   MSTLATIIETAFDDRANFTAQTVSPEIRAAVDEVIEALDNGSLRVAQKID-GEWVVHQWV 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  K ++ G     ++DK+  KF+ W  +DF+    R++P  + R  ++I
Sbjct: 60  KKAVLLSFKINDNKPMNAGE--LGFYDKVDTKFNGWTEEDFKNAGVRVVPPAVARKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               +LMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKDVILMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIFYGRVPAGSVVVPGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS   K       LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 238 LPSPCGK-----YGLYAAIIVKKVDAQTRAKTSLNDLLR 271


>gi|332532249|ref|ZP_08408130.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038347|gb|EGI74792.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 275

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 149/280 (53%), Positives = 206/280 (73%), Gaps = 11/280 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNES-IPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ +I++ ++  +S + S +  DVK A+   LDLLD G  R+A +  +G W  HQW+
Sbjct: 1   MSDLKTMIENAWDNRDSISPSTVSSDVKQAIIDALDLLDSGAARVAEKI-SGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I   + ++DG   + ++DK+P KF D+  + F++   R++P  + R  +++
Sbjct: 60  KKAVLLSFRIRDNQPMNDG--VNQFYDKVPLKFSDYTPEQFQQGGMRVVPNAVARKGSFV 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G   VLMPS+VN+GAY+ +G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 GKNVVLMPSYVNIGAYVDDGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EG+V+ MGV+I +ST+I DR TGEI YG VP+ +VVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGAVISMGVYISQSTRIYDRETGEIHYGRVPAGAVVVPGA 237

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +      G H LY A+I+KKVD++TR K  IN LLR
Sbjct: 238 LPSKD------GTHSLYAAIIVKKVDKQTREKVGINALLR 271


>gi|229844814|ref|ZP_04464952.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae 6P18H1]
 gi|229812195|gb|EEP47886.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae 6P18H1]
          Length = 275

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 199/282 (70%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +S L+ II++ FE+   + E  P+ V      A++  ++ LD G  R+A + D G W TH
Sbjct: 1   MSNLQTIIEAAFEK---RAEITPKTVDAATSAAIEEVIEGLDSGKYRVAEKID-GEWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFAEEGFRVVPSATVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           AYI    VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AYISKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTII DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            GS PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 235 SGSLPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|165977305|ref|YP_001652898.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|303249709|ref|ZP_07335914.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307253551|ref|ZP_07535419.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|165877406|gb|ABY70454.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|302651521|gb|EFL81672.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306858931|gb|EFM90976.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
          Length = 274

 Score =  305 bits (781), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 153/277 (55%), Positives = 198/277 (71%), Gaps = 9/277 (3%)

Query: 7   TLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  +    +++  + + A++  ++ LD G  R+A + D G W THQW+KK
Sbjct: 2   SLQAIIEAAFERRAEITPKTVDAETRAAIEQVIEGLDSGKYRVAEKID-GEWVTHQWLKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI  
Sbjct: 61  AVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFAQEGFRVVPSATVRKGAYISK 118

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTII 
Sbjct: 119 NCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIG 178

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+ +G V+ MGVFIG+ST+I DR TGEI YG VP+ SVVV GS P
Sbjct: 179 DNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVVSGSLP 238

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 239 S-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 270


>gi|260580409|ref|ZP_05848238.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus influenzae RdAW]
 gi|329124038|ref|ZP_08252585.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus aegyptius ATCC 11116]
 gi|1574480|gb|AAC23279.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           (dapD) [Haemophilus influenzae Rd KW20]
 gi|260093086|gb|EEW77020.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus influenzae RdAW]
 gi|327467463|gb|EGF12961.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus aegyptius ATCC 11116]
          Length = 303

 Score =  305 bits (781), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 199/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II++ FE+ +    +++  + + A++  ++ LD G  R+A +   G W THQW+
Sbjct: 29  MSNLQAIIEAAFEKRAEITPKTVDAETRAAIEEVIEGLDSGKYRVAEKI-AGEWVTHQWL 87

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI
Sbjct: 88  KKAVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFTEEGFRVVPSATVRKGAYI 145

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 146 SKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 205

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 206 IGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGS 265

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 266 LPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 299


>gi|46143754|ref|ZP_00134477.2| COG2171: Tetrahydrodipicolinate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126209323|ref|YP_001054548.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae L20]
 gi|190151220|ref|YP_001969745.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|307246795|ref|ZP_07528861.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307255778|ref|ZP_07537580.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|307257967|ref|ZP_07539720.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|307260230|ref|ZP_07541938.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|307262362|ref|ZP_07544008.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|307264569|ref|ZP_07546152.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 13 str. N273]
 gi|166224192|sp|A3N3F7|DAPD_ACTP2 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|126098115|gb|ABN74943.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 5b str. L20]
 gi|189916351|gb|ACE62603.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 7 str. AP76]
 gi|306852266|gb|EFM84505.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306861241|gb|EFM93233.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 9 str.
           CVJ13261]
 gi|306863514|gb|EFM95444.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|306865677|gb|EFM97557.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306867910|gb|EFM99740.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 12 str. 1096]
 gi|306870098|gb|EFN01859.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 13 str. N273]
          Length = 274

 Score =  305 bits (781), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 153/277 (55%), Positives = 198/277 (71%), Gaps = 9/277 (3%)

Query: 7   TLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  +    +++  + + A++  ++ LD G  R+A + D G W THQW+KK
Sbjct: 2   SLQAIIEAAFERRAEITPKTVDAETRAAIEEVIEGLDSGKYRVAEKID-GEWVTHQWLKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI  
Sbjct: 61  AVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFAQEGFRVVPSATVRKGAYISK 118

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTII 
Sbjct: 119 NCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIG 178

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+ +G V+ MGVFIG+ST+I DR TGEI YG VP+ SVVV GS P
Sbjct: 179 DNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVVSGSLP 238

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 239 S-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 270


>gi|167947794|ref|ZP_02534868.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Endoriftia persephone 'Hot96_1+Hot96_2']
 gi|110589238|gb|ABG77128.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Endoriftia persephone 'Hot96_1+Hot96_2']
          Length = 274

 Score =  305 bits (780), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 196/274 (71%), Gaps = 9/274 (3%)

Query: 11  IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I D+F + +     S    V+DAV   ++ LDRG IR+A R D G W  + W+KKA+LLS
Sbjct: 8   ITDAFEKRAEITPRSADTLVRDAVAEAINQLDRGEIRVAERQD-GDWVVNDWVKKAVLLS 66

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N       G  +     ++P+K+ D  ++DF     R++P   VR  AYI P  VLM
Sbjct: 67  FRLN-DNYFQKGWLHQLLGTRVPSKYADHNSRDFRDSGVRVVPPASVRKGAYIAPSCVLM 125

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PS+VN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIEDNCFI
Sbjct: 126 PSYVNIGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIEDNCFI 185

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSEIVEG I+ +G+V+ MGV+IG+STKI +R TGEI++G VP+ +VVVPGS PS +  
Sbjct: 186 GARSEIVEGVIVEQGAVISMGVYIGQSTKIYNRLTGEISFGRVPTGAVVVPGSLPSKD-- 243

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLRD 283
               G H LYCAVIIK+VDEKTRSK  IN LLRD
Sbjct: 244 ----GSHSLYCAVIIKQVDEKTRSKVGINELLRD 273


>gi|27904712|ref|NP_777838.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Buchnera aphidicola str. Bp (Baizongia pistaciae)]
 gi|38372211|sp|Q89AP4|DAPD_BUCBP RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|27904109|gb|AAO26943.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Buchnera aphidicola str. Bp (Baizongia pistaciae)]
          Length = 274

 Score =  305 bits (780), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 156/280 (55%), Positives = 196/280 (70%), Gaps = 10/280 (3%)

Query: 5   VSTLEEIIDSFFEES-NSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           + TL+ II+  F+   N    ++ Q   DA+   L +L+ G +R+ S   NG W THQW+
Sbjct: 1   MHTLKNIINKTFDNKLNIHQHNVDQKTTDAINQVLHMLNIGKLRV-SEKINGFWITHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKAILLSF +N   + S  N  + ++DKI  K+ ++  + F+    RI+P   VRH A+I
Sbjct: 60  KKAILLSFLVNKNVLFS--NKQTCFYDKIKLKYCNYTEEKFKNEKIRIVPPATVRHGAFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G   +LMP +VN GAYI EG+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 GKNTILMPCYVNTGAYIDEGTMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQNNPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG II   SV+ MGVFIG+STKI DRN  +I YG+VPS SVVVPGS
Sbjct: 178 IEDNCFIGARSEIVEGVIIESNSVISMGVFIGQSTKIYDRNNKKILYGKVPSGSVVVPGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS N        +LYC VI+K+V+ +T SKT IN LLR+
Sbjct: 238 LPSKN------NCNLYCVVIVKQVNAQTLSKTGINKLLRE 271


>gi|30995463|ref|NP_439776.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Haemophilus influenzae Rd KW20]
 gi|145635081|ref|ZP_01790787.1| phosphoenolpyruvate carboxylase [Haemophilus influenzae PittAA]
 gi|145637521|ref|ZP_01793179.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae PittHH]
 gi|148826158|ref|YP_001290911.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Haemophilus influenzae PittEE]
 gi|229846261|ref|ZP_04466373.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae 7P49H1]
 gi|1169222|sp|P45284|DAPD_HAEIN RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|166224210|sp|A5UCM7|DAPD_HAEIE RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|145267689|gb|EDK07687.1| phosphoenolpyruvate carboxylase [Haemophilus influenzae PittAA]
 gi|145269327|gb|EDK09272.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae PittHH]
 gi|148716318|gb|ABQ98528.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae PittEE]
 gi|229811265|gb|EEP46982.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae 7P49H1]
 gi|309973305|gb|ADO96506.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae R2846]
          Length = 275

 Score =  304 bits (779), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 199/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II++ FE+ +    +++  + + A++  ++ LD G  R+A +   G W THQW+
Sbjct: 1   MSNLQAIIEAAFEKRAEITPKTVDAETRAAIEEVIEGLDSGKYRVAEKI-AGEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFTEEGFRVVPSATVRKGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 SKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 178 IGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 238 LPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|34495905|ref|NP_900120.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Chromobacterium violaceum ATCC 12472]
 gi|71153281|sp|Q7P0W5|DAPD_CHRVO RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|34101760|gb|AAQ58128.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Chromobacterium violaceum ATCC 12472]
          Length = 273

 Score =  304 bits (779), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 199/277 (71%), Gaps = 11/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           ++ +I+  FE  +     ++  ++K A++  +  LD G +R+A ++    W  +QW+KKA
Sbjct: 4   IQSLIEQAFENRAEITPATVSPELKAAIEQVITELDNGHLRVAEKN-GAEWVVNQWVKKA 62

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF+I    +  DG   + ++DK+  KF DW    F++  FR++PG + R  ++I   
Sbjct: 63  VLLSFRIRDNAVQDDG--VNRYFDKVDTKFADWSQARFQEAGFRVVPGAVARKGSFIAKN 120

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 121 TVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED 180

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP  SVVV G+ PS
Sbjct: 181 NCFIGARSEIVEGVIVGEGSVISMGVYIGQSTKIYDRETGEVMYGRVPPGSVVVSGNLPS 240

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD +TRSKTSIN LLR
Sbjct: 241 KD------GSHSLYCAVIVKKVDAQTRSKTSINELLR 271


>gi|303252754|ref|ZP_07338915.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307248936|ref|ZP_07530946.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|307251133|ref|ZP_07533055.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|322513752|ref|ZP_08066840.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus ureae ATCC 25976]
 gi|302648404|gb|EFL78599.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|306854547|gb|EFM86740.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 2 str. S1536]
 gi|306856799|gb|EFM88933.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus pleuropneumoniae serovar 4 str. M62]
 gi|322120425|gb|EFX92348.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Actinobacillus ureae ATCC 25976]
          Length = 274

 Score =  304 bits (779), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 153/277 (55%), Positives = 198/277 (71%), Gaps = 9/277 (3%)

Query: 7   TLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  +    +++  + + A++  ++ LD G  R+A + D G W THQW+KK
Sbjct: 2   SLQAIIEAAFERRAEITPKTVDAETRAAIEEVIEGLDSGKYRVAEKID-GEWVTHQWLKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI  
Sbjct: 61  AVLLSFRINDNQII-DG-AETKYYDKVGLKFADYTEERFAQEGFRVVPSATVRKGAYISK 118

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTII 
Sbjct: 119 NCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIG 178

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+ +G V+ MGVFIG+ST+I DR TGEI YG VP+ SVVV GS P
Sbjct: 179 DNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVVSGSLP 238

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 239 S-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 270


>gi|258543908|ref|ZP_05704142.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Cardiobacterium hominis ATCC 15826]
 gi|258520847|gb|EEV89706.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Cardiobacterium hominis ATCC 15826]
          Length = 271

 Score =  304 bits (779), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 151/275 (54%), Positives = 199/275 (72%), Gaps = 10/275 (3%)

Query: 9   EEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAIL 68
           + I D+F   ++    +    +  A+   LD L+RG +R+A    NG W  ++W+KKA+L
Sbjct: 5   QTIEDAFERRADITPANASPALLTAINEALDALERGTMRVAEPTANG-WQVNEWLKKAVL 63

Query: 69  LSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAV 128
           LSF+++    +   +GY+ ++DK+ ++F +     F+    R++P  + R  +YIG  AV
Sbjct: 64  LSFRVHDNVPVE--HGYTRYFDKVESRFANHDLARFQAEGVRVVPPAVARRGSYIGRGAV 121

Query: 129 LMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNC 188
           LMPS+VN+GAY+ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIEDNC
Sbjct: 122 LMPSYVNIGAYVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIEDNC 181

Query: 189 FIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSIN 248
           FIGARSEIVEG I+ +GSV+ MGVFIG+STKI +R TGEITYG VP+ SVVVPG+ P+ +
Sbjct: 182 FIGARSEIVEGVIVEKGSVISMGVFIGQSTKIYNRMTGEITYGRVPAGSVVVPGNLPAAD 241

Query: 249 LKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
                 G H LYCAVIIK+VDEKTRSKT IN LLR
Sbjct: 242 ------GSHSLYCAVIIKQVDEKTRSKTGINELLR 270


>gi|288940162|ref|YP_003442402.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Allochromatium vinosum DSM 180]
 gi|288895534|gb|ADC61370.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Allochromatium vinosum DSM 180]
          Length = 273

 Score =  304 bits (779), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 146/274 (53%), Positives = 199/274 (72%), Gaps = 10/274 (3%)

Query: 11  IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+++F   +     ++   V+DAVQ  ++ LD+G +R+A + D G W  ++W+KKA+LLS
Sbjct: 8   ILEAFERRAEITPRNVETHVRDAVQDVIERLDQGTLRVAEKRD-GDWVVNEWVKKAVLLS 66

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F+I     +    G++ ++DK+P+K+ D  +++F +   R++P    R  +YI    VLM
Sbjct: 67  FRIEDNAFMK--GGFTNYYDKVPSKYADANSREFREGGVRVVPPATARKGSYIASGCVLM 124

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PS+VN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIEDNCFI
Sbjct: 125 PSYVNIGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQAAPTIIEDNCFI 184

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSEIVEG I+ EG+V+ MGV+IG+STKI +R TGEITYG VP  +VVV G+ P+ +  
Sbjct: 185 GARSEIVEGVIVGEGAVISMGVYIGQSTKIYNRETGEITYGRVPPGAVVVSGNLPAKD-- 242

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLRD 283
               G H LYCAVIIK+VDE+TR K  IN LLRD
Sbjct: 243 ----GSHSLYCAVIIKQVDERTRGKVGINELLRD 272


>gi|77360963|ref|YP_340538.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Pseudoalteromonas haloplanktis TAC125]
 gi|123588817|sp|Q3IIZ6|DAPD_PSEHT RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|76875874|emb|CAI87095.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 276

 Score =  304 bits (779), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 148/280 (52%), Positives = 205/280 (73%), Gaps = 11/280 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNES-IPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ +I++ ++  +S + S +  +VK A+   LDLLD G  R+A +  +G W  HQW+
Sbjct: 1   MSDLKTMIENAWDNRDSISPSTVSVEVKQAIIDALDLLDSGAARVAEKI-SGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I   + + DG   + ++DK+P KF D+  + F++   R++P  + R  +++
Sbjct: 60  KKAVLLSFRIRENQAMDDG--VNQFYDKVPLKFSDYTPEQFKQGGMRVVPNAVARKGSFV 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G   VLMPS+VN+GAY+ +G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 GKNVVLMPSYVNIGAYVDDGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EG+V+ MGV+I +ST+I DR TGEI YG VP+ +VVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGAVISMGVYISQSTRIYDRETGEIHYGRVPAGAVVVPGA 237

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +      G H LY A+I+KKVD++TR K  IN LLR
Sbjct: 238 LPSKD------GSHSLYAAIIVKKVDQQTREKVGINALLR 271


>gi|169632734|ref|YP_001706470.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acinetobacter baumannii SDF]
 gi|226724150|sp|B0VTA6|DAPD_ACIBS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|169151526|emb|CAP00293.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acinetobacter baumannii]
          Length = 273

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 198/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L  II+  FE+ +N      P +++ AV+  +  LD G +R+A +  NG W  HQW+
Sbjct: 1   MSQLSTIIEQAFEDCANFTAADCPSEIRQAVEEAIAGLDNGTLRVAEKI-NGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  K I   +    ++DK+  KF  W  + F+    R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNKPIESCD--LRFYDKVETKFSGWTEEQFKAAGVRVVPPAVARRGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVPGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 238 LPSADGK-----YSLYAAIIVKKVDAQTRAKTSLNDLLR 271


>gi|126642574|ref|YP_001085558.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acinetobacter baumannii ATCC 17978]
 gi|169795078|ref|YP_001712871.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acinetobacter baumannii AYE]
 gi|184159134|ref|YP_001847473.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acinetobacter baumannii ACICU]
 gi|213158260|ref|YP_002320311.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter baumannii AB0057]
 gi|215482628|ref|YP_002324820.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter baumannii AB307-0294]
 gi|239501048|ref|ZP_04660358.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acinetobacter baumannii AB900]
 gi|260556564|ref|ZP_05828782.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter baumannii ATCC 19606]
 gi|301346459|ref|ZP_07227200.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acinetobacter baumannii AB056]
 gi|301512445|ref|ZP_07237682.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acinetobacter baumannii AB058]
 gi|301594746|ref|ZP_07239754.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acinetobacter baumannii AB059]
 gi|332851073|ref|ZP_08433182.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter baumannii 6013150]
 gi|332869678|ref|ZP_08438866.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter baumannii 6013113]
 gi|332875963|ref|ZP_08443749.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter baumannii 6014059]
 gi|71153268|sp|Q5DL43|DAPD_ACIBA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|166224190|sp|A3M7R2|DAPD_ACIBT RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724147|sp|B7GYD0|DAPD_ACIB3 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724148|sp|B7I595|DAPD_ACIB5 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724149|sp|B2HWR7|DAPD_ACIBC RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724151|sp|B0VCW7|DAPD_ACIBY RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|56131241|gb|AAV80242.1| putative tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acinetobacter baumannii]
 gi|126388458|gb|ABO12956.1| putative tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acinetobacter baumannii ATCC 17978]
 gi|169148005|emb|CAM85868.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acinetobacter baumannii AYE]
 gi|183210728|gb|ACC58126.1| Tetrahydrodipicolinate N-succinyltransferase [Acinetobacter
           baumannii ACICU]
 gi|213057420|gb|ACJ42322.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter baumannii AB0057]
 gi|213987263|gb|ACJ57562.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter baumannii AB307-0294]
 gi|260409823|gb|EEX03123.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter baumannii ATCC 19606]
 gi|322509048|gb|ADX04502.1| dapD [Acinetobacter baumannii 1656-2]
 gi|323519030|gb|ADX93411.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acinetobacter baumannii TCDC-AB0715]
 gi|332730237|gb|EGJ61562.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter baumannii 6013150]
 gi|332732580|gb|EGJ63813.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter baumannii 6013113]
 gi|332735829|gb|EGJ66870.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter baumannii 6014059]
          Length = 273

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 198/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L  II+  FE+ +N      P +++ AV+  +  LD G +R+A +  NG W  HQW+
Sbjct: 1   MSQLSTIIEQAFEDRANFTAADCPSEIRQAVEEAIAGLDNGTLRVAEKI-NGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  K I   +    ++DK+  KF  W  + F+    R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNKPIESCD--LRFYDKVETKFSGWTEEQFKAAGVRVVPPAVARRGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVPGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 238 LPSADGK-----YSLYAAIIVKKVDAQTRAKTSLNDLLR 271


>gi|145627776|ref|ZP_01783577.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae 22.1-21]
 gi|144979551|gb|EDJ89210.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae 22.1-21]
          Length = 275

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 199/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II++ FE+ +    +++  + + A++  ++ LD G  R+A +   G W THQW+
Sbjct: 1   MSNLQAIIEAAFEKRAEITPKTVDAETRVAIEEVIEGLDSGKYRVAEKI-AGEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFTEEGFRVVPSATVRKGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 SKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 178 IGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 238 LPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|117923363|ref|YP_863980.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Magnetococcus sp. MC-1]
 gi|117607119|gb|ABK42574.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Magnetococcus sp. MC-1]
          Length = 283

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 198/285 (69%), Gaps = 7/285 (2%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGH-----WNT 59
           +S L+ II+  ++E +  N S   +V+ AV  T++ +D G +R+A ++ +       W  
Sbjct: 1   MSDLQAIIEKAWDERDGINSSTAGEVRRAVLETIEAIDAGTLRVAEKNPDHPEAEHGWVV 60

Query: 60  HQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRH 119
           +QW KKA+LL F+++  +++ D    +T++DK+P KF  W    F++  FR +P    R 
Sbjct: 61  NQWAKKAVLLYFKLHDNQVMGDEG--ATYFDKVPLKFAGWDEARFKQAGFRAVPPATARK 118

Query: 120 SAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQT 179
             YI P  VLMPS+ N+GAY+  G+M+DTW+TVGSCAQIGKNVHISGG GIGGVLEP+Q 
Sbjct: 119 GVYIAPGVVLMPSYCNIGAYVDSGTMVDTWATVGSCAQIGKNVHISGGAGIGGVLEPLQA 178

Query: 180 GPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVV 239
            P IIEDNCFIGAR+E+ EG I+ EGSVL MGV++GKSTKI+DR +GEI  G VP YSVV
Sbjct: 179 NPVIIEDNCFIGARAEVAEGVIVGEGSVLSMGVYLGKSTKIVDRASGEIHMGYVPPYSVV 238

Query: 240 VPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDY 284
           V G+ P   +     GP+LYCAVI+K VD +TRSKT IN LLR++
Sbjct: 239 VSGTMPGKPMPNGQPGPNLYCAVIVKTVDAQTRSKTGINELLREF 283


>gi|255320798|ref|ZP_05361973.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter radioresistens SK82]
 gi|255302175|gb|EET81417.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter radioresistens SK82]
          Length = 273

 Score =  303 bits (777), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 198/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L  II+  FE  +N      P +V+ AV+  ++ LD G +R+A + D G W  HQW+
Sbjct: 1   MTQLSTIIEQAFENRANFTAADCPSEVRQAVEEAIEGLDNGTLRVAEKID-GEWIVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  K I   +    ++DK+  KF  W  + F++   R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNKPIESCD--LRFYDKVETKFSGWTEEQFKEAGVRVVPPAVARRGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVPGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 238 LPSKD-----GTYSLYAAIIVKKVDAQTRAKTSLNDLLR 271


>gi|68057975|gb|AAX88228.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Haemophilus influenzae 86-028NP]
          Length = 297

 Score =  303 bits (777), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 198/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II++ FE+ +    +++  +   A++  ++ LD G  R+A +   G W THQW+
Sbjct: 23  MSNLQAIIEAAFEKRAEITPKTVDAETHAAIEEVIEGLDSGKYRVAEKI-AGEWVTHQWL 81

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI
Sbjct: 82  KKAVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFTEEGFRVVPSATVRKGAYI 139

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 140 SKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 199

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 200 IGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGS 259

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 260 LPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 293


>gi|261854877|ref|YP_003262160.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Halothiobacillus neapolitanus c2]
 gi|261835346|gb|ACX95113.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Halothiobacillus neapolitanus c2]
          Length = 277

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 206/283 (72%), Gaps = 8/283 (2%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNES-IPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +T ++ L+  I++ FE+  S   +  PQ V+DAV + L +LD G +R+A R   G W  +
Sbjct: 1   MTDLNALKNTIETAFEDRASITPAEAPQAVRDAVNTVLGMLDAGQLRVAERRGVGDWVVN 60

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           +W+KKA+LLSF++NP +++  G+    ++DK+P KF +W    FE+   R++P  + R  
Sbjct: 61  EWLKKAVLLSFRLNPNEVVQGGD--LRYFDKVPTKFANWNQAQFEEAGIRVVPNAVARRG 118

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           ++I   AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 119 SFIAKGAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAS 178

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+STKI DR TGE++YG +P+ SVVV
Sbjct: 179 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVSYGRIPAGSVVV 238

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            G+ PS           LYCAVI+KKVD KT SK  IN LLRD
Sbjct: 239 SGNLPS-----KCGKYSLYCAVIVKKVDAKTLSKVGINALLRD 276


>gi|226952148|ref|ZP_03822612.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acinetobacter sp. ATCC 27244]
 gi|226837110|gb|EEH69493.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acinetobacter sp. ATCC 27244]
          Length = 273

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 195/279 (69%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L  II+  FE+ +N      P +++ AV+  L  LD G +R+A + D G W  HQW+
Sbjct: 1   MSQLSTIIEQAFEDRANFSAADCPTEIRQAVEEALTGLDNGTLRVAEKID-GEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  + I   +    ++DK+  K+  W  + F+    R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNQPIEACD--LQFYDKVATKYSGWTEEQFKAAGVRVVPPAVARRGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGE+ YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRETGEVHYGRVPAGSVVVAGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LY A+I+KKVD KTR+KTS+N LLR
Sbjct: 238 LPS-----KCGTYSLYAAIIVKKVDAKTRAKTSLNDLLR 271


>gi|229558494|ref|YP_277781.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Candidatus Blochmannia pennsylvanicus str. BPEN]
 gi|229462860|sp|Q493D4|DAPD_BLOPB RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
          Length = 273

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 156/280 (55%), Positives = 199/280 (71%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L +II+S FE+     N +I   V +AV+  +D LD G +RI+ +  NG W THQW+
Sbjct: 1   MNQLRKIIESAFEKKEYISNNNIDSTVNNAVREIMDRLDNGTLRISEKI-NGTWITHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKAI+L+F     ++I+ G G   ++DK P KF  W    FE    RIIP   VR+ AYI
Sbjct: 60  KKAIMLAFHTMDNQLITWGGG--VFFDKFPMKFSGWDHTRFENKKLRIIPPATVRYGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               V+MPS++N+GAYI  G+MIDTW+TVGSCAQIGK VH+SGGVGIGGVLEPIQT PTI
Sbjct: 118 ADNTVIMPSYINLGAYIDVGTMIDTWATVGSCAQIGKYVHLSGGVGIGGVLEPIQTNPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIG+RSEIVEG I+ +G+V+ MGVFIG+STKI DR +G I YG VP+ SVV+PGS
Sbjct: 178 IEDNCFIGSRSEIVEGVIVEKGAVISMGVFIGQSTKIYDRASGNIYYGRVPAGSVVIPGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS + +      + YCAVI+K VD KT++K  IN LLRD
Sbjct: 238 LPSKDGR-----VNTYCAVIVKTVDSKTKNKVKINNLLRD 272


>gi|257095181|ref|YP_003168822.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257047705|gb|ACV36893.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 273

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 152/279 (54%), Positives = 202/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  +++ I+  +E+  + +  S P  + +AV   L  LD G +R+A + D G W THQWI
Sbjct: 1   MQAIQQTIEKAWEDRAALQPGSAPAAIGEAVAEVLGRLDEGSLRVAEKID-GEWLTHQWI 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++    ++ DG G   ++DK+P+KF  + ++ F +  FR++P    R  A+I
Sbjct: 60  KKAVLLSFRLQ-DNVLVDG-GPLRYFDKVPSKFASYDSERFTRGGFRVVPPATARRGAFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G   VLMPS+VN+GAY+ EG+M+DTWSTVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 GRNVVLMPSYVNIGAYVDEGTMVDTWSTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG II EGSV+ MGV+IG+ST+I DR TG+++YG VP  SVVV G+
Sbjct: 178 IEDNCFIGARSEVVEGVIIGEGSVISMGVYIGQSTRIFDRETGQVSYGRVPPGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            P+ +         LYCAVI+KKVD  TR+KTSIN LLR
Sbjct: 238 LPAKD-----GSYSLYCAVIVKKVDAGTRAKTSINDLLR 271


>gi|260551479|ref|ZP_05825663.1| tetrahydrodipicolinate N-succinyltransferase [Acinetobacter sp.
           RUH2624]
 gi|260405473|gb|EEW98966.1| tetrahydrodipicolinate N-succinyltransferase [Acinetobacter sp.
           RUH2624]
          Length = 273

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 151/279 (54%), Positives = 197/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L  II+  FE+ +N        +++ AV+  +  LD G +R+A +  NG W  HQW+
Sbjct: 1   MSQLSTIIEQAFEDRANFTAADCSSEIRQAVEEAIAGLDNGTLRVAEKI-NGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  K I   +    ++DK+  KF  W  + F+    R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNKPIESCD--LRFYDKVETKFSGWTEEQFKAAGVRVVPPAVARRGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI YG VP+ SVVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVPGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 238 IPSADGK-----YSLYAAIIVKKVDAQTRAKTSLNDLLR 271


>gi|161761268|ref|YP_248888.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Haemophilus influenzae 86-028NP]
 gi|82592816|sp|Q4QL69|DAPD_HAEI8 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
          Length = 275

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 154/279 (55%), Positives = 198/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II++ FE+ +    +++  +   A++  ++ LD G  R+A +   G W THQW+
Sbjct: 1   MSNLQAIIEAAFEKRAEITPKTVDAETHAAIEEVIEGLDSGKYRVAEKI-AGEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFTEEGFRVVPSATVRKGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 SKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 178 IGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 238 LPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|262379426|ref|ZP_06072582.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter radioresistens SH164]
 gi|262298883|gb|EEY86796.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter radioresistens SH164]
          Length = 273

 Score =  303 bits (775), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 198/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L  II+  FE  +N      P +V+ AV+  ++ LD G +R+A + D G W  HQW+
Sbjct: 1   MTQLSTIIEQAFENRANFTAADCPSEVRQAVEEAIEGLDNGTLRVAEKID-GEWIVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  K I   +    ++DK+  KF  W  + F++   R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNKPIESCD--LRFYDKVETKFSGWTEEQFKEAGVRVVPPAVARRGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVPGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 238 LPSKD-----GTYSLYAAIIVKKVDPQTRAKTSLNDLLR 271


>gi|71796157|gb|AAZ40908.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Candidatus Blochmannia pennsylvanicus str. BPEN]
          Length = 283

 Score =  303 bits (775), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 156/280 (55%), Positives = 199/280 (71%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L +II+S FE+     N +I   V +AV+  +D LD G +RI+ +  NG W THQW+
Sbjct: 11  MNQLRKIIESAFEKKEYISNNNIDSTVNNAVREIMDRLDNGTLRISEKI-NGTWITHQWL 69

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKAI+L+F     ++I+ G G   ++DK P KF  W    FE    RIIP   VR+ AYI
Sbjct: 70  KKAIMLAFHTMDNQLITWGGG--VFFDKFPMKFSGWDHTRFENKKLRIIPPATVRYGAYI 127

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               V+MPS++N+GAYI  G+MIDTW+TVGSCAQIGK VH+SGGVGIGGVLEPIQT PTI
Sbjct: 128 ADNTVIMPSYINLGAYIDVGTMIDTWATVGSCAQIGKYVHLSGGVGIGGVLEPIQTNPTI 187

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIG+RSEIVEG I+ +G+V+ MGVFIG+STKI DR +G I YG VP+ SVV+PGS
Sbjct: 188 IEDNCFIGSRSEIVEGVIVEKGAVISMGVFIGQSTKIYDRASGNIYYGRVPAGSVVIPGS 247

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS + +      + YCAVI+K VD KT++K  IN LLRD
Sbjct: 248 LPSKDGR-----VNTYCAVIVKTVDSKTKNKVKINNLLRD 282


>gi|294651040|ref|ZP_06728379.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter haemolyticus ATCC 19194]
 gi|292823053|gb|EFF81917.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter haemolyticus ATCC 19194]
          Length = 273

 Score =  302 bits (774), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 195/279 (69%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L  II+  FE+ +N      P +++ AV+  L  LD G +R+A + D G W  HQW+
Sbjct: 1   MSQLSTIIEQAFEDRANFSAADCPTEIRQAVEEALTGLDNGSLRVAEKID-GEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  + I   +    ++DK+  K+  W  + F+    R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNQPIEACD--LQFYDKVATKYSGWTEEQFKAAGVRVVPPAVARRGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGE+ YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIFDRETGEVHYGRVPAGSVVVAGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LY A+I+KKVD KTR+KTS+N LLR
Sbjct: 238 LPS-----KCGTYSLYAAIIVKKVDAKTRAKTSLNDLLR 271


>gi|332967789|gb|EGK06893.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Kingella kingae ATCC 23330]
          Length = 273

 Score =  302 bits (774), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 158/278 (56%), Positives = 207/278 (74%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L++II++ FE  ++    ++  +VK+AV  TL  LD G +R+A R+  G W  ++W KK
Sbjct: 2   SLQQIIETAFENRADITPATVTPEVKEAVLETLRQLDNGTLRVAERESVGKWKVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I    I+  G+G + ++DK+P KF +W   DF+   FR +PG + R  +++  
Sbjct: 62  AVLLSFRIQDNVIL--GDGVNQFFDKVPTKFANWTQADFQAAGFRAVPGAVARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NVVLMPSYVNIGAYVDEGAMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG ++ EGSV+ MGV+IG+STKI DR TGEI YG VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTKIYDRETGEIHYGRVPAGSVVVSGSLP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+KKVD +TRSKTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKKVDAQTRSKTSVNELLR 271


>gi|315127168|ref|YP_004069171.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Pseudoalteromonas sp. SM9913]
 gi|315015682|gb|ADT69020.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Pseudoalteromonas sp. SM9913]
          Length = 275

 Score =  302 bits (773), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 146/280 (52%), Positives = 205/280 (73%), Gaps = 11/280 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ +I++ ++  +S    ++  DVK A+   L+LLD G  R+A +  +G W  HQW+
Sbjct: 1   MSDLKTMIENAWDNRDSISPATVSSDVKQAIIDALELLDSGAARVAEKI-SGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I   + ++DG   + ++DK+P KF D+  + F++   R++P  + R  +++
Sbjct: 60  KKAVLLSFRIRENQPMNDG--VNQFYDKVPLKFSDYTPEQFQQGGMRVVPNAVARKGSFV 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G   VLMPS+VN+GA++ +G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 GKNVVLMPSYVNIGAFVDDGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EG+V+ MGV+I +ST+I DR TGEI YG VP+ +VVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGAVISMGVYISQSTRIYDRETGEIHYGRVPAGAVVVPGA 237

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +      G H LY A+I+KKVD++TR K  IN LLR
Sbjct: 238 LPSKD------GSHSLYAAIIVKKVDKQTREKVGINALLR 271


>gi|296283294|ref|ZP_06861292.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Citromicrobium bathyomarinum JL354]
          Length = 273

 Score =  302 bits (773), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 184/255 (72%), Gaps = 6/255 (2%)

Query: 29  DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTW 88
           D+++AV+S +  LD G  R+A  D NG W  +QW+KKA+LLSF+++  +++ DG   S  
Sbjct: 25  DLREAVESAITSLDEGSARVAEPDGNGGWQVNQWLKKAVLLSFRLSDNRVM-DGAVGSPA 83

Query: 89  WDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDT 148
           +DK+P+KF  W    F +  FR++PG I R  ++IG   VLMPSF N+GAY+GE +M+DT
Sbjct: 84  FDKVPSKFAGWGEARFREAGFRVVPGAIARRGSFIGKNCVLMPSFTNIGAYVGENTMLDT 143

Query: 149 WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208
           W++VGSCAQ+G N HIS G GIGGVLEP+Q  PTII DNCFIGARSEIVEG I+ EG V+
Sbjct: 144 WASVGSCAQVGANCHISAGTGIGGVLEPLQANPTIIGDNCFIGARSEIVEGVIVGEGCVV 203

Query: 209 GMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVD 268
            MGVFI +STKI+ R+TGE+  G +P YSVVVPGS P     G   GP L CAVI+K VD
Sbjct: 204 AMGVFITQSTKIVVRDTGEVLRGHIPPYSVVVPGSLP-----GKDGGPSLACAVIVKTVD 258

Query: 269 EKTRSKTSINTLLRD 283
            +TR KT IN LLRD
Sbjct: 259 AQTREKTGINELLRD 273


>gi|319897305|ref|YP_004135500.1| 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase
           [Haemophilus influenzae F3031]
 gi|317432809|emb|CBY81174.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae F3031]
          Length = 275

 Score =  302 bits (773), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 153/279 (54%), Positives = 198/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II++ FE+ +    +++  + + A++  ++ LD G  R+A +   G W THQW+
Sbjct: 1   MSNLQAIIEAAFEKRAEITPKTVDAETRAAIEEVIEGLDSGKYRVAEKI-AGEWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LL F+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI
Sbjct: 60  KKAVLLFFRINDNQII-DG-AETKYYDKVALKFADYTEERFTEEGFRVVPSATVRKGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 SKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSE+VEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 178 IGDNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 238 LPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|262373095|ref|ZP_06066374.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter junii SH205]
 gi|262313120|gb|EEY94205.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter junii SH205]
          Length = 273

 Score =  301 bits (771), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 195/279 (69%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L  II+  FE+ +N      P +++ AV+  L  LD G +R+A + D G W  HQW+
Sbjct: 1   MSQLSTIIEQAFEDRANYSATDCPTEIRQAVEEALTGLDNGTLRVAEKID-GEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  + I   +    ++DK+  K+  W  + F+    R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNQPIEACD--LQFYDKVATKYSGWTEEQFKAAGVRVVPPAVARRGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               +LMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVILMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEIVEGVIVGEGSVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVAGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LY A+I+KKVD KTR+KTS+N LLR
Sbjct: 238 LPS-----KCGTYSLYAAIIVKKVDAKTRAKTSLNDLLR 271


>gi|52425232|ref|YP_088369.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Mannheimia succiniciproducens MBEL55E]
 gi|71153293|sp|Q65TC6|DAPD_MANSM RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|52307284|gb|AAU37784.1| DapD protein [Mannheimia succiniciproducens MBEL55E]
          Length = 275

 Score =  301 bits (771), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 154/280 (55%), Positives = 199/280 (71%), Gaps = 11/280 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II++ FE  +    +++    K A++  +  LD G  R+A + D G W THQW+
Sbjct: 1   MSNLQSIIEAAFERRAEITPKTVDAQTKAAIEEVIAGLDCGKYRVAEKID-GDWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  ++I DG   + ++DK+  KF D+  + F++  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRINDNQLI-DG-AETKYYDKVALKFADYTEERFQQEGFRVVPSATVRKGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GA++ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNTVLMPSYVNIGAFVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           I DNCFIGARSEIVEG I+ +G V+ MGVFIG+STKI DR TGE+ YG VP+ SVVV GS
Sbjct: 178 IGDNCFIGARSEIVEGVIVEDGCVISMGVFIGQSTKIYDRETGEVHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +      G H LYCAVI+KKVD KT  K  +N LLR
Sbjct: 238 LPSKD------GSHSLYCAVIVKKVDAKTLGKVGLNELLR 271


>gi|241662931|ref|YP_002981291.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Ralstonia pickettii 12D]
 gi|240864958|gb|ACS62619.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ralstonia pickettii 12D]
          Length = 275

 Score =  301 bits (771), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 151/281 (53%), Positives = 208/281 (74%), Gaps = 10/281 (3%)

Query: 4   IVSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L+ +ID  +E+ +N   +S P D+++AV + +  LDRG +R+A + D G W  +QW
Sbjct: 1   MTQQLQSLIDQAWEDRANLSPKSAPADIREAVANVIGQLDRGALRVAEKKD-GEWIVNQW 59

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF++     ++ G G++ ++DK+P+KF D+  +DF    FR++P  + R  ++
Sbjct: 60  IKKAVLLSFRLEDNAPMAAG-GFTQFYDKVPSKFADYTAEDFAAGGFRVVPPAVARRGSF 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P 
Sbjct: 119 IAKNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPV 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE++YG +P+ SVVV G
Sbjct: 179 IIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVSYGRIPAGSVVVAG 238

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           + PS +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 239 NLPSKD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|239994625|ref|ZP_04715149.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Alteromonas macleodii ATCC 27126]
          Length = 274

 Score =  301 bits (770), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 149/279 (53%), Positives = 198/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L+ II+  FE  +S    S P +V+DAV   +DLL+ G  R+A +   G W  HQW+
Sbjct: 1   MNELKAIIEDAFENRDSISPSSAPDEVRDAVAQAIDLLNTGKARVAEKI-AGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LL F+++   +I      S ++DK+P K+ ++  + F     RI+P   VR   ++
Sbjct: 60  KKAVLLFFRLHNNDVIEGAE--SKFYDKVPLKYTNYTAEQFAADGARIVPPAAVRTGTFV 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G  AV+MPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 GKNAVVMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+ST+I DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTRIYDRETGEVHYGRVPAGSVVVAGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LY A+I+KKVD KTR+K  IN LLR
Sbjct: 238 LPSADGK-----YSLYAAIIVKKVDAKTRAKVGINALLR 271


>gi|293609844|ref|ZP_06692146.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828296|gb|EFF86659.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325123070|gb|ADY82593.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 273

 Score =  301 bits (770), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 151/279 (54%), Positives = 194/279 (69%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L  II+  FE+ +N        +++ AV+  +  LD G +R+A +  NG W  HQW+
Sbjct: 1   MSQLSTIIEQAFEDRANFTAADCSSEIRQAVEEAIAGLDNGTLRVAEKI-NGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  K I   +    ++DK+  KF  W  + F+    R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNKPIESCD--LRFYDKVETKFSGWTEEQFKAAGVRVVPPAVARRGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LY A+I+KKVD +TRSKTS+N LLR
Sbjct: 238 LPS-----KCGTYSLYAAIIVKKVDAQTRSKTSLNDLLR 271


>gi|299769139|ref|YP_003731165.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acinetobacter sp. DR1]
 gi|298699227|gb|ADI89792.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acinetobacter sp. DR1]
          Length = 273

 Score =  301 bits (770), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 149/279 (53%), Positives = 196/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L  II+  FE+ +N        +++ AV+  +  LD G +R+A +  NG W  HQW+
Sbjct: 1   MSQLSTIIEQAFEDRANFTAADCSSEIRQAVEEAIAGLDNGTLRVAEKI-NGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  K I   +    ++DK+  KF  W  + F+    R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNKPIESCD--LRFYDKVETKFSGWTEEQFKAAGVRVVPPAVARRGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS++N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYINIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGE+ YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIYDRATGEVHYGRVPAGSVVVAGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 238 LPSADGK-----YSLYAAIIVKKVDAQTRAKTSLNDLLR 271


>gi|262278178|ref|ZP_06055963.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acinetobacter calcoaceticus RUH2202]
 gi|262258529|gb|EEY77262.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Acinetobacter calcoaceticus RUH2202]
          Length = 273

 Score =  301 bits (770), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 151/279 (54%), Positives = 196/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L  II+  FE+ +N        +++ AV+  +  LD G +R+A +  NG W  HQW+
Sbjct: 1   MSQLSTIIEQAFEDRANFTAVDCSSEIRQAVEEAIAGLDNGTLRVAEKI-NGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  K I   +    ++DK+  KF  W  + F+    R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNKPIESCD--LRFYDKVETKFSGWTEEQFKAAGVRVVPPAVARRGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIYDRATGEIHYGRVPAGSVVVAGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LY A+I+KKVD +TR+KTS+N LLR
Sbjct: 238 LPSADGK-----YSLYAAIIVKKVDAQTRAKTSLNDLLR 271


>gi|300715393|ref|YP_003740196.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erwinia billingiae Eb661]
 gi|299061229|emb|CAX58338.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Erwinia billingiae Eb661]
          Length = 274

 Score =  301 bits (770), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 160/282 (56%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIESAFER---RAEITPANADTVTREAVSQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRFYDKVPMKFADYDEARFKKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           AYI    VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AYIARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EG+V+ MGV++G+STKI DR TGE+TYG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGAVISMGVYLGQSTKIYDRETGEVTYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTR+K  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRAKVGINELLR 271


>gi|262375546|ref|ZP_06068779.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter lwoffii SH145]
 gi|262309800|gb|EEY90930.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acinetobacter lwoffii SH145]
          Length = 273

 Score =  300 bits (769), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 151/280 (53%), Positives = 196/280 (70%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L  II+  FE+ +N   E    +++ AV+  +  LD G +R+A + D G W  HQWI
Sbjct: 1   MSQLSTIIEQAFEDRANFTAEDCSAEIRQAVEEVIAGLDNGTLRVAEKID-GEWVVHQWI 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  K +   +    ++DK+  KF  W  + F+    R++P  + R  ++ 
Sbjct: 60  KKAVLLSFKLNDNKPMEACD--LRFYDKVDTKFSGWTEEQFKAAGVRVVPPAVARKGSFQ 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               +LMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKGVILMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVFIGQSTKIYDRATGEIHYGRVPAGSVVVAGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS           LY A+I+KKVD +TRSKTS+N LLR+
Sbjct: 238 LPS-----KCGTYSLYAAIIVKKVDAQTRSKTSLNDLLRE 272


>gi|187928355|ref|YP_001898842.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Ralstonia pickettii 12J]
 gi|309782148|ref|ZP_07676878.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ralstonia sp. 5_7_47FAA]
 gi|226724184|sp|B2UAZ4|DAPD_RALPJ RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|187725245|gb|ACD26410.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ralstonia pickettii 12J]
 gi|308919214|gb|EFP64881.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ralstonia sp. 5_7_47FAA]
          Length = 275

 Score =  300 bits (768), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 151/281 (53%), Positives = 208/281 (74%), Gaps = 10/281 (3%)

Query: 4   IVSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L+ +ID  +E+ +N   +S P DV++AV + +  LDRG +R+A + D G W  +QW
Sbjct: 1   MTQQLQSLIDQAWEDRANLSPKSAPADVREAVANVIGQLDRGALRVAEKQD-GEWIVNQW 59

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF++     ++ G G++ ++DK+P+KF ++  +DF    FR++P  + R  ++
Sbjct: 60  IKKAVLLSFRLEDNAPMAAG-GFTQFYDKVPSKFANYTAEDFAAGGFRVVPPAVARRGSF 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P 
Sbjct: 119 IAKNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPV 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE++YG +P+ SVVV G
Sbjct: 179 IIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVSYGRIPAGSVVVAG 238

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           + PS +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 239 NLPSKD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|17546112|ref|NP_519514.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ralstonia solanacearum GMI1000]
 gi|71153301|sp|Q8XZK2|DAPD_RALSO RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|17428408|emb|CAD15095.1| probable 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           n-succinyltransferase (tetrahydrodipicolinate
           n-succinyltransferase) (thp succinyltransferase)
           (tetrahydropicolinate succinylase) protein [Ralstonia
           solanacearum GMI1000]
          Length = 275

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 150/276 (54%), Positives = 207/276 (75%), Gaps = 8/276 (2%)

Query: 8   LEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+ +I+  +E+ +N   ++ P DV+ AV + +D LD+G +R+A + D G W  +QW+KKA
Sbjct: 5   LQSLIEQAWEDRANLSPKAAPNDVRAAVANVIDQLDQGALRVAEKKD-GQWIVNQWVKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     ++ G G++ ++DK+P+KF  +   DF +  FR++P  + R  ++IG  
Sbjct: 64  VLLSFRLEDNAPMTAG-GFTHFYDKVPSKFASYTADDFARGGFRVVPPAVARRGSFIGKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 AVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+ YG VP+ SVVVPG+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVHYGRVPAGSVVVPGNLPS 242

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            +         LYCAVI+KKVD +TR+KTS+N LLR
Sbjct: 243 KD-----GTYSLYCAVIVKKVDAQTRAKTSLNELLR 273


>gi|332140396|ref|YP_004426134.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|226724152|sp|B4RVP7|DAPD_ALTMD RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|327550418|gb|AEA97136.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 274

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 198/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L+ II+  FE  +S    S P +V+DAV   +DLL+ G  R+A +   G W  HQW+
Sbjct: 1   MNELKAIIEDAFENRDSISPSSAPDEVRDAVAQAIDLLNSGKGRVAEKI-AGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LL F+++   +I      S ++DK+P K+ ++  + F     RI+P   VR   ++
Sbjct: 60  KKAVLLFFRLHNNDVIEGAE--SKFYDKVPLKYTNYTAEQFAADGARIVPPAAVRTGTFV 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G  AV+MPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 GKNAVVMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVAGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LY A+I+KKVD KTR+K  IN LLR
Sbjct: 238 LPSADGK-----YSLYAAIIVKKVDAKTRAKVGINALLR 271


>gi|304320365|ref|YP_003854008.1| hypothetical protein PB2503_03957 [Parvularcula bermudensis
           HTCC2503]
 gi|303299267|gb|ADM08866.1| hypothetical protein PB2503_03957 [Parvularcula bermudensis
           HTCC2503]
          Length = 278

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 155/282 (54%), Positives = 200/282 (70%), Gaps = 10/282 (3%)

Query: 1   MITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           M T++ T  E  D   + +N        D+++AV S L+ LD G +R+A  D  G W  +
Sbjct: 6   MATLIETAWENRDGLSDPANRT-----ADLEEAVASALEGLDSGTLRVAEPDGKGGWTVN 60

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           +W+KKA+LLSF+++    I+ G G S W+DK+P KF  W   DF +  FR +P   VR+ 
Sbjct: 61  EWLKKAVLLSFRLSANVSIAGGPGGSDWYDKVPPKFIGWTEADFAQAGFRAVPPCAVRYG 120

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A++   AVLMPS+VN+GAY+G G+M+DTW T+GSCAQIG+N HISGGVGIGGVLEPIQ  
Sbjct: 121 AHVAKGAVLMPSYVNIGAYVGSGTMVDTWVTIGSCAQIGENCHISGGVGIGGVLEPIQAA 180

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           P IIEDNCFIGARSE+ EG I+REG+VL MGVF+G STKI+DR TGE+T GEVP Y+VVV
Sbjct: 181 PVIIEDNCFIGARSEVAEGVIVREGAVLSMGVFLGASTKIVDRETGEVTRGEVPPYAVVV 240

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           PG+     + G    P L CAVI+K+VDE+TR+KT IN LLR
Sbjct: 241 PGT-----MGGGADRPALSCAVIVKRVDERTRAKTGINELLR 277


>gi|71907356|ref|YP_284943.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Dechloromonas aromatica RCB]
 gi|123627559|sp|Q47FA8|DAPD_DECAR RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|71846977|gb|AAZ46473.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Dechloromonas aromatica RCB]
          Length = 272

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 150/275 (54%), Positives = 192/275 (69%), Gaps = 8/275 (2%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           L+  I+  +E     +   P     A+ S +  LD G +R+A +   G W THQWIKKA+
Sbjct: 5   LQATIEELWERRTELSPQSPPTTIAAINSVIGDLDSGKLRVAEKI-AGEWFTHQWIKKAV 63

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++   ++   G+    ++DK+  KF+ W  + F +  FR++PGTIVR  +Y+   A
Sbjct: 64  LLSFRVRDNRVQEAGD--IRFYDKVDTKFEGWTEEQFRQGGFRVVPGTIVRKGSYVAKNA 121

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           VLMPSFVN+GAY+ E +M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIEDN
Sbjct: 122 VLMPSFVNIGAYVDESTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDN 181

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGARSE+VEG +I E SVL MGV+IG+ST I DR TGE+TYG VP  SVV+ G+ P  
Sbjct: 182 CFIGARSEVVEGVVIGENSVLSMGVYIGQSTPIYDRETGEVTYGRVPPGSVVISGTLPKA 241

Query: 248 NLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           + K       LY A+I+KKVD +TRSKTSIN LLR
Sbjct: 242 DGKYS-----LYAAIIVKKVDAQTRSKTSINELLR 271


>gi|171319298|ref|ZP_02908411.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia ambifaria MEX-5]
 gi|171095480|gb|EDT40447.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia ambifaria MEX-5]
          Length = 275

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 151/277 (54%), Positives = 205/277 (74%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P DV++AV   ++ LDRG +R+A + D G+W  HQW+KKA
Sbjct: 5   LQQIIDTAWENRAELSPKAAPADVREAVAHAIEQLDRGALRVAEKID-GNWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE++YG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVSYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|115352113|ref|YP_773952.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia ambifaria AMMD]
 gi|122322830|sp|Q0BE05|DAPD_BURCM RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|115282101|gb|ABI87618.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia ambifaria AMMD]
          Length = 275

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 151/277 (54%), Positives = 205/277 (74%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P DV++AV   L+ LD+G +R+A + D G+W  HQW+KKA
Sbjct: 5   LQQIIDTAWENRAELSPKAAPADVREAVAHALEQLDKGALRVAEKID-GNWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE++YG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVSYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|268590536|ref|ZP_06124757.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Providencia rettgeri DSM 1131]
 gi|291313923|gb|EFE54376.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Providencia rettgeri DSM 1131]
          Length = 275

 Score =  299 bits (766), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 202/276 (73%), Gaps = 9/276 (3%)

Query: 8   LEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+ II+  FEE  S    ++   VK AV  T+ LLD G +R+A +   G W THQW+KKA
Sbjct: 4   LQAIIEQAFEERASITPNTVSNSVKQAVLDTIALLDSGELRVAEKI-AGVWVTHQWLKKA 62

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF+I   ++I DG   S ++DK+P KF D+    FEK  FR++P   VR  AYI   
Sbjct: 63  VLLSFRIQDNQVI-DG-AESRYFDKVPMKFADYDQARFEKEGFRVVPPAAVRKGAYIAKN 120

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           +VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 121 SVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED 180

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGEI YG VP+ SVVV G+ PS
Sbjct: 181 NCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEIHYGRVPAGSVVVSGNLPS 240

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            + +       LYCAVI+KKVDEKTR K  IN LLR
Sbjct: 241 KDGR-----YSLYCAVIVKKVDEKTRGKVGINELLR 271


>gi|42520558|ref|NP_966473.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|225630420|ref|YP_002727211.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Wolbachia sp. wRi]
 gi|42410297|gb|AAS14407.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|225592401|gb|ACN95420.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Wolbachia sp. wRi]
          Length = 276

 Score =  299 bits (766), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 162/282 (57%), Positives = 200/282 (70%), Gaps = 9/282 (3%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           + +  T  EI D +       + ++ +  + A++  ++LLD G IR+A +  +G W  H+
Sbjct: 4   LQLKKTQSEIKDIWKNREKFNDCNLKKTARIAIKEVIELLDSGKIRVAEKLSSGEWVVHK 63

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           WIK+AILL F     KII + N    W+DKI  KF +W  + F +   R +PG  VR SA
Sbjct: 64  WIKQAILLHFLTEENKIIDNTN---CWFDKIGNKFSEWNEEKFRRLKIRAVPGCFVRRSA 120

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YIG   VLMPSF+N+GAY+  G+MIDTWST+GSCAQIGKN HISGGVGIGGVLEPIQ  P
Sbjct: 121 YIGTNVVLMPSFINVGAYVDSGTMIDTWSTIGSCAQIGKNCHISGGVGIGGVLEPIQASP 180

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
            IIEDNCFIGARSE+ EG ++REGSVLG+GVFIG STKIIDR T ++ YGEVP YSVVVP
Sbjct: 181 VIIEDNCFIGARSEVAEGVVVREGSVLGIGVFIGASTKIIDRETSKVFYGEVPPYSVVVP 240

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           GS PS   K +I+    YCAVI+KKVDEKTRSK SIN +LRD
Sbjct: 241 GSIPS---KNNIS---TYCAVIVKKVDEKTRSKISINEILRD 276


>gi|219871455|ref|YP_002475830.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus parasuis SH0165]
 gi|219691659|gb|ACL32882.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus parasuis SH0165]
          Length = 274

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 155/281 (55%), Positives = 200/281 (71%), Gaps = 17/281 (6%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +L+ II++ FE    + E  P+ V    + AV+  +  LD G +R+A + D G W  +QW
Sbjct: 2   SLQAIIEAAFER---RAEITPKTVDAQTRAAVEEVIKGLDNGSLRVAEKID-GEWVVNQW 57

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF+IN  +II DG   + ++DK+P K+ ++  + F+    R +PG +VR  ++
Sbjct: 58  VKKAVLLSFRINENEII-DG-AETKYYDKVPTKYGEYSEEQFKADGIRAVPGAVVRQGSH 115

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I    VLMPSFVN+GAY+GEG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PT
Sbjct: 116 IEKNVVLMPSFVNIGAYVGEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPT 175

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           II DNCFIGARSEIVEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV G
Sbjct: 176 IIGDNCFIGARSEIVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSG 235

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S P+ +      G H LYCAVI+KKVD KT  K  +N LLR
Sbjct: 236 SLPAKD------GSHSLYCAVIVKKVDAKTLGKVGLNDLLR 270


>gi|229462847|sp|Q73H59|DAPD_WOLPM RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
          Length = 273

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 162/277 (58%), Positives = 198/277 (71%), Gaps = 9/277 (3%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           T  EI D +       + ++ +  + A++  ++LLD G IR+A +  +G W  H+WIK+A
Sbjct: 6   TQSEIKDIWKNREKFNDCNLKKTARIAIKEVIELLDSGKIRVAEKLSSGEWVVHKWIKQA 65

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           ILL F     KII + N    W+DKI  KF +W  + F +   R +PG  VR SAYIG  
Sbjct: 66  ILLHFLTEENKIIDNTN---CWFDKIGNKFSEWNEEKFRRLKIRAVPGCFVRRSAYIGTN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPSF+N+GAY+  G+MIDTWST+GSCAQIGKN HISGGVGIGGVLEPIQ  P IIED
Sbjct: 123 VVLMPSFINVGAYVDSGTMIDTWSTIGSCAQIGKNCHISGGVGIGGVLEPIQASPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+ EG ++REGSVLG+GVFIG STKIIDR T ++ YGEVP YSVVVPGS PS
Sbjct: 183 NCFIGARSEVAEGVVVREGSVLGIGVFIGASTKIIDRETSKVFYGEVPPYSVVVPGSIPS 242

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              K +I+    YCAVI+KKVDEKTRSK SIN +LRD
Sbjct: 243 ---KNNIS---TYCAVIVKKVDEKTRSKISINEILRD 273


>gi|88857980|ref|ZP_01132622.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Pseudoalteromonas tunicata D2]
 gi|88819597|gb|EAR29410.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Pseudoalteromonas tunicata D2]
          Length = 275

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 149/281 (53%), Positives = 202/281 (71%), Gaps = 13/281 (4%)

Query: 5   VSTLEEIIDSFFEESNSKNESI--PQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +S L+ II+  +E  +  N +   PQ VKDA+   L+LLD G  R+A +  +  W  HQW
Sbjct: 1   MSNLKLIIEQAWENRDQINPTTVDPQ-VKDAIIEALNLLDSGAARVAEKISD-EWVVHQW 58

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF+I   + + DG   + ++DK+P KF D+  + F++   R++P  + R  ++
Sbjct: 59  LKKAVLLSFRIRDNQAMHDG--VNQFYDKVPLKFSDYTPEQFKEGGMRVVPNAVARKGSF 116

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           IG   VLMPS+VN+GAY+ +G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PT
Sbjct: 117 IGKNVVLMPSYVNIGAYVDDGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPT 176

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSEIVEG I+ +G+V+ MGV+I +ST+I DR TGE  +G VP+ +VVVPG
Sbjct: 177 IIEDNCFIGARSEIVEGVIVEQGAVISMGVYISQSTRIYDRETGETHFGRVPAGAVVVPG 236

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S PS +      G H LY A+I+KKVD++TR K  IN LLR
Sbjct: 237 SIPSSD------GTHSLYAAIIVKKVDQQTREKVGINALLR 271


>gi|253998644|ref|YP_003050707.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Methylovorus sp. SIP3-4]
 gi|313200717|ref|YP_004039375.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n-succinyltransferase
           [Methylovorus sp. MP688]
 gi|253985323|gb|ACT50180.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylovorus sp. SIP3-4]
 gi|312440033|gb|ADQ84139.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylovorus sp. MP688]
          Length = 275

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 158/280 (56%), Positives = 200/280 (71%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASR-DDNGHWNTHQW 62
           +S L+ II+  FE  ++    +   +VKDAV S L  LD G +R+A R  D   W THQW
Sbjct: 1   MSQLQAIIEDAFERRADITPATATAEVKDAVFSVLADLDAGKLRVAERVGDTQEWTTHQW 60

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF++    ++ DG   + ++DK+P KF ++   DF+   FR++P  IVR  +Y
Sbjct: 61  IKKAVLLSFRLEDNVLLDDG--VTKYFDKVPPKFANYTEADFKAGGFRVVPNAIVRRGSY 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   AVLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEPIQ GPT
Sbjct: 119 IAKNAVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPIQAGPT 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           II DNCFIGARSE+VEG ++ +  V+ MGV+IG+STKI DR TG ITYG VP+ SVVV G
Sbjct: 179 IIGDNCFIGARSEVVEGVVVEDNCVISMGVYIGQSTKIYDRETGSITYGRVPAGSVVVSG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           + PS +         LYCAVI+KKVD KT  K  IN LLR
Sbjct: 239 NLPSKD-----GSYSLYCAVIVKKVDAKTLGKVGINELLR 273


>gi|71277820|ref|YP_268290.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Colwellia psychrerythraea 34H]
 gi|82592815|sp|Q485H5|DAPD_COLP3 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|71143560|gb|AAZ24033.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Colwellia psychrerythraea 34H]
          Length = 279

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 153/286 (53%), Positives = 204/286 (71%), Gaps = 11/286 (3%)

Query: 2   ITIVSTLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +T +  L  +I+  FEE  S +  ++  ++K+AV   L  L+ G  R+A + D G W+ +
Sbjct: 1   MTDLKHLASVIEQAFEERASISPATVSSEIKNAVLDALAALNNGSARVAEKVD-GSWHVN 59

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+I   ++I DG   ST++DK+P K++ +    FE    R++PG  VR  
Sbjct: 60  QWLKKAVLLSFRIWDNQVI-DG-AESTFFDKVPMKYEGYTQAMFEADGVRVVPGASVRTG 117

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           ++IG   V+MPSFVN+GA++ EG M+D W+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q G
Sbjct: 118 SFIGKNVVVMPSFVNIGAFVDEGCMVDAWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAG 177

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSEIVEG I+ EG+V+ MGV+IG+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 178 PTIIEDNCFIGARSEIVEGVIVEEGAVISMGVYIGQSTRIFDRETGEVHYGRVPAGSVVV 237

Query: 241 PGSYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLRDYS 285
           PG+ PS        G + LY A+I+KKVD KT +K  IN LLR  S
Sbjct: 238 PGNLPS------ACGTYSLYAAIIVKKVDAKTLAKVGINELLRAVS 277


>gi|254362937|ref|ZP_04979003.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Mannheimia haemolytica PHL213]
 gi|261492758|ref|ZP_05989306.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495628|ref|ZP_05992074.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153094585|gb|EDN75399.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Mannheimia haemolytica PHL213]
 gi|261308735|gb|EEY09992.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261311611|gb|EEY12766.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 274

 Score =  299 bits (765), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 153/278 (55%), Positives = 200/278 (71%), Gaps = 11/278 (3%)

Query: 7   TLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  +    +++  + K AV+  +  LD G +R+A + D G W  +QW+KK
Sbjct: 2   SLQAIIEAAFERRAEITPKTVDAETKAAVEEVIAGLDNGSLRVAEKKD-GEWVVNQWVKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   +II DG   + ++DK+P K+ ++  + F+    R +PG +VR  ++I  
Sbjct: 61  AVLLSFRIADNEII-DG-AETKFYDKVPTKYGNYTEEQFKADGIRAVPGAVVRKGSHIEK 118

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+GEG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTII 
Sbjct: 119 NVVLMPSFVNIGAYVGEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIG 178

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ +  V+ MGVFIG+STKI DR TGE+ YG VP+ SVVV GS P
Sbjct: 179 DNCFIGARSEIVEGVIVEDNCVISMGVFIGQSTKIYDRETGEVHYGRVPAGSVVVSGSLP 238

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+KKVDEKT SK  +N LLR
Sbjct: 239 SKD------GSHNLYCAVIVKKVDEKTLSKVGLNDLLR 270


>gi|238022470|ref|ZP_04602896.1| hypothetical protein GCWU000324_02378 [Kingella oralis ATCC 51147]
 gi|237867084|gb|EEP68126.1| hypothetical protein GCWU000324_02378 [Kingella oralis ATCC 51147]
          Length = 273

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 159/278 (57%), Positives = 204/278 (73%), Gaps = 10/278 (3%)

Query: 7   TLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L++II++ FE  +     ++  +VK+AV  T+  LD G +R+A R   G W  ++W KK
Sbjct: 2   SLQQIIETAFENRAEITPANVQPEVKEAVLETMRQLDNGSLRVAERRGVGDWLVNEWAKK 61

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+I   ++  DG   + ++DK+P KF +W   DF+   FR +PG I R  +++  
Sbjct: 62  AVLLSFRIQDNELADDG--VNRYFDKVPTKFANWSQADFQAAGFRAVPGAIARRGSFVAK 119

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVLMPS+VN+GAY+ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 120 NAVLMPSYVNIGAYVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIE 179

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG ++ EGSV+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS P
Sbjct: 180 DNCFIGARSEIVEGVVVEEGSVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGSLP 239

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S +      G H LYCAVI+KKVD KTR+KTS+N LLR
Sbjct: 240 SKD------GSHSLYCAVIVKKVDAKTRAKTSVNELLR 271


>gi|114321018|ref|YP_742701.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311388|sp|Q0A7H6|DAPD_ALHEH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|114227412|gb|ABI57211.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 272

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 156/277 (56%), Positives = 204/277 (73%), Gaps = 11/277 (3%)

Query: 8   LEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++ I++ FE     +  S P  V++AV+  L +LDRG  R+A + D G W  ++W+KKA
Sbjct: 4   LKQTIETAFENRGELSPASAPAAVREAVEQALAMLDRGEARVAEKRD-GDWVVNEWLKKA 62

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++N  +II    G + ++DK+P KF D  ++       R++P  + R  AYIGP 
Sbjct: 63  VLLSFRLNDNEIIR--GGATNFFDKVPLKFADTNSEQMRASGVRVVPPAMARRGAYIGPG 120

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 121 AVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIED 180

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ EG+V+ MGV+IG+STKI +R TGE+TYG VP  +VVVPGS P+
Sbjct: 181 NCFIGARSEVVEGVIVEEGAVISMGVYIGQSTKIYNRETGEVTYGRVPKGAVVVPGSLPA 240

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVIIK+VD +TRSK  IN LLR
Sbjct: 241 KD------GSHSLYCAVIIKQVDAQTRSKVGINELLR 271


>gi|323526500|ref|YP_004228653.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia sp. CCGE1001]
 gi|323383502|gb|ADX55593.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia sp. CCGE1001]
          Length = 275

 Score =  298 bits (764), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 151/277 (54%), Positives = 205/277 (74%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P DV++AV   ++ LD+G++R+A + D G W  +QW+KKA
Sbjct: 5   LQQIIDTAWENRAELSPKAAPSDVREAVAHAIEQLDKGLLRVAEKKD-GDWVVNQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +S G GYS ++DK+P+KF  +  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMSAG-GYSQFYDKVPSKFASYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|1169221|sp|P41396|DAPD_ACTPL RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|38947|emb|CAA44883.1| tetrahydrodipicolinate N-succinyltransferase [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 274

 Score =  298 bits (764), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 151/277 (54%), Positives = 196/277 (70%), Gaps = 9/277 (3%)

Query: 7   TLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  +    +++  + + A++  ++ LD G  R+A + D G W THQW+KK
Sbjct: 2   SLQAIIEAAFERRAEITPKTVDAETRAAIEEVIEGLDSGKYRVAEKID-GEWVTHQWLKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+IN  +II DG   + ++DK+  KF D+  + F +  FR++P   VR  AYI  
Sbjct: 61  AVLLSFRINDNQII-DG-AETKYYDKVALKFADYTEERFAQEGFRVVPSATVRKGAYISK 118

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPS+VN+GAY+GEG+M+DTW+TVGS  QIGKNVH+SGGVGIGGVLEP+Q  PTII 
Sbjct: 119 NCVLMPSYVNIGAYVGEGTMVDTWATVGSSRQIGKNVHLSGGVGIGGVLEPLQANPTIIG 178

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+ +G V+ MGVFIG+ST+I DR TGEI YG VP+ SVVV GS P
Sbjct: 179 DNCFIGARSEVVEGVIVEDGCVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVVSGSLP 238

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 239 S-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 270


>gi|300704243|ref|YP_003745846.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ralstonia solanacearum CFBP2957]
 gi|299071907|emb|CBJ43236.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ralstonia solanacearum CFBP2957]
          Length = 275

 Score =  298 bits (764), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 149/276 (53%), Positives = 208/276 (75%), Gaps = 8/276 (2%)

Query: 8   LEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+ +I+  +E+ +N   ++ P+D++ AV + +  LD+G +R+A + D G W  +QW+KKA
Sbjct: 5   LQSLIEQAWEDRANLSPKAAPEDIRAAVANVIGQLDQGALRVAEKKD-GQWIVNQWVKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     ++ G G++ ++DK+P+KF  +   DF +  FR++P  + R  ++IG  
Sbjct: 64  VLLSFRLEDNAPMTAG-GFTHFYDKVPSKFASYTADDFARGGFRVVPPAVARRGSFIGKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 AVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+ YG VP+ SVVVPG+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVHYGRVPAGSVVVPGNLPS 242

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            + K       LYCAVI+KKVD +TR+KTS+N LLR
Sbjct: 243 KDGK-----YSLYCAVIVKKVDAQTRAKTSLNELLR 273


>gi|296101334|ref|YP_003611480.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295055793|gb|ADF60531.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 274

 Score =  298 bits (764), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 161/282 (57%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + E  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIESAFER---RAEITPANVDTVTREAVNQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|148244246|ref|YP_001218940.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Candidatus Vesicomyosocius okutanii HA]
 gi|146326073|dbj|BAF61216.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Candidatus Vesicomyosocius okutanii HA]
          Length = 271

 Score =  298 bits (763), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 196/276 (71%), Gaps = 8/276 (2%)

Query: 8   LEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           +++II+  FE+ +N   +++   VK AV   + LLD G  RIA +   G+W  ++W+KKA
Sbjct: 1   MKDIIEKAFEDRANLNPQTVNVKVKQAVTDAIHLLDSGKARIAQQKSIGNWKVNEWLKKA 60

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     I    G++ ++DK+P+KF D    +F K   RI+P    R+ ++I   
Sbjct: 61  VLLSFRLEEN--IPMQGGFTQYFDKVPSKFADMSINEFNKAGIRIVPPASARYGSFIAKN 118

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            V+MPS+VN+GAY+  G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 119 TVMMPSYVNIGAYVDSGTMIDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIED 178

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSEIVEG II E +V+ MGV+IG+STKI +R T +ITYG +P+ SVVVPG+ PS
Sbjct: 179 NCFIGARSEIVEGVIIEESAVISMGVYIGQSTKIFNRKTNKITYGRIPAGSVVVPGNLPS 238

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            +         LYCAVI+K+VD KTR K  IN LLR
Sbjct: 239 KD-----GTYSLYCAVIVKQVDAKTRYKIGINELLR 269


>gi|330817449|ref|YP_004361154.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia gladioli BSR3]
 gi|327369842|gb|AEA61198.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia gladioli BSR3]
          Length = 275

 Score =  298 bits (763), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 205/277 (74%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P +V++AV   ++ LDRG +R+A +  NG W  HQW+KKA
Sbjct: 5   LQQIIDTAWENRAELSPKAAPAEVREAVAHAIEQLDRGSLRVAEKQ-NGEWIVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     ++ G GYS ++DK+P+KF ++  +DF    FR++P  + R  ++I   
Sbjct: 64  VLLSFRLEDNAPMAAG-GYSQFFDKVPSKFANYTAEDFAAGGFRVVPPAVARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGEI+YG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEISYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|171059197|ref|YP_001791546.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Leptothrix cholodnii SP-6]
 gi|226724177|sp|B1Y6E5|DAPD_LEPCP RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|170776642|gb|ACB34781.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Leptothrix cholodnii SP-6]
          Length = 274

 Score =  298 bits (763), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 152/278 (54%), Positives = 203/278 (73%), Gaps = 8/278 (2%)

Query: 6   STLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           S L+++I++ +E+ +N    S P  V++AV   L  LD G IR+A R   G W  +QW+K
Sbjct: 3   SQLQQVIEAAWEDRANLSVASAPAAVREAVAHVLGELDAGRIRVAERQAVGQWQVNQWVK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF++N   ++  G+G  T++DK+P+KF             R++P  + R  ++I 
Sbjct: 63  KAVLLSFRLNDNVVM--GDGALTFFDKVPSKFGGMDEAALRATGVRVVPPAVARRGSFIA 120

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
             A+LMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII
Sbjct: 121 RGAILMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTII 180

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEG ++ E SV+ MGV+IG+STKI DR TGE+TYG +PS SVVV G+ 
Sbjct: 181 EDNCFIGARSEVVEGVVVEENSVISMGVYIGQSTKIYDRATGEVTYGRIPSGSVVVSGNL 240

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           PS + K       LYCAVI+K+VD +TR+KTSIN LLR
Sbjct: 241 PSADGK-----YSLYCAVIVKRVDAQTRAKTSINDLLR 273


>gi|118595128|ref|ZP_01552475.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Methylophilales bacterium HTCC2181]
 gi|118440906|gb|EAV47533.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Methylophilales bacterium HTCC2181]
          Length = 275

 Score =  298 bits (763), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 153/280 (54%), Positives = 207/280 (73%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNES-IPQDVKDAVQSTLDLLDRGIIRIASR-DDNGHWNTHQW 62
           ++TL+ II+  FE+ +    S +  +VK+A+  T++ L+ G+ R+ASR +    W THQW
Sbjct: 1   MTTLQSIIEEAFEDRSEITPSNVSSEVKNAINETIEGLNHGVHRVASRIEGTQEWETHQW 60

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF+I     +    GY++++DK+ +KF ++  +DF+   FR++P  +VRH ++
Sbjct: 61  IKKAVLLSFRIEEN--VKLDAGYTSYFDKVKSKFANYSAEDFKTGGFRVVPNAMVRHGSF 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           IG  AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEPIQ GPT
Sbjct: 119 IGKNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPIQAGPT 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           II DNCFIGARSE+VEG ++ +  V+ MGV+IG+STKI DR TGE+T+G +P  SVVV G
Sbjct: 179 IIGDNCFIGARSEVVEGVVVEDNVVISMGVYIGQSTKIYDRETGEVTFGRIPKGSVVVSG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           + PS +         LYCAVI+KKVDEKT  K  IN LLR
Sbjct: 239 NLPSKD-----GAYSLYCAVIVKKVDEKTLGKVGINELLR 273


>gi|78066808|ref|YP_369577.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia sp. 383]
 gi|107028790|ref|YP_625885.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia cenocepacia AU 1054]
 gi|116690051|ref|YP_835674.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia cenocepacia HI2424]
 gi|134296039|ref|YP_001119774.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia vietnamiensis G4]
 gi|170703468|ref|ZP_02894235.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia ambifaria IOP40-10]
 gi|170733385|ref|YP_001765332.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia cenocepacia MC0-3]
 gi|172060977|ref|YP_001808629.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia ambifaria MC40-6]
 gi|206560463|ref|YP_002231227.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia cenocepacia J2315]
 gi|254247874|ref|ZP_04941195.1| Tetrahydrodipicolinate N-succinyltransferase [Burkholderia
           cenocepacia PC184]
 gi|123370094|sp|Q1BHJ3|DAPD_BURCA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|123568175|sp|Q39F33|DAPD_BURS3 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|166224200|sp|A0K8F4|DAPD_BURCH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|166224206|sp|A4JF86|DAPD_BURVG RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724156|sp|B1YSH7|DAPD_BURA4 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724157|sp|B1JUG0|DAPD_BURCC RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724158|sp|B4ECP1|DAPD_BURCJ RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|77967553|gb|ABB08933.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia sp. 383]
 gi|105897954|gb|ABF80912.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia cenocepacia AU 1054]
 gi|116648140|gb|ABK08781.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia cenocepacia HI2424]
 gi|124872650|gb|EAY64366.1| Tetrahydrodipicolinate N-succinyltransferase [Burkholderia
           cenocepacia PC184]
 gi|134139196|gb|ABO54939.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia vietnamiensis G4]
 gi|169816627|gb|ACA91210.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia cenocepacia MC0-3]
 gi|170131625|gb|EDT00186.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia ambifaria IOP40-10]
 gi|171993494|gb|ACB64413.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia ambifaria MC40-6]
 gi|198036504|emb|CAR52401.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia cenocepacia J2315]
          Length = 275

 Score =  298 bits (763), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 205/277 (74%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P DV++AV   ++ LD+G +R+A + D G+W  HQW+KKA
Sbjct: 5   LQQIIDTAWENRAELSPKAAPADVREAVAHAIEQLDKGALRVAEKID-GNWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE++YG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVSYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|187924445|ref|YP_001896087.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia phytofirmans PsJN]
 gi|226724161|sp|B2T5K6|DAPD_BURPP RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|187715639|gb|ACD16863.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia phytofirmans PsJN]
          Length = 275

 Score =  298 bits (762), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 151/277 (54%), Positives = 205/277 (74%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P DV++AV   ++ LD+G++R+A + D G W  +QW+KKA
Sbjct: 5   LQQIIDTAWENRAELSPKAAPADVREAVAHAIEQLDKGLLRVAEKKD-GDWVVNQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|145641154|ref|ZP_01796734.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae R3021]
 gi|145273991|gb|EDK13857.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus influenzae 22.4-21]
          Length = 261

 Score =  298 bits (762), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 148/260 (56%), Positives = 187/260 (71%), Gaps = 8/260 (3%)

Query: 23  NESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDG 82
            +++  + + A++  ++ LD G  R+A +   G W THQW+KKA+LLSF+IN  +II DG
Sbjct: 6   QKTVDAETRAAIEEVIEGLDSGKYRVAEKI-AGEWVTHQWLKKAVLLSFRINDNQII-DG 63

Query: 83  NGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGE 142
              + ++DK+  KF D+  + F +  FR++P   VR  AYI    VLMPS+VN+GAY+GE
Sbjct: 64  -AETKYYDKVALKFADYTEERFTEEGFRVVPSATVRKGAYISKNCVLMPSYVNIGAYVGE 122

Query: 143 GSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCII 202
           G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTII DNCFIGARSE+VEG I+
Sbjct: 123 GTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIGDNCFIGARSEVVEGVIV 182

Query: 203 REGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAV 262
            +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV GS PS           LYCAV
Sbjct: 183 EDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSGSLPS-----KCGKYSLYCAV 237

Query: 263 IIKKVDEKTRSKTSINTLLR 282
           I+KKVD KT  K  IN LLR
Sbjct: 238 IVKKVDAKTLGKVGINELLR 257


>gi|113868045|ref|YP_726534.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Ralstonia eutropha H16]
 gi|123133946|sp|Q0KA05|DAPD_RALEH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|113526821|emb|CAJ93166.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ralstonia eutropha H16]
          Length = 275

 Score =  298 bits (762), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 152/280 (54%), Positives = 204/280 (72%), Gaps = 8/280 (2%)

Query: 4   IVSTLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L+ +ID  +E+  S + +S P D+++AV + +  LD G +R+A +     W  +QW
Sbjct: 1   MTQALQALIDQAWEDRTSLSPKSAPNDIREAVANVISQLDSGALRVAEKQGK-DWIVNQW 59

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF++     +S G G++ ++DK+P KF +W   DF K  FR++P  + R  ++
Sbjct: 60  IKKAVLLSFRLEDNAPMSAG-GFAQFYDKVPTKFANWSADDFAKAGFRVVPPAVARRGSF 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P 
Sbjct: 119 IAKNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPV 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGEI YG VP+ SVVV G
Sbjct: 179 IIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEIHYGRVPAGSVVVAG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           + PS + K       LYCAVI+KKVD +TR+KTS+N LLR
Sbjct: 239 NLPSKDGK-----YSLYCAVIVKKVDAQTRAKTSLNDLLR 273


>gi|299067447|emb|CBJ38646.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ralstonia solanacearum CMR15]
          Length = 275

 Score =  298 bits (762), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 149/276 (53%), Positives = 206/276 (74%), Gaps = 8/276 (2%)

Query: 8   LEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+ +I+  +E+ +N   ++ P DV+ AV + +  LD+G +R+A + D G W  +QW+KKA
Sbjct: 5   LQSLIEQAWEDRANLSPKAAPDDVRAAVATVIGQLDQGALRVAEKKD-GQWIVNQWVKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     ++ G G++ ++DK+P+KF  +   DF +  FR++P  + R  ++IG  
Sbjct: 64  VLLSFRLEDNAPMTAG-GFTHFYDKVPSKFASYTADDFARGGFRVVPPAVARRGSFIGKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 AVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+ YG VP+ SVVVPG+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVHYGRVPAGSVVVPGNLPS 242

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            +         LYCAVI+KKVD +TR+KTS+N LLR
Sbjct: 243 KD-----GSYSLYCAVIVKKVDAQTRAKTSLNELLR 273


>gi|121998252|ref|YP_001003039.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Halorhodospira halophila SL1]
 gi|121589657|gb|ABM62237.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Halorhodospira halophila SL1]
          Length = 273

 Score =  298 bits (762), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 143/281 (50%), Positives = 196/281 (69%), Gaps = 11/281 (3%)

Query: 4   IVSTLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           + + ++++ID  FE+    N    P ++++AV+  L  LD G  R+A    +G W  ++W
Sbjct: 1   MAAQIQKVIDEAFEQRAQLNPNEAPAEIREAVEEALRRLDSGQARVAEPGADG-WQVNEW 59

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++N  +++    G + ++DK+P KF  W      +   R++P    R  +Y
Sbjct: 60  LKKAVLLSFRLNDNRLMR--GGVTNFFDKVPMKFAGWGEDALRESGVRVVPPAAARRGSY 117

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I P  VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PT
Sbjct: 118 IAPGVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPT 177

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIED+CFIGARSEIVEG  +  G+V+ MGV++G+STKI DR TGE+ +G VP  +VVVPG
Sbjct: 178 IIEDDCFIGARSEIVEGVTVGRGAVISMGVYVGQSTKIYDRTTGEVHFGHVPEGAVVVPG 237

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           + P+ +      G H LYCAVIIK  DEKTR+K  IN LLR
Sbjct: 238 NLPAAD------GSHSLYCAVIIKYADEKTRAKVGINELLR 272


>gi|261344739|ref|ZP_05972383.1| hypothetical protein PROVRUST_05997 [Providencia rustigianii DSM
           4541]
 gi|282567181|gb|EFB72716.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Providencia rustigianii DSM 4541]
          Length = 275

 Score =  298 bits (762), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 159/279 (56%), Positives = 201/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ II+  FE+  S    ++   VK AV  T+ LLD G +R+A +   G W THQW+
Sbjct: 1   MQQLQAIIEQAFEDRASITPNTVSPAVKQAVMDTIALLDSGKLRVAEKI-AGVWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I+  ++I      S ++DK+P KF D+    FE+  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRIHDNQVIEGAE--SRYFDKVPMKFADYDKARFEREGFRVVPPAAVRQGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
              +VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNSVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEIFYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVDEKTR K  IN LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDEKTRGKVGINELLR 271


>gi|254252049|ref|ZP_04945367.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia dolosa AUO158]
 gi|124894658|gb|EAY68538.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia dolosa AUO158]
          Length = 275

 Score =  298 bits (762), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 205/277 (74%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P +V++AV   ++ LDRG +R+A + D G+W  HQW+KKA
Sbjct: 5   LQQIIDNAWENRAELSPKAAPAEVREAVAHAIEQLDRGALRVAEKID-GNWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE++YG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVSYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|229462848|sp|Q5GSI7|DAPD_WOLTR RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
          Length = 273

 Score =  298 bits (762), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 160/271 (59%), Positives = 192/271 (70%), Gaps = 9/271 (3%)

Query: 13  DSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQ 72
           D +   S   N S+ +  +  ++  + LLD G IR+A R  +G W  H WIK+AI L F 
Sbjct: 12  DIWKNRSKLSNRSVKRAARVIIKKVIKLLDSGKIRVAERLSDGKWIVHTWIKQAISLYFL 71

Query: 73  INPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPS 132
              +K+I D  G+  W+DK+  KFD W  ++F +   R +PG  VR SAY+G   VLMPS
Sbjct: 72  TEESKMI-DHTGW--WFDKVNNKFDGWNEEEFHQSKIRAVPGCFVRQSAYVGTNVVLMPS 128

Query: 133 FVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGA 192
           F+N+GAYI  G+MIDTWST+GSCAQIGKN H+SGGVGIGGVLEPIQ  P IIEDNCFIGA
Sbjct: 129 FINVGAYISSGTMIDTWSTIGSCAQIGKNCHVSGGVGIGGVLEPIQASPVIIEDNCFIGA 188

Query: 193 RSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGD 252
           RSE+ EG IIREGSVLGMGVFIG STKIIDR T ++ YGEVP YSVVVPGS  S N    
Sbjct: 189 RSEVAEGVIIREGSVLGMGVFIGASTKIIDRETNKVFYGEVPPYSVVVPGSTLSAN---- 244

Query: 253 IAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
                +YCA+I+KKVDEKTR KTSIN +LRD
Sbjct: 245 --NISIYCAIIVKKVDEKTRQKTSINEILRD 273


>gi|212710400|ref|ZP_03318528.1| hypothetical protein PROVALCAL_01461 [Providencia alcalifaciens DSM
           30120]
 gi|212686982|gb|EEB46510.1| hypothetical protein PROVALCAL_01461 [Providencia alcalifaciens DSM
           30120]
          Length = 275

 Score =  298 bits (762), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 159/279 (56%), Positives = 201/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ II+  FE+  S    ++   VK AV  T+ LLD G +R+A +   G W THQW+
Sbjct: 1   MQQLQAIIEQAFEDRASITPNTVTPAVKQAVTETIALLDSGKLRVAEKI-GGVWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I+  ++I      S ++DK+P KF D+    FE+  FR++P   VR  AYI
Sbjct: 60  KKAVLLSFRIHDNQVIEGAE--SRYFDKVPMKFADYDKARFEREGFRVVPPAAVRQGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
              +VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNSVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEIFYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVDEKTR K  IN LLR
Sbjct: 238 LPSKD-----GSYSLYCAVIVKKVDEKTRGKVGINELLR 271


>gi|157962707|ref|YP_001502741.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shewanella pealeana ATCC 700345]
 gi|189082822|sp|A8H6L9|DAPD_SHEPA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|157847707|gb|ABV88206.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella pealeana ATCC 700345]
          Length = 274

 Score =  297 bits (761), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 149/282 (52%), Positives = 197/282 (69%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLD----LLDRGIIRIASRDDNGHWNTH 60
           +  L + I++ FE   ++ E  P  V+ +V++ ++    +LD G  R+A +  NG W+ H
Sbjct: 1   MEALRQRIEAAFE---ARAEITPATVEPSVRADVEKAIAMLDTGEARVAEKI-NGEWHVH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+I    +I      + ++DK+P KF D+    F K   R++P   VR  
Sbjct: 57  QWLKKAVLLSFRIFDNGVIEGAE--TKYFDKVPMKFADYDEARFRKEAIRVVPPAAVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           ++IG   VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q G
Sbjct: 115 SFIGKNTVLMPSYVNLGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAG 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSEIVEG I+ EGSV+ MGV+IG+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTRIFDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS           LY A+I+KKVD KTR K  IN LLR
Sbjct: 235 AGNLPS-----KCGTYSLYAAIIVKKVDAKTRGKVGINELLR 271


>gi|167854858|ref|ZP_02477635.1| 3-dehydroquinate dehydratase [Haemophilus parasuis 29755]
 gi|167854037|gb|EDS25274.1| 3-dehydroquinate dehydratase [Haemophilus parasuis 29755]
          Length = 274

 Score =  297 bits (761), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 155/281 (55%), Positives = 199/281 (70%), Gaps = 17/281 (6%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +L+ II++ FE    + E  P+ V    + AV+  +  LD G +R+A + D G W  +QW
Sbjct: 2   SLQAIIEAAFER---RAEITPKTVDAQTRAAVEEVIKGLDNGSLRVAEKID-GEWVVNQW 57

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF+IN  +II DG   + ++DK+P K+  +  + F+    R +PG +VR  ++
Sbjct: 58  VKKAVLLSFRINDNEII-DG-AETKYYDKVPTKYGKYSEEQFKADGIRAVPGAVVRQGSH 115

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I    VLMPSFVN+GAY+GEG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PT
Sbjct: 116 IEKNVVLMPSFVNIGAYVGEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPT 175

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           II DNCFIGARSEIVEG I+ +G V+ MGVFIG+STKI DR TGEI YG VP+ SVVV G
Sbjct: 176 IIGDNCFIGARSEIVEGVIVEDGCVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVVSG 235

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           S P+ +      G H LYCAVI+KKVD KT  K  +N LLR
Sbjct: 236 SLPAKD------GSHSLYCAVIVKKVDAKTLGKVGLNDLLR 270


>gi|153876275|ref|ZP_02003679.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Beggiatoa sp. PS]
 gi|152067261|gb|EDN66321.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Beggiatoa sp. PS]
          Length = 243

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 143/247 (57%), Positives = 186/247 (75%), Gaps = 8/247 (3%)

Query: 37  TLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKF 96
           TLDLLD+G +R+A +   G W  +QW+KKA+LLSF++N    I    G++ ++DK+ +KF
Sbjct: 4   TLDLLDQGTLRVAEKQ-QGQWVVNQWVKKAVLLSFRLNDNDFIE--GGFTNYYDKVSSKF 60

Query: 97  DDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCA 156
            D  ++DF +   R++P   VR+ AYI    VLMPS+VN+GAY+  G+M+DTW+TVGSCA
Sbjct: 61  ADISSRDFREMGVRVVPPATVRNGAYIASGVVLMPSYVNIGAYVDSGTMVDTWATVGSCA 120

Query: 157 QIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGK 216
           QIGKNVH+SGGVGIGGVLEP+Q  PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+
Sbjct: 121 QIGKNVHLSGGVGIGGVLEPLQATPTIIEDNCFIGARSEVVEGVIVGEGSVISMGVYIGQ 180

Query: 217 STKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTS 276
           ST+I +R T EI+YG +P  SVVV G+ PS + K       LYCAVI+K+VDEKTR K  
Sbjct: 181 STRIYNRQTEEISYGYIPPGSVVVSGNLPSKDGK-----YSLYCAVIVKQVDEKTRGKVG 235

Query: 277 INTLLRD 283
           +N LLRD
Sbjct: 236 LNELLRD 242


>gi|146310368|ref|YP_001175442.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Enterobacter sp. 638]
 gi|167012027|sp|A4W6R1|DAPD_ENT38 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|145317244|gb|ABP59391.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Enterobacter sp. 638]
          Length = 274

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 161/282 (57%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIESAFER---RADITPANVDTVTREAVNQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFVKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTRSK  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRSKVGINELLR 271


>gi|58584706|ref|YP_198279.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58419022|gb|AAW71037.1| Tetrahydrodipicolinate N-succinyltransferase [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 276

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 160/274 (58%), Positives = 194/274 (70%), Gaps = 9/274 (3%)

Query: 10  EIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILL 69
           ++ D +   S   N S+ +  +  ++  + LLD G IR+A R  +G W  H WIK+AI L
Sbjct: 12  DVEDIWKNRSKLSNRSVKRAARVIIKKVIKLLDSGKIRVAERLSDGKWIVHTWIKQAISL 71

Query: 70  SFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVL 129
            F    +K+I D  G+  W+DK+  KFD W  ++F +   R +PG  VR SAY+G   VL
Sbjct: 72  YFLTEESKMI-DHTGW--WFDKVNNKFDGWNEEEFHQSKIRAVPGCFVRQSAYVGTNVVL 128

Query: 130 MPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCF 189
           MPSF+N+GAYI  G+MIDTWST+GSCAQIGKN H+SGGVGIGGVLEPIQ  P IIEDNCF
Sbjct: 129 MPSFINVGAYISSGTMIDTWSTIGSCAQIGKNCHVSGGVGIGGVLEPIQASPVIIEDNCF 188

Query: 190 IGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINL 249
           IGARSE+ EG IIREGSVLGMGVFIG STKIIDR T ++ YGEVP YSVVVPGS  S N 
Sbjct: 189 IGARSEVAEGVIIREGSVLGMGVFIGASTKIIDRETNKVFYGEVPPYSVVVPGSTLSAN- 247

Query: 250 KGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
                   +YCA+I+KKVDEKTR KTSIN +LRD
Sbjct: 248 -----NISIYCAIIVKKVDEKTRQKTSINEILRD 276


>gi|168245058|ref|ZP_02669990.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|194449938|ref|YP_002044203.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|226724192|sp|B4TK41|DAPD_SALHS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|194408242|gb|ACF68461.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|205336149|gb|EDZ22913.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
          Length = 274

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 205/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RADITPANVDTVTREAVNQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG G S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-GESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|119898296|ref|YP_933509.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Azoarcus sp. BH72]
 gi|166224195|sp|A1K717|DAPD_AZOSB RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|119670709|emb|CAL94622.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Azoarcus sp. BH72]
          Length = 273

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 153/276 (55%), Positives = 200/276 (72%), Gaps = 9/276 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID  FE  ++    + P  V+DAV   +  LD G +R+A + D G W  +QWIKKA
Sbjct: 4   LQKIIDDAFENRASLSPAAAPAAVRDAVAEVIAGLDAGTLRVAEKKD-GQWVVNQWIKKA 62

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +L+SF++   ++I  G     ++DK+P KF D+  + F++  FR++P  + R  +YI   
Sbjct: 63  VLISFRLRDNEVIPAGG--LNFFDKVPTKFGDYTPEQFQQGGFRVVPPAVARKGSYIAKN 120

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GP IIED
Sbjct: 121 VVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQAGPVIIED 180

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           N F+GARSE+VEG II E +VL MGV+IG+STKI DR TG ITYG VP+ +VVVPGS PS
Sbjct: 181 NVFVGARSEVVEGVIIEENAVLSMGVYIGQSTKIYDRETGSITYGRVPAGAVVVPGSLPS 240

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            + K       LYCAVI+KKVD +TR+KT IN LLR
Sbjct: 241 ADGK-----YSLYCAVIVKKVDAQTRAKTGINELLR 271


>gi|21672504|ref|NP_660571.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Buchnera aphidicola str. Sg (Schizaphis graminum)]
 gi|22654235|sp|O85290|DAPD_BUCAP RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|21623124|gb|AAM67782.1| 2,3,4,5-tetrahydropyridine-2-carboxylate n-succinyltransferase
           [Buchnera aphidicola str. Sg (Schizaphis graminum)]
          Length = 273

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 147/275 (53%), Positives = 199/275 (72%), Gaps = 9/275 (3%)

Query: 10  EIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAIL 68
           +II++ + + N  N ++I  + K  +   ++LL+ G IR+A + DN  W T+QWIKK+IL
Sbjct: 6   DIIENAYLKKNEVNTKNIDIETKQTIHHVIELLNSGKIRVAEKKDN-IWITNQWIKKSIL 64

Query: 69  LSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAV 128
           L   +N   +      +S ++DKIP K++++  K F++   R++P   +R+ ++I    +
Sbjct: 65  LYMYLNQNNVFQGS--FSNYYDKIPLKYENYNEKKFKEERIRVVPPATIRYGSFINSNTI 122

Query: 129 LMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNC 188
           +MPS+VN+GAY+ +G+MIDTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIEDNC
Sbjct: 123 IMPSYVNIGAYVDQGTMIDTWTTVGSCAQIGKNVHLSGGVGIGGVLEPLQNNPTIIEDNC 182

Query: 189 FIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSIN 248
           FIGARSEIVEG II EGSV+ MGVFIG+STKI +R TGEI YG VP+ SVVV GS PS +
Sbjct: 183 FIGARSEIVEGVIIEEGSVISMGVFIGQSTKIYNRETGEILYGRVPANSVVVSGSLPSKD 242

Query: 249 LKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            K +     LY AVI+K+VD KT +K  IN LLRD
Sbjct: 243 RKYN-----LYAAVIVKRVDSKTLNKVEINQLLRD 272


>gi|270264823|ref|ZP_06193087.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Serratia odorifera 4Rx13]
 gi|270041121|gb|EFA14221.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Serratia odorifera 4Rx13]
          Length = 274

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIESAFER---RADITPANVDTVTREAVNQVIGLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  K++ DG   + ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNKVM-DG-AETRYYDKVPMKFADYDEARFQKEGFRVVPPATVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTRSK  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRSKVGINELLR 271


>gi|295098659|emb|CBK87749.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 274

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 160/282 (56%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIESAFER---RADITPANVDTVTREAVNQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|161524420|ref|YP_001579432.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia multivorans ATCC 17616]
 gi|189350825|ref|YP_001946453.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia multivorans ATCC 17616]
 gi|221198334|ref|ZP_03571380.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia multivorans CGD2M]
 gi|221208273|ref|ZP_03581277.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia multivorans CGD2]
 gi|221215446|ref|ZP_03588410.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia multivorans CGD1]
 gi|226724159|sp|A9AHT0|DAPD_BURM1 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|160341849|gb|ABX14935.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia multivorans ATCC 17616]
 gi|189334847|dbj|BAG43917.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia multivorans ATCC 17616]
 gi|221164630|gb|EED97112.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia multivorans CGD1]
 gi|221171921|gb|EEE04364.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia multivorans CGD2]
 gi|221182266|gb|EEE14667.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia multivorans CGD2M]
          Length = 275

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 205/277 (74%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P +V++AV   ++ LD+G +R+A + D G+W  HQW+KKA
Sbjct: 5   LQQIIDNAWENRAELSPKAAPAEVREAVAHAIEQLDKGALRVAEKID-GNWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGEI+YG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEISYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|255589170|ref|XP_002534861.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase,
           putative [Ricinus communis]
 gi|223524456|gb|EEF27521.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase,
           putative [Ricinus communis]
          Length = 275

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 154/276 (55%), Positives = 201/276 (72%), Gaps = 9/276 (3%)

Query: 9   EEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASR-DDNGHWNTHQWIKKA 66
           + II++ FE+ +N    + P D+K  V S LD LD G +R+ASR  D   W THQWIKKA
Sbjct: 5   QSIIEAAFEDRANINPANAPADIKATVASVLDDLDAGKLRVASRIGDTQQWETHQWIKKA 64

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++    ++ DG   + ++DK+  KF ++  +DF+   FR++P  IVR  ++I   
Sbjct: 65  VLLSFRLKDNYLMDDG--VTRYFDKVDPKFANYTEEDFKAGGFRVVPNAIVRKGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           AVLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTII D
Sbjct: 123 AVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQAGPTIIGD 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCF+GARSE+VEG ++ +  V+ MGV+IG+STKI DR TGEI +G VP+ SVVV G+ PS
Sbjct: 183 NCFVGARSEVVEGVVVEDNCVISMGVYIGQSTKIYDRETGEIHFGRVPAGSVVVSGNLPS 242

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            + K       LYCAVI+KKVD KT  K  IN LLR
Sbjct: 243 SDGK-----YSLYCAVIVKKVDAKTLGKVGINELLR 273


>gi|297717782|gb|ADI50034.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n-succinyltransferase
           [Candidatus Odyssella thessalonicensis L13]
          Length = 271

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 158/276 (57%), Positives = 198/276 (71%), Gaps = 7/276 (2%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           + ++II++ +E   S   S  +DV +AV   L  LD G +R+A +     W  HQWIKKA
Sbjct: 2   SYQDIIEAAWESRQSLT-SENKDVVNAVDHVLTRLDSGQVRVAEKLGQ-EWVVHQWIKKA 59

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           ILLSF++NP ++++ G G + ++DK+P K   W T DF    FR +PGTIVR SA+I   
Sbjct: 60  ILLSFRLNPNQLMA-GLGNTPYYDKVPLKMTGWTTSDFTAAGFRAVPGTIVRRSAFIEKD 118

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPSF+N+GA +G G+M+DTWST+GSCAQIG N HISGGVGIGGVLEP+Q  P IIED
Sbjct: 119 VVLMPSFINVGARVGAGTMVDTWSTIGSCAQIGANCHISGGVGIGGVLEPLQANPVIIED 178

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSEI EG I+ EG+V+ MGVF+G STKI++R TGEITYG VP+YSVVVPG+ P 
Sbjct: 179 NCFIGARSEIAEGVIVEEGAVISMGVFLGASTKIVNRQTGEITYGRVPAYSVVVPGTLPG 238

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
                    P L CAVI+K+VD KTRSK  IN LLR
Sbjct: 239 ATAD----APALACAVIVKQVDAKTRSKVGINELLR 270


>gi|325518133|gb|EGC97917.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia sp. TJI49]
          Length = 275

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 149/277 (53%), Positives = 205/277 (74%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P +V++AV   ++ LD+G +R+A + D G+W  HQW+KKA
Sbjct: 5   LQQIIDTAWENRAELSPKAAPAEVREAVAHAIEQLDKGALRVAEKID-GNWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE++YG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVSYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|240948868|ref|ZP_04753224.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Actinobacillus minor NM305]
 gi|240296683|gb|EER47294.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Actinobacillus minor NM305]
          Length = 274

 Score =  296 bits (759), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 149/278 (53%), Positives = 199/278 (71%), Gaps = 11/278 (3%)

Query: 7   TLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +L+ II++ FE  +    +++  + + A++  +  LD G +R+A + D G W  +QW+KK
Sbjct: 2   SLQAIIEAAFERRAEITPKTVDAETRTAIEEVIKGLDNGSLRVAEKID-GEWVVNQWVKK 60

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF+IN  ++I DG   + ++DK+P K+  +  + F+    R +PG +VR  ++I  
Sbjct: 61  AVLLSFRINDNEVI-DG-AETKYYDKVPTKYGQYTEEQFKADGIRAVPGAVVRQGSHIEK 118

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN+GAY+GEG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTII 
Sbjct: 119 NVVLMPSFVNIGAYVGEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIG 178

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSEIVEG I+ +G V+ MGVFIG+ST+I DR TGEI YG VP+ SVVV GS P
Sbjct: 179 DNCFIGARSEIVEGVIVEDGCVISMGVFIGQSTRIYDRETGEIYYGRVPAGSVVVSGSLP 238

Query: 246 SINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           + +      G H LYCAVI+KKVD KT  K  +N LLR
Sbjct: 239 AKD------GSHSLYCAVIVKKVDAKTLGKVGLNDLLR 270


>gi|254468914|ref|ZP_05082320.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [beta proteobacterium KB13]
 gi|207087724|gb|EDZ65007.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [beta proteobacterium KB13]
          Length = 275

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 154/280 (55%), Positives = 208/280 (74%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNES-IPQDVKDAVQSTLDLLDRGIIRIASR-DDNGHWNTHQW 62
           +S L++II+  FE  +  N S  P+++ DAV   L+ L+ G +R+ASR  D+  W THQW
Sbjct: 1   MSNLQDIIEQGFENRSEINPSNAPKEIVDAVSEVLNKLNSGELRVASRIGDSQDWETHQW 60

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF++   +++  G+  ++++DK+ +KF  +  +DF+   +R++P  I RH ++
Sbjct: 61  IKKAVLLSFRLKDNELMPGGS--TSYFDKVDSKFRHFTEQDFKNGGYRVVPNAIARHGSF 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           IG  AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEPIQ GPT
Sbjct: 119 IGKNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPIQAGPT 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           II DNCFIGARSE+VEG ++ +  V+ MGV+IG+STKI+DR TGEIT+G +P  SVVV G
Sbjct: 179 IIGDNCFIGARSEVVEGVVVEDNVVISMGVYIGQSTKILDRETGEITFGRIPKGSVVVSG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           + PS +         LYCAVI+KKVDEKT  K  IN LLR
Sbjct: 239 NLPSKD-----GSYSLYCAVIVKKVDEKTLGKVGINELLR 273


>gi|152968760|ref|YP_001333869.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|206579536|ref|YP_002240346.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Klebsiella pneumoniae 342]
 gi|238893162|ref|YP_002917896.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Klebsiella pneumoniae NTUH-K2044]
 gi|262044765|ref|ZP_06017811.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|288937052|ref|YP_003441111.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Klebsiella variicola At-22]
 gi|290512473|ref|ZP_06551839.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Klebsiella sp. 1_1_55]
 gi|330001643|ref|ZP_08304069.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Klebsiella sp. MS 92-3]
 gi|166224213|sp|A6T4W8|DAPD_KLEP7 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724176|sp|B5Y1K5|DAPD_KLEP3 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|150953609|gb|ABR75639.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
 gi|206568594|gb|ACI10370.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Klebsiella pneumoniae 342]
 gi|238545478|dbj|BAH61829.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259037877|gb|EEW39102.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC
           13884]
 gi|288891761|gb|ADC60079.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Klebsiella variicola At-22]
 gi|289774814|gb|EFD82816.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Klebsiella sp. 1_1_55]
 gi|328537585|gb|EGF63805.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Klebsiella sp. MS 92-3]
          Length = 274

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIESAFER---RADITPANVDTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEVFYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|307729321|ref|YP_003906545.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia sp. CCGE1003]
 gi|307583856|gb|ADN57254.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia sp. CCGE1003]
          Length = 275

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 204/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P DV++AV   ++ LD+G +R+A + D G W  +QW+KKA
Sbjct: 5   LQQIIDTAWENRAELSPKAAPADVREAVAHAIEQLDKGALRVAEKKD-GDWVVNQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYSAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|300691616|ref|YP_003752611.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ralstonia solanacearum PSI07]
 gi|299078676|emb|CBJ51334.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ralstonia solanacearum PSI07]
          Length = 275

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 149/276 (53%), Positives = 206/276 (74%), Gaps = 8/276 (2%)

Query: 8   LEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+ +I+  +E+ +N   ++ P DV+ AV + +  LD+G +R+A +   G W  +QW+KKA
Sbjct: 5   LQSLIEQAWEDRANLSPKAAPDDVRQAVANVIGQLDQGALRVAEKK-GGQWIVNQWVKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     ++ G G++ ++DK+P+KF  +   DF +  FR++P  + R  ++IG  
Sbjct: 64  VLLSFRLEDNAPMTAG-GFTHFYDKVPSKFASYTADDFARGGFRVVPPAVARRGSFIGRN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 AVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+ YG VP+ SVVVPG+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIFDRETGEVHYGRVPAGSVVVPGNLPS 242

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            + K       LYCAVI+KKVD +TR+KTS+N LLR
Sbjct: 243 KDGK-----YSLYCAVIVKKVDAQTRAKTSLNELLR 273


>gi|187730436|ref|YP_001878967.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shigella boydii CDC 3083-94]
 gi|226724196|sp|B2U308|DAPD_SHIB3 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|187427428|gb|ACD06702.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella boydii CDC 3083-94]
          Length = 274

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREAVNQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|261338836|ref|ZP_05966694.1| hypothetical protein ENTCAN_05032 [Enterobacter cancerogenus ATCC
           35316]
 gi|288318659|gb|EFC57597.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Enterobacter cancerogenus ATCC 35316]
          Length = 274

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 203/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + E  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIESAFER---RAEITPANVDTVTREAVNQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
            +I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 TFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|294665425|ref|ZP_06730712.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succin [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
 gi|292604793|gb|EFF48157.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succin [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 400

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 144/273 (52%), Positives = 189/273 (69%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  D  G W  ++W+KKA+LL 
Sbjct: 132 IESAFERRATLTMDEIDGSTRAIVTRVIDGLESGQFRVAEPDGQGGWTVNEWLKKAVLLY 191

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +   +F K   R++PG + R  +Y G   VLM
Sbjct: 192 FRVNEMAVIDAQP--APFWDKVESRFAGFHEAEFRKAGVRVVPGAVARRGSYFGKDVVLM 249

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 250 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 309

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 310 GARSEVVEGVVIGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 367

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD KTRSKTS+N LLR
Sbjct: 368 ----GSHSLYCAVIVKQVDAKTRSKTSVNELLR 396


>gi|16128159|ref|NP_414708.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|24111601|ref|NP_706111.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shigella flexneri 2a str. 301]
 gi|30061723|ref|NP_835894.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shigella flexneri 2a str. 2457T]
 gi|74310786|ref|YP_309205.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shigella sonnei Ss046]
 gi|89107046|ref|AP_000826.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli str. K-12 substr. W3110]
 gi|110804218|ref|YP_687738.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shigella flexneri 5 str. 8401]
 gi|157156037|ref|YP_001461335.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli E24377A]
 gi|157159631|ref|YP_001456949.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli HS]
 gi|170021481|ref|YP_001726435.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli ATCC 8739]
 gi|170079802|ref|YP_001729122.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|188494977|ref|ZP_03002247.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli 53638]
 gi|191166391|ref|ZP_03028223.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli B7A]
 gi|193063202|ref|ZP_03044293.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli E22]
 gi|193067552|ref|ZP_03048519.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli E110019]
 gi|194428259|ref|ZP_03060801.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli B171]
 gi|194433405|ref|ZP_03065684.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella dysenteriae 1012]
 gi|194439097|ref|ZP_03071179.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli 101-1]
 gi|209917356|ref|YP_002291440.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli SE11]
 gi|218552745|ref|YP_002385658.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli IAI1]
 gi|218693630|ref|YP_002401297.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli 55989]
 gi|238899564|ref|YP_002925360.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli BW2952]
 gi|253774807|ref|YP_003037638.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254037585|ref|ZP_04871662.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia sp. 1_1_43]
 gi|254160285|ref|YP_003043393.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli B str. REL606]
 gi|256021598|ref|ZP_05435463.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shigella sp. D9]
 gi|256025478|ref|ZP_05439343.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia sp. 4_1_40B]
 gi|260842398|ref|YP_003220176.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O103:H2 str. 12009]
 gi|260853376|ref|YP_003227267.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|260866315|ref|YP_003232717.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O111:H- str. 11128]
 gi|291280988|ref|YP_003497806.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O55:H7 str. CB9615]
 gi|293418052|ref|ZP_06660674.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli B185]
 gi|293476823|ref|ZP_06665231.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli B088]
 gi|300816206|ref|ZP_07096429.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 107-1]
 gi|300824111|ref|ZP_07104231.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 119-7]
 gi|300901985|ref|ZP_07120012.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 84-1]
 gi|300919729|ref|ZP_07136215.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 115-1]
 gi|300923042|ref|ZP_07139109.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 182-1]
 gi|300932119|ref|ZP_07147405.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 187-1]
 gi|300949803|ref|ZP_07163776.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 116-1]
 gi|300956048|ref|ZP_07168374.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 175-1]
 gi|301028657|ref|ZP_07191880.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 196-1]
 gi|301305302|ref|ZP_07211398.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 124-1]
 gi|301330036|ref|ZP_07222720.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 78-1]
 gi|301646487|ref|ZP_07246364.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 146-1]
 gi|307136766|ref|ZP_07496122.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli H736]
 gi|307311387|ref|ZP_07591029.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli W]
 gi|309796343|ref|ZP_07690752.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 145-7]
 gi|312970265|ref|ZP_07784447.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli 1827-70]
 gi|331640620|ref|ZP_08341768.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli H736]
 gi|331651071|ref|ZP_08352099.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli M718]
 gi|331666407|ref|ZP_08367288.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli TA271]
 gi|331680745|ref|ZP_08381404.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli H591]
 gi|331681551|ref|ZP_08382188.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli H299]
 gi|332282840|ref|ZP_08395253.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Shigella sp. D9]
 gi|71154177|sp|P0A9D8|DAPD_ECOLI RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|71154178|sp|P0A9D9|DAPD_SHIFL RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|123147268|sp|Q0T843|DAPD_SHIF8 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|123618028|sp|Q3Z5J2|DAPD_SHISS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|167012025|sp|A7ZHQ6|DAPD_ECO24 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|167012026|sp|A7ZWB2|DAPD_ECOHS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|189082814|sp|B1IQH5|DAPD_ECOLC RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724169|sp|B7M1A5|DAPD_ECO8A RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724170|sp|B1XD35|DAPD_ECODH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724172|sp|B6HZE0|DAPD_ECOSE RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|259586142|sp|C4ZRQ8|DAPD_ECOBW RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|1552743|gb|AAB08595.1| tetrahydrodipicolinate N-succinyltransferase [Escherichia coli]
 gi|1786362|gb|AAC73277.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli str. K-12 substr. MG1655]
 gi|21239021|dbj|BAB96742.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli str. K12 substr. W3110]
 gi|24050367|gb|AAN41818.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Shigella flexneri 2a str. 301]
 gi|30039965|gb|AAP15699.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Shigella flexneri 2a str. 2457T]
 gi|73854263|gb|AAZ86970.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Shigella sonnei Ss046]
 gi|110613766|gb|ABF02433.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Shigella flexneri 5 str. 8401]
 gi|157065311|gb|ABV04566.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli HS]
 gi|157078067|gb|ABV17775.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli E24377A]
 gi|169756409|gb|ACA79108.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli ATCC 8739]
 gi|169887637|gb|ACB01344.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli str. K-12 substr. DH10B]
 gi|188490176|gb|EDU65279.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli 53638]
 gi|190903642|gb|EDV63359.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli B7A]
 gi|192931110|gb|EDV83713.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli E22]
 gi|192958964|gb|EDV89400.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli E110019]
 gi|194413634|gb|EDX29914.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli B171]
 gi|194418333|gb|EDX34423.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella dysenteriae 1012]
 gi|194421916|gb|EDX37921.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli 101-1]
 gi|209745890|gb|ACI71252.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli]
 gi|209910615|dbj|BAG75689.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli SE11]
 gi|218350362|emb|CAU96045.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli 55989]
 gi|218359513|emb|CAQ97051.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli IAI1]
 gi|226840691|gb|EEH72693.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia sp. 1_1_43]
 gi|238859742|gb|ACR61740.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli BW2952]
 gi|242375998|emb|CAQ30680.1| tetrahydrodipicolinate succinylase subunit, subunit of
           tetrahydrodipicolinate succinylase [Escherichia coli
           BL21(DE3)]
 gi|253325851|gb|ACT30453.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972186|gb|ACT37857.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli B str. REL606]
 gi|253976395|gb|ACT42065.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli BL21(DE3)]
 gi|257752025|dbj|BAI23527.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O26:H11 str. 11368]
 gi|257757545|dbj|BAI29042.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O103:H2 str. 12009]
 gi|257762671|dbj|BAI34166.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O111:H- str. 11128]
 gi|260450630|gb|ACX41052.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli DH1]
 gi|281599520|gb|ADA72504.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella flexneri 2002017]
 gi|290760861|gb|ADD54822.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O55:H7 str. CB9615]
 gi|291321276|gb|EFE60718.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli B088]
 gi|291430770|gb|EFF03768.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli B185]
 gi|299878326|gb|EFI86537.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 196-1]
 gi|300317112|gb|EFJ66896.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 175-1]
 gi|300405871|gb|EFJ89409.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 84-1]
 gi|300413229|gb|EFJ96539.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 115-1]
 gi|300420669|gb|EFK03980.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 182-1]
 gi|300450801|gb|EFK14421.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 116-1]
 gi|300460130|gb|EFK23623.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 187-1]
 gi|300523388|gb|EFK44457.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 119-7]
 gi|300531413|gb|EFK52475.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 107-1]
 gi|300839407|gb|EFK67167.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 124-1]
 gi|300843947|gb|EFK71707.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 78-1]
 gi|301075313|gb|EFK90119.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 146-1]
 gi|306908366|gb|EFN38864.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli W]
 gi|308120047|gb|EFO57309.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 145-7]
 gi|309700374|emb|CBI99662.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli ETEC H10407]
 gi|310337763|gb|EFQ02874.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli 1827-70]
 gi|313646775|gb|EFS11234.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella flexneri 2a str. 2457T]
 gi|315059384|gb|ADT73711.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli W]
 gi|315134856|dbj|BAJ42015.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylateN- succinyltransferase
           [Escherichia coli DH1]
 gi|315254968|gb|EFU34936.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 85-1]
 gi|315616351|gb|EFU96969.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli 3431]
 gi|320173354|gb|EFW48557.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella dysenteriae CDC 74-1112]
 gi|320200310|gb|EFW74896.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli EC4100B]
 gi|320658286|gb|EFX26015.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320663596|gb|EFX30880.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli O55:H7 str. USDA 5905]
 gi|323157998|gb|EFZ44100.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli EPECa14]
 gi|323160216|gb|EFZ46175.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli E128010]
 gi|323165866|gb|EFZ51648.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella sonnei 53G]
 gi|323170956|gb|EFZ56605.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli LT-68]
 gi|323176479|gb|EFZ62071.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli 1180]
 gi|323181672|gb|EFZ67086.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli 1357]
 gi|323380057|gb|ADX52325.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli KO11]
 gi|323939959|gb|EGB36157.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli E482]
 gi|323945640|gb|EGB41689.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli H120]
 gi|323959926|gb|EGB55573.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli H489]
 gi|323970645|gb|EGB65901.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli TA007]
 gi|324017827|gb|EGB87046.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 117-3]
 gi|324118285|gb|EGC12180.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli E1167]
 gi|331040366|gb|EGI12573.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli H736]
 gi|331051525|gb|EGI23574.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli M718]
 gi|331066618|gb|EGI38495.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli TA271]
 gi|331072208|gb|EGI43544.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli H591]
 gi|331081772|gb|EGI52933.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli H299]
 gi|332095207|gb|EGJ00236.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella boydii 5216-82]
 gi|332098308|gb|EGJ03281.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella dysenteriae 155-74]
 gi|332105192|gb|EGJ08538.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Shigella sp. D9]
 gi|332341498|gb|AEE54832.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           DapD [Escherichia coli UMNK88]
 gi|332762014|gb|EGJ92285.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella flexneri 2747-71]
 gi|332762168|gb|EGJ92437.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella flexneri 4343-70]
 gi|332765012|gb|EGJ95240.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella flexneri K-671]
 gi|332768667|gb|EGJ98847.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella flexneri 2930-71]
 gi|333009302|gb|EGK28758.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella flexneri K-218]
 gi|333010659|gb|EGK30092.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella flexneri VA-6]
 gi|333011003|gb|EGK30422.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella flexneri K-272]
 gi|333021798|gb|EGK41047.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella flexneri K-227]
 gi|333022229|gb|EGK41468.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella flexneri K-304]
          Length = 274

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|190571088|ref|YP_001975446.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|213019608|ref|ZP_03335414.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
 gi|190357360|emb|CAQ54791.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|212995030|gb|EEB55672.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
          Length = 280

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 161/276 (58%), Positives = 198/276 (71%), Gaps = 10/276 (3%)

Query: 8   LEEIIDSFFEESNSKNE-SIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++ I++ +++    N+ ++  + +  ++  ++LLD G IR+A +  +G W  H+WIK++
Sbjct: 13  LQDEIENIWKDKEKLNDYNLKHEARLIIKEVIELLDSGKIRVAEKLSSGEWIVHKWIKQS 72

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           ILL F    +KII + N    W+DKI +KF +W  + F     R +PG  VR SAYIG  
Sbjct: 73  ILLHFLTEESKIIDNTN---CWFDKIGSKFSEWNEEKFYHSKIRAVPGCFVRQSAYIGKN 129

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPSF+N+GAYI  G+MIDTWSTVGSCAQIGKN HISGGVGIGGVLEPIQ  P IIED
Sbjct: 130 VVLMPSFINVGAYIDSGTMIDTWSTVGSCAQIGKNCHISGGVGIGGVLEPIQASPVIIED 189

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+ EG IIREGSVL MGVFIG STKIIDR T ++ YGEVP YSVVVPGS  S
Sbjct: 190 NCFIGARSEVAEGVIIREGSVLSMGVFIGASTKIIDRETNKVFYGEVPPYSVVVPGSTRS 249

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            N          YCAVI+KKVDEKTRSKTSIN +LR
Sbjct: 250 RN------NVSTYCAVIVKKVDEKTRSKTSINEILR 279


>gi|62178783|ref|YP_215200.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|194446468|ref|YP_002039453.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|200389059|ref|ZP_03215671.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205351550|ref|YP_002225351.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|207855730|ref|YP_002242381.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|224582061|ref|YP_002635859.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|71153307|sp|Q57T42|DAPD_SALCH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724190|sp|B5R3H8|DAPD_SALEP RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724191|sp|B5RHF1|DAPD_SALG2 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724193|sp|B4SUZ5|DAPD_SALNS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|254767080|sp|C0Q5S6|DAPD_SALPC RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|62126416|gb|AAX64119.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. SC-B67]
 gi|194405131|gb|ACF65353.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|199606157|gb|EDZ04702.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205271331|emb|CAR36124.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|206707533|emb|CAR31807.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|224466588|gb|ACN44418.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|322713237|gb|EFZ04808.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
 gi|326626576|gb|EGE32919.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
          Length = 274

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 205/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++AV+  + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RADITPANVDTVTREAVKQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|194289803|ref|YP_002005710.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate n-succinyltransferase
           [Cupriavidus taiwanensis LMG 19424]
 gi|226724164|sp|B3R2C8|DAPD_CUPTR RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|193223638|emb|CAQ69645.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Cupriavidus taiwanensis LMG 19424]
          Length = 275

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 151/280 (53%), Positives = 204/280 (72%), Gaps = 8/280 (2%)

Query: 4   IVSTLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L+ +ID  +E+  S + +S P D+++AV + +  LD G +R+A +     W  +QW
Sbjct: 1   MTQALQALIDQAWEDRTSLSPKSAPNDIREAVANVIGQLDAGTLRVAEKQGK-DWIVNQW 59

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++     +S G G++ ++DK+P KF +W   DF K  FR++P  + R  ++
Sbjct: 60  VKKAVLLSFRLEDNAPMSAG-GFAQFYDKVPTKFANWSGDDFAKAGFRVVPPAVARRGSF 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P 
Sbjct: 119 IAKNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPV 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGEI YG VP+ SVVV G
Sbjct: 179 IIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEIHYGRVPAGSVVVAG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           + PS + K       LYCAVI+KKVD +TR+KTS+N LLR
Sbjct: 239 NLPSKDGK-----YSLYCAVIVKKVDAQTRAKTSLNDLLR 273


>gi|73541581|ref|YP_296101.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Ralstonia eutropha JMP134]
 gi|123624820|sp|Q470C6|DAPD_RALEJ RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|72118994|gb|AAZ61257.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Ralstonia eutropha JMP134]
          Length = 275

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 151/280 (53%), Positives = 204/280 (72%), Gaps = 8/280 (2%)

Query: 4   IVSTLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L+ +ID  +E+  S + +S P D+++AV + +  LD G +R+A +     W  +QW
Sbjct: 1   MTQALQALIDQAWEDRTSLSPKSAPADIREAVANVIGQLDAGTLRVAEKQGK-DWIVNQW 59

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF++     +S G G++ ++DK+P KF +W   DF K  FR++P  + R  ++
Sbjct: 60  VKKAVLLSFRLEDNAPMSAG-GFAQFYDKVPTKFANWSGDDFAKAGFRVVPPAVARRGSF 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   AVLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P 
Sbjct: 119 IAKNAVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPV 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGEI YG VP+ SVVV G
Sbjct: 179 IIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEIHYGRVPAGSVVVAG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           + PS + K       LYCAVI+KKVD +TR+KTS+N LLR
Sbjct: 239 NLPSKDGK-----YSLYCAVIVKKVDAQTRAKTSLNDLLR 273


>gi|294635115|ref|ZP_06713626.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Edwardsiella tarda ATCC 23685]
 gi|291091492|gb|EFE24053.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Edwardsiella tarda ATCC 23685]
          Length = 274

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 200/282 (70%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + E  P +     + AV+  + LLD G +R+A +  NG W TH
Sbjct: 1   MQQLQTLIENAFER---RAEITPANADTLTRSAVEQVIALLDSGALRVAEKI-NGEWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF D+    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNRLMEGAE--TRFYDKVPMKFADYDEARFQREGFRVVPPASVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           AYI    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AYIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGVFIG+STKI DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ P+ N         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPAKN-----GAYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|167586842|ref|ZP_02379230.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia ubonensis Bu]
          Length = 275

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 149/277 (53%), Positives = 204/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ ++  +    ++ P +V+DAV   ++ LD+G +R+A + D G W  HQW+KKA
Sbjct: 5   LQQIIDTAWDNRAELSPKAAPAEVRDAVAHAIEQLDKGALRVAEKID-GSWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE++YG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVSYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|296136209|ref|YP_003643451.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Thiomonas intermedia K12]
 gi|294340445|emb|CAZ88826.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           (Tetrahydrodipicolinate N-succinyltransferase) (THP
           succinyltransferase) (Tetrahydropicolinate succinylase)
           [Thiomonas sp. 3As]
 gi|295796331|gb|ADG31121.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Thiomonas intermedia K12]
          Length = 273

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 146/280 (52%), Positives = 196/280 (70%), Gaps = 9/280 (3%)

Query: 4   IVSTLEEIIDSFFEESNSKNES-IPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L+ +ID  +E     + +  P ++++AV   +D L+ G +R+A R   G W THQW
Sbjct: 1   MTQQLQTLIDQAWENRTEYSPANAPAELREAVSHVIDQLNVGKLRVAERV-GGEWVTHQW 59

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF+++    +  G+ +  ++DK+  KF +           R++P  + RH +Y
Sbjct: 60  LKKAVLLSFRLHDNVAMQAGDLH--FFDKVQTKFHNLDEAQMRATGVRVVPPAVARHGSY 117

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I P  VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEPIQ  PT
Sbjct: 118 IAPNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPIQANPT 177

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           II DNCFIGARSE+VEG I+ +  V+ MGV+IGKSTKI DR TGE++YG +P  SVVV G
Sbjct: 178 IIGDNCFIGARSEVVEGVIVEDNCVISMGVYIGKSTKIYDRATGEVSYGRIPEGSVVVSG 237

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           + PS + K       LYCAVI+K+VD +TRSKTSIN LLR
Sbjct: 238 NLPSSDGKYS-----LYCAVIVKRVDAQTRSKTSINELLR 272


>gi|82542765|ref|YP_406712.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shigella boydii Sb227]
 gi|123560536|sp|Q325X4|DAPD_SHIBS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|81244176|gb|ABB64884.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Shigella boydii Sb227]
 gi|332098752|gb|EGJ03712.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella boydii 3594-74]
          Length = 274

 Score =  295 bits (756), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPTNADTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGHVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|16763603|ref|NP_459218.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|56412486|ref|YP_149561.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|161504669|ref|YP_001571781.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. arizonae serovar
           62:z4,z23:-- str. RSK2980]
 gi|161612582|ref|YP_001586547.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Paratyphi B
           str. SPB7]
 gi|167550582|ref|ZP_02344339.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|168230519|ref|ZP_02655577.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|168263922|ref|ZP_02685895.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168464226|ref|ZP_02698129.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|194471939|ref|ZP_03077923.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|197262080|ref|ZP_03162154.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197361421|ref|YP_002141057.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|198244458|ref|YP_002214174.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|71153308|sp|Q5PD57|DAPD_SALPA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|71153310|sp|Q8ZRP4|DAPD_SALTY RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|189082818|sp|A9MPJ6|DAPD_SALAR RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|189082819|sp|A9N0R2|DAPD_SALPB RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724189|sp|B5FJ13|DAPD_SALDC RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724194|sp|B5BL93|DAPD_SALPK RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|16418717|gb|AAL19177.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. LT2]
 gi|56126743|gb|AAV76249.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|160866016|gb|ABX22639.1| hypothetical protein SARI_02791 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161361946|gb|ABX65714.1| hypothetical protein SPAB_00272 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194458303|gb|EDX47142.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|195632854|gb|EDX51308.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197092897|emb|CAR58326.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|197240335|gb|EDY22955.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197938974|gb|ACH76307.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|205324369|gb|EDZ12208.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205334938|gb|EDZ21702.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|205347462|gb|EDZ34093.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|261245445|emb|CBG23235.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|301156840|emb|CBW16316.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|312911183|dbj|BAJ35157.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. T000240]
 gi|321222203|gb|EFX47275.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322616037|gb|EFY12954.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315996572]
 gi|322620820|gb|EFY17680.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-1]
 gi|322623829|gb|EFY20666.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-3]
 gi|322627277|gb|EFY24068.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 495297-4]
 gi|322630584|gb|EFY27348.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-1]
 gi|322638198|gb|EFY34899.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 515920-2]
 gi|322640683|gb|EFY37334.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 531954]
 gi|322645533|gb|EFY42060.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. NC_MB110209-0054]
 gi|322648173|gb|EFY44640.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. OH_2009072675]
 gi|322657124|gb|EFY53407.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. CASC_09SCPH15965]
 gi|322657494|gb|EFY53766.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 19N]
 gi|322663814|gb|EFY60014.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 81038-01]
 gi|322666647|gb|EFY62825.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MD_MDA09249507]
 gi|322672195|gb|EFY68307.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 414877]
 gi|322676494|gb|EFY72565.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 366867]
 gi|322679414|gb|EFY75459.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 413180]
 gi|322686259|gb|EFY82243.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 446600]
 gi|323128533|gb|ADX15963.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 4/74]
 gi|323193439|gb|EFZ78647.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609458-1]
 gi|323197539|gb|EFZ82674.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556150-1]
 gi|323201192|gb|EFZ86261.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 609460]
 gi|323209587|gb|EFZ94520.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 507440-20]
 gi|323212161|gb|EFZ96985.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 556152]
 gi|323216466|gb|EGA01192.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB101509-0077]
 gi|323220870|gb|EGA05307.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB102109-0047]
 gi|323225905|gb|EGA10125.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB110209-0055]
 gi|323228554|gb|EGA12683.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. MB111609-0052]
 gi|323236833|gb|EGA20909.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009083312]
 gi|323239667|gb|EGA23714.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 2009085258]
 gi|323242286|gb|EGA26315.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. 315731156]
 gi|323249948|gb|EGA33844.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2009159199]
 gi|323252378|gb|EGA36229.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008282]
 gi|323255661|gb|EGA39414.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008283]
 gi|323262902|gb|EGA46452.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008284]
 gi|323265388|gb|EGA48884.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008285]
 gi|323271825|gb|EGA55243.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Montevideo
           str. IA_2010008287]
 gi|326621917|gb|EGE28262.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Dublin str.
           3246]
          Length = 274

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RADITPANVDTVTREAVNQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|242240400|ref|YP_002988581.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Dickeya dadantii Ech703]
 gi|242132457|gb|ACS86759.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Dickeya dadantii Ech703]
          Length = 274

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 200/282 (70%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P  V    ++A+   +  LD G++R+A +  NG W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPTSVNNVTREAINQVISQLDSGVLRVAEKI-NGQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF D+    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNRLLEGAE--TRYYDKVPMKFADYDEARFQREGFRVVPPASVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           AYI    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AYIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGVFIG+STKI DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVFIGQSTKIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|91784131|ref|YP_559337.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia xenovorans LB400]
 gi|123062773|sp|Q13XA4|DAPD_BURXL RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|91688085|gb|ABE31285.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia xenovorans LB400]
          Length = 275

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 149/277 (53%), Positives = 204/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P DV++AV   ++ LD+G++R+A + D G W  +QW+KKA
Sbjct: 5   LQQIIDTAWENRAELSPKAAPADVREAVAHAIEQLDKGLLRVAEKKD-GDWVVNQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF  +  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFASYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD +TR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDARTRAKVGLNELLR 273


>gi|157147404|ref|YP_001454723.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Citrobacter koseri ATCC BAA-895]
 gi|166224207|sp|A8ALC4|DAPD_CITK8 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|157084609|gb|ABV14287.1| hypothetical protein CKO_03203 [Citrobacter koseri ATCC BAA-895]
          Length = 274

 Score =  295 bits (755), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 159/282 (56%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIESAFER---RADITPANVDTVTREAVNQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|154707744|ref|YP_001424081.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Coxiella burnetii Dugway 5J108-111]
 gi|189082811|sp|A9KC83|DAPD_COXBN RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|154357030|gb|ABS78492.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Coxiella burnetii Dugway 5J108-111]
          Length = 271

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 144/280 (51%), Positives = 202/280 (72%), Gaps = 11/280 (3%)

Query: 5   VSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L+ II+  ++  +S   +++P+ +  A+  T++LLD G +RIA +  NG WNT++W 
Sbjct: 1   MTDLKTIIEEAYQNKDSFTTDTVPKKIHQAIHQTIELLDNGELRIAEKQ-NGQWNTNEWA 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           K AILL F+  P K    G  Y+ ++DKIP K+ +  ++   +   R++P  IVR  AY+
Sbjct: 60  KMAILLYFKTEPLKTFDAG--YTFFYDKIPLKYTNNTSQ--PQSGVRVVPHAIVRKGAYL 115

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPS++N+GAY+  G++IDTW+TVGSCAQIGKNVH+SGG GIGGVLEP+Q  PTI
Sbjct: 116 APNTVLMPSYINIGAYVDSGTLIDTWATVGSCAQIGKNVHLSGGAGIGGVLEPLQAHPTI 175

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IED+CFIGARSEIVEG ++ +GSV+ MGVF+G+ST I +R T EITYG +P+ SVV+PGS
Sbjct: 176 IEDDCFIGARSEIVEGVMVEKGSVISMGVFVGQSTPIYNRQTQEITYGRIPAGSVVIPGS 235

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS +        + Y A+I+K+VDEKTRSK S+N LLR+
Sbjct: 236 LPSKD-----GHYNRYSAIIVKQVDEKTRSKVSLNELLRE 270


>gi|167570384|ref|ZP_02363258.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia oklahomensis C6786]
          Length = 275

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 149/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++   ++++AV   ++ LDRG +R+A + D G W  HQW+KKA
Sbjct: 5   LQQIIDNAWENRAELSPKAASAEIREAVAHAIEQLDRGALRVAEKID-GEWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|325928400|ref|ZP_08189594.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Xanthomonas perforans 91-118]
 gi|325541232|gb|EGD12780.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Xanthomonas perforans 91-118]
          Length = 398

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 144/273 (52%), Positives = 189/273 (69%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  D  G W  ++W+KKA+LL 
Sbjct: 130 IESAFERRATLTMDEIDGSTRAIVNRVIDGLESGQFRVAEPDGQGGWTVNEWLKKAVLLY 189

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +   +F K   R++PG + R  +Y G   VLM
Sbjct: 190 FRVNEMAVIEAQP--APFWDKVESRFAGFHEAEFRKAGVRVVPGAVARRGSYFGKDVVLM 247

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 248 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 307

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 308 GARSEVVEGVVIGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 365

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD KTRSKTS+N LLR
Sbjct: 366 ----GSHSLYCAVIVKQVDAKTRSKTSVNELLR 394


>gi|167563200|ref|ZP_02356116.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia oklahomensis EO147]
          Length = 275

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 149/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E     + ++   ++++AV   ++ LDRG +R+A + D G W  HQW+KKA
Sbjct: 5   LQQIIDNAWENRTELSPKAASAEIREAVAHAIEQLDRGALRVAEKID-GEWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|71899245|ref|ZP_00681407.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xylella fastidiosa Ann-1]
 gi|71730978|gb|EAO33047.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xylella fastidiosa Ann-1]
          Length = 300

 Score =  295 bits (755), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 195/284 (68%), Gaps = 12/284 (4%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           T+VS +E   D+F   S    E I   ++  V   +D L+ G  R+A  D++G W  ++W
Sbjct: 27  TLVSAIE---DAFARYSTLTVEEIEDSIRPTVNRVIDGLETGAFRVAEPDNHGGWKVNEW 83

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LL F+++ T I+      + +WDK+ ++F  + T  F     R++PG I R  +Y
Sbjct: 84  LKKAVLLYFRVHDTTIVDAQP--APFWDKVESRFSGYDTAKFRAAGVRVVPGAIARRGSY 141

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
            G   VLMPSF N+GAY+GEG+MIDTW+TVGSCAQ+G + H+SGG  IGGVLEP+Q  P 
Sbjct: 142 FGKDVVLMPSFTNIGAYVGEGTMIDTWATVGSCAQLGAHCHLSGGAAIGGVLEPLQASPA 201

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIED+CFIGARSE+VEG I+   SV+GMGVFI +ST+I +R TGEI+YG VP YSVVV G
Sbjct: 202 IIEDHCFIGARSEVVEGVIVGHHSVIGMGVFISQSTRIYNRATGEISYGYVPPYSVVVSG 261

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLRDYS 285
             P+ +      G H LYCAVI+K+VDEKTR+KTSIN LLR ++
Sbjct: 262 QLPAKD------GTHSLYCAVIVKQVDEKTRAKTSINELLRGFA 299


>gi|283835228|ref|ZP_06354969.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Citrobacter youngae ATCC 29220]
 gi|291068939|gb|EFE07048.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Citrobacter youngae ATCC 29220]
          Length = 274

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + +  P +V    ++AV   + LLD G +R+A + + G W TH
Sbjct: 1   MQQLQNVIESAFER---RADITPANVDTVTREAVNQVISLLDSGALRVAEKIE-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|283783950|ref|YP_003363815.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Citrobacter rodentium ICC168]
 gi|282947404|emb|CBG86949.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Citrobacter rodentium ICC168]
          Length = 274

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + E  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RAEITPANVDTVTREAVNQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIED+CFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDHCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|170682872|ref|YP_001742293.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli SMS-3-5]
 gi|226724173|sp|B1LGW7|DAPD_ECOSM RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|170520590|gb|ACB18768.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli SMS-3-5]
          Length = 274

 Score =  295 bits (754), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 157/282 (55%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF ++    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFANYDAARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|186476107|ref|YP_001857577.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia phymatum STM815]
 gi|226724160|sp|B2JID7|DAPD_BURP8 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|184192566|gb|ACC70531.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia phymatum STM815]
          Length = 275

 Score =  295 bits (754), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 149/277 (53%), Positives = 205/277 (74%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ ++  ++   ++ P DV++AV   ++ LD+G +R+A + D G W  +QW+KKA
Sbjct: 5   LQQIIDNAWDNRADLSPKAAPADVREAVAHAIEQLDKGALRVAEKKD-GDWVVNQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  +YI   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSYIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE++YG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVSYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|296158918|ref|ZP_06841746.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia sp. Ch1-1]
 gi|295890793|gb|EFG70583.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia sp. Ch1-1]
          Length = 275

 Score =  295 bits (754), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 149/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P DV+ AV   ++ LD+G++R+A + D G W  +QW+KKA
Sbjct: 5   LQQIIDTAWENRAELSPKAAPADVRQAVAHAIEQLDKGLLRVAEKKD-GDWVVNQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF  +  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFASYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+ST+I DR TGE+TYG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTRIYDRETGEVTYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|168820781|ref|ZP_02832781.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205342468|gb|EDZ29232.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|320084467|emb|CBY94260.1| 2,3,4,5-tetrahydropyridine-2-carboxylateN-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
          Length = 274

 Score =  295 bits (754), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 157/282 (55%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RADITPANVDTVTREAVNQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGE+ YG +P+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEVHYGRIPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|167990097|ref|ZP_02571197.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205331419|gb|EDZ18183.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|267991902|gb|ACY86787.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 14028S]
 gi|332987165|gb|AEF06148.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. UK-1]
          Length = 274

 Score =  295 bits (754), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RADITPPNVDTVTREAVNQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|168234990|ref|ZP_02660048.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|194736150|ref|YP_002113236.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197248248|ref|YP_002145218.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|204927156|ref|ZP_03218358.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|238911279|ref|ZP_04655116.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Tennessee
           str. CDC07-0191]
 gi|226724188|sp|B5F8S7|DAPD_SALA4 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724195|sp|B4TXR8|DAPD_SALSV RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|194711652|gb|ACF90873.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|197211951|gb|ACH49348.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
 gi|197291991|gb|EDY31341.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|204323821|gb|EDZ09016.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
          Length = 274

 Score =  295 bits (754), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RADITPVNVDTVTREAVNQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|165918461|ref|ZP_02218547.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Coxiella burnetii RSA 334]
 gi|212212856|ref|YP_002303792.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Coxiella burnetii CbuG_Q212]
 gi|226724163|sp|B6J119|DAPD_COXB2 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|165917829|gb|EDR36433.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Coxiella burnetii RSA 334]
 gi|212011266|gb|ACJ18647.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Coxiella burnetii CbuG_Q212]
          Length = 271

 Score =  295 bits (754), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 144/280 (51%), Positives = 202/280 (72%), Gaps = 11/280 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L+ II+  ++ + N   +++P+ +  A+  T++LLD G +RIA +  NG WNT++W 
Sbjct: 1   MTDLKTIIEEAYQNKDNFTTDTVPKKIHQAIHQTIELLDNGELRIAEKQ-NGQWNTNEWA 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           K AILL F+  P K    G  Y+ ++DKIP K+ +  ++   +   R++P  IVR  AY+
Sbjct: 60  KMAILLYFKTEPLKTFDAG--YTFFYDKIPLKYTNNTSQ--PQSGVRVVPHAIVRKGAYL 115

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPS++N+GAY+  G++IDTW+TVGSCAQIGKNVH+SGG GIGGVLEP+Q  PTI
Sbjct: 116 APNTVLMPSYINIGAYVDSGTLIDTWATVGSCAQIGKNVHLSGGAGIGGVLEPLQAHPTI 175

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IED+CFIGARSEIVEG ++ +GSV+ MGVF+G+ST I +R T EITYG +P+ SVV+PGS
Sbjct: 176 IEDDCFIGARSEIVEGVMVEKGSVISMGVFVGQSTPIYNRQTQEITYGRIPAGSVVIPGS 235

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS +        + Y A+I+K+VDEKTRSK S+N LLR+
Sbjct: 236 LPSKD-----GHYNRYSAIIVKQVDEKTRSKVSLNELLRE 270


>gi|198283611|ref|YP_002219932.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218665220|ref|YP_002426238.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198248132|gb|ACH83725.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218517433|gb|ACK78019.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 274

 Score =  295 bits (754), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 155/277 (55%), Positives = 200/277 (72%), Gaps = 9/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L  +ID+ +E  +    +  P ++++AV  T++ LD+G++R+A + D G W THQWIKKA
Sbjct: 5   LATMIDAAWENRAEISPKQAPAELREAVHQTIEGLDKGVLRVAEKRD-GQWITHQWIKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     I  G   + ++DK+P KF D+ + DF    FR++P    R  A+IG  
Sbjct: 64  VLLSFRLQDNARIPGGE--TNFYDKVPGKFADYNSNDFRTGGFRVVPPATARRGAFIGRN 121

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPSFVN+GAY+ EG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 122 CVLMPSFVNIGAYVDEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPLQANPTIIED 181

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ EGSV+ MGVFIG ST+I DR TGEITYG VP+ SVVV GS PS
Sbjct: 182 NCFIGARSEVVEGVIVEEGSVISMGVFIGSSTRIYDRATGEITYGRVPAGSVVVSGSLPS 241

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            +         LYCAVI+K+VD KT  K  IN +LRD
Sbjct: 242 KD-----GSYSLYCAVIVKQVDAKTLGKVGINAILRD 273


>gi|16759203|ref|NP_454820.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           CT18]
 gi|29140753|ref|NP_804095.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|213163142|ref|ZP_03348852.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E00-7866]
 gi|213423432|ref|ZP_03356417.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E01-6750]
 gi|213425939|ref|ZP_03358689.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E02-1180]
 gi|213582936|ref|ZP_03364762.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-0664]
 gi|213647833|ref|ZP_03377886.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           J185]
 gi|213852921|ref|ZP_03382453.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           M223]
 gi|289825717|ref|ZP_06544885.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-3139]
 gi|71153309|sp|Q8Z9A8|DAPD_SALTI RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|25286673|pir||AG0528 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16501493|emb|CAD01367.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29136377|gb|AAO67944.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
          Length = 274

 Score =  295 bits (754), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 204/282 (72%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++AV+  + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RADITPANVDTVTREAVKQVISLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I DG   S ++DK P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVI-DG-AESRYFDKAPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|157372028|ref|YP_001480017.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Serratia proteamaculans 568]
 gi|167012028|sp|A8GIE9|DAPD_SERP5 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|157323792|gb|ABV42889.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Serratia proteamaculans 568]
          Length = 274

 Score =  294 bits (753), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 202/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIENAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  K++ DG   + ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNKVM-DG-AETRYYDKVPMKFADYDEARFQKEGFRVVPPATVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|15799848|ref|NP_285860.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli O157:H7 EDL933]
 gi|15829422|ref|NP_308195.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. Sakai]
 gi|168751384|ref|ZP_02776406.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4113]
 gi|168755778|ref|ZP_02780785.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4401]
 gi|168764328|ref|ZP_02789335.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4501]
 gi|168770362|ref|ZP_02795369.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4486]
 gi|168777002|ref|ZP_02802009.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4196]
 gi|168782057|ref|ZP_02807064.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4076]
 gi|168789274|ref|ZP_02814281.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC869]
 gi|168802320|ref|ZP_02827327.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC508]
 gi|195938153|ref|ZP_03083535.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4024]
 gi|208807387|ref|ZP_03249724.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4206]
 gi|208811847|ref|ZP_03253176.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4045]
 gi|208821464|ref|ZP_03261784.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4042]
 gi|209400200|ref|YP_002268773.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4115]
 gi|217326584|ref|ZP_03442668.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. TW14588]
 gi|254791299|ref|YP_003076136.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. TW14359]
 gi|261226920|ref|ZP_05941201.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. FRIK2000]
 gi|261255324|ref|ZP_05947857.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. FRIK966]
 gi|71153283|sp|Q8X8Y7|DAPD_ECO57 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724167|sp|B5Z0E4|DAPD_ECO5E RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|12512888|gb|AAG54468.1|AE005192_10 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EDL933]
 gi|13359624|dbj|BAB33591.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. Sakai]
 gi|187767701|gb|EDU31545.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4196]
 gi|188014556|gb|EDU52678.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4113]
 gi|189000445|gb|EDU69431.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4076]
 gi|189357096|gb|EDU75515.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4401]
 gi|189360710|gb|EDU79129.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4486]
 gi|189365633|gb|EDU84049.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4501]
 gi|189371113|gb|EDU89529.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC869]
 gi|189375681|gb|EDU94097.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC508]
 gi|208727188|gb|EDZ76789.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4206]
 gi|208733124|gb|EDZ81811.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4045]
 gi|208741587|gb|EDZ89269.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4042]
 gi|209161600|gb|ACI39033.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC4115]
 gi|209745884|gb|ACI71249.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli]
 gi|209745886|gb|ACI71250.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli]
 gi|209745888|gb|ACI71251.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli]
 gi|209745892|gb|ACI71253.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli]
 gi|217322805|gb|EEC31229.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. TW14588]
 gi|254590699|gb|ACT70060.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. TW14359]
 gi|320190309|gb|EFW64959.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. EC1212]
 gi|320639972|gb|EFX09557.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. G5101]
 gi|320644742|gb|EFX13786.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli O157:H- str. 493-89]
 gi|320652898|gb|EFX21136.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli O157:H- str. H 2687]
 gi|320668909|gb|EFX35704.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. LSU-61]
 gi|326339780|gb|EGD63588.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. 1044]
 gi|326345115|gb|EGD68858.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli O157:H7 str. 1125]
          Length = 274

 Score =  294 bits (753), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 157/282 (55%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TG+I YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGDIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|91209235|ref|YP_539221.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli UTI89]
 gi|110640385|ref|YP_668113.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli 536]
 gi|117622451|ref|YP_851364.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli APEC O1]
 gi|191172804|ref|ZP_03034341.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli F11]
 gi|215485327|ref|YP_002327758.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218557107|ref|YP_002390020.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli S88]
 gi|218698585|ref|YP_002406214.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli IAI39]
 gi|218703420|ref|YP_002410939.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli UMN026]
 gi|237704325|ref|ZP_04534806.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia sp. 3_2_53FAA]
 gi|293403235|ref|ZP_06647332.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli FVEC1412]
 gi|293408258|ref|ZP_06652098.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli B354]
 gi|298378770|ref|ZP_06988654.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli FVEC1302]
 gi|300900797|ref|ZP_07118940.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 198-1]
 gi|300938572|ref|ZP_07153306.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 21-1]
 gi|300984845|ref|ZP_07177134.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 200-1]
 gi|301025954|ref|ZP_07189438.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 69-1]
 gi|306815234|ref|ZP_07449383.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli NC101]
 gi|312966301|ref|ZP_07780527.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli 2362-75]
 gi|331661237|ref|ZP_08362169.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli TA206]
 gi|331661540|ref|ZP_08362464.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli TA143]
 gi|331671674|ref|ZP_08372472.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli TA280]
 gi|123148414|sp|Q0TLG7|DAPD_ECOL5 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|123388054|sp|Q1RG24|DAPD_ECOUT RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|166224208|sp|A1A7L0|DAPD_ECOK1 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724166|sp|B7MBE7|DAPD_ECO45 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724168|sp|B7NIC7|DAPD_ECO7I RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724171|sp|B7N833|DAPD_ECOLU RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|254767076|sp|B7UIL1|DAPD_ECO27 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|91070809|gb|ABE05690.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli UTI89]
 gi|110341977|gb|ABG68214.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli 536]
 gi|115511575|gb|ABI99649.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli APEC O1]
 gi|190906954|gb|EDV66556.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli F11]
 gi|215263399|emb|CAS07719.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli O127:H6 str. E2348/69]
 gi|218363876|emb|CAR01540.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli S88]
 gi|218368571|emb|CAR16308.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli IAI39]
 gi|218430517|emb|CAR11383.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli UMN026]
 gi|222031996|emb|CAP74735.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate [Escherichia coli
           LF82]
 gi|226902237|gb|EEH88496.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia sp. 3_2_53FAA]
 gi|281177391|dbj|BAI53721.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli SE15]
 gi|284919941|emb|CBG32996.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli 042]
 gi|291430150|gb|EFF03164.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli FVEC1412]
 gi|291472509|gb|EFF14991.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli B354]
 gi|294493673|gb|ADE92429.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli IHE3034]
 gi|298281104|gb|EFI22605.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli FVEC1302]
 gi|300306606|gb|EFJ61126.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 200-1]
 gi|300355715|gb|EFJ71585.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 198-1]
 gi|300395753|gb|EFJ79291.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 69-1]
 gi|300456485|gb|EFK19978.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 21-1]
 gi|305850896|gb|EFM51351.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli NC101]
 gi|307629742|gb|ADN74046.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli UM146]
 gi|312289544|gb|EFR17438.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli 2362-75]
 gi|312944774|gb|ADR25601.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli O83:H1 str. NRG 857C]
 gi|315285237|gb|EFU44682.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 110-3]
 gi|315300705|gb|EFU59932.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 16-3]
 gi|320196958|gb|EFW71579.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli WV_060327]
 gi|323190435|gb|EFZ75710.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli RN587/1]
 gi|323935005|gb|EGB31378.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli E1520]
 gi|323950835|gb|EGB46712.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli H252]
 gi|323955127|gb|EGB50902.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli H263]
 gi|323964942|gb|EGB60408.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli M863]
 gi|323975667|gb|EGB70763.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli TW10509]
 gi|324008261|gb|EGB77480.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 57-2]
 gi|324012179|gb|EGB81398.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 60-1]
 gi|327255144|gb|EGE66747.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli STEC_7v]
 gi|331052279|gb|EGI24318.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli TA206]
 gi|331061455|gb|EGI33418.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli TA143]
 gi|331071519|gb|EGI42876.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli TA280]
          Length = 274

 Score =  294 bits (753), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 157/282 (55%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF ++    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFANYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|6014910|sp|P56220|DAPD_MYCBO RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|20150772|pdb|1KGQ|A Chain A, Crystal Structure Of Tetrahydrodipicolinate N-
           Succinyltransferase In Complex With L-2-Aminopimelate
           And Succinamide-Coa
 gi|20150773|pdb|1KGT|A Chain A, Crystal Structure Of Tetrahydrodipicolinate N-
           Succinyltransferase In Complex With Pimelate And
           Succinyl- Coa
 gi|157836380|pdb|2TDT|A Chain A, Complex Of Tetrahydrodipicolinate N-Succinyltransferase
           With 2-Aminopimelate And Coenzyme A
 gi|157836894|pdb|3TDT|A Chain A, Complex Of Tetrahydrodipicolinate N-Succinyltransferase
           With 2-Amino-6-Oxopimelate And Coenzyme A
          Length = 274

 Score =  294 bits (753), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 157/282 (55%), Positives = 203/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIESAFER---RADITPANVDTVTREAVNQVIGLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  K++ DG   + ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNKVM-DG-AETRYYDKVPMKFADYDEARFQKEGFRVVPPATVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|153207388|ref|ZP_01946125.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Coxiella burnetii 'MSU Goat Q177']
 gi|212219102|ref|YP_002305889.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Coxiella burnetii CbuK_Q154]
 gi|226724162|sp|B6J928|DAPD_COXB1 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|120576697|gb|EAX33321.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Coxiella burnetii 'MSU Goat Q177']
 gi|212013364|gb|ACJ20744.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Coxiella burnetii CbuK_Q154]
          Length = 271

 Score =  294 bits (753), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 144/280 (51%), Positives = 202/280 (72%), Gaps = 11/280 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L+ II+  ++ + N   +++P+ +  A+  T++LLD G +RIA +  NG WNT++W 
Sbjct: 1   MTDLKTIIEEAYQNKDNFTTDTVPKKIYQAIHQTIELLDNGELRIAEKQ-NGQWNTNEWA 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           K AILL F+  P K    G  Y+ ++DKIP K+ +  ++   +   R++P  IVR  AY+
Sbjct: 60  KMAILLYFKTEPLKTFDAG--YTFFYDKIPLKYTNNTSQ--PQSGVRVVPHAIVRKGAYL 115

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPS++N+GAY+  G++IDTW+TVGSCAQIGKNVH+SGG GIGGVLEP+Q  PTI
Sbjct: 116 APNTVLMPSYINIGAYVDSGTLIDTWATVGSCAQIGKNVHLSGGAGIGGVLEPLQAHPTI 175

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IED+CFIGARSEIVEG ++ +GSV+ MGVF+G+ST I +R T EITYG +P+ SVV+PGS
Sbjct: 176 IEDDCFIGARSEIVEGVMVEKGSVISMGVFVGQSTPIYNRQTQEITYGRIPAGSVVIPGS 235

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS +        + Y A+I+K+VDEKTRSK S+N LLR+
Sbjct: 236 LPSKD-----GHYNRYSAIIVKQVDEKTRSKVSLNELLRE 270


>gi|167720182|ref|ZP_02403418.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei DM98]
          Length = 275

 Score =  294 bits (753), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 149/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++   ++++AV   ++ LDRG +RIA + D G W  HQW+KKA
Sbjct: 5   LQQIIDNAWENRAELSPKAASAEIREAVAHAIEQLDRGALRIAEKID-GAWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ P+
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPA 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|311280865|ref|YP_003943096.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Enterobacter cloacae SCF1]
 gi|308750060|gb|ADO49812.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Enterobacter cloacae SCF1]
          Length = 274

 Score =  294 bits (753), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 158/279 (56%), Positives = 201/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV-KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ +I+S FE       +    V + AV+  + LLD G +R+A + D G W THQW+
Sbjct: 1   MQQLQNVIESAFERRADITPANADTVTRAAVEQVIALLDSGALRVAEKID-GQWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  ++I DG   S ++DK+P KF ++    F+K  FR++P   VR  A+I
Sbjct: 60  KKAVLLSFRINDNQVI-DG-AESRYFDKVPMKFANYDEARFQKEGFRVVPPAAVRQGAFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 238 LPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|166235502|pdb|3BXY|A Chain A, Crystal Structure Of Tetrahydrodipicolinate N-
           Succinyltransferase From E. Coli
          Length = 285

 Score =  294 bits (753), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 157/279 (56%), Positives = 200/279 (71%), Gaps = 15/279 (5%)

Query: 8   LEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W THQW+
Sbjct: 15  LQNIIETAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTHQWL 70

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  ++I      S ++DK+P KF D+    F+K  FR++P   VR  A+I
Sbjct: 71  KKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQGAFI 128

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 129 ARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 188

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TG+I YG VP+ SVVV G+
Sbjct: 189 IEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGDIHYGRVPAGSVVVSGN 248

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 249 LPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 282


>gi|76580780|gb|ABA50255.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 1710b]
          Length = 312

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++   ++++AV   ++ LDRG +R+A + D G W  HQW+KKA
Sbjct: 42  LQQIIDNAWENRAELSPKAASAEIREAVAHAIEQLDRGALRVAEKID-GAWTVHQWLKKA 100

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 101 VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 159

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 160 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 219

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ P+
Sbjct: 220 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPA 279

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 280 KD------GTHSLYCAVIVKKVDAKTRAKVGLNELLR 310


>gi|325913963|ref|ZP_08176319.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325539732|gb|EGD11372.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 387

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 142/273 (52%), Positives = 188/273 (68%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G+ R+A  D  G W  ++W+KKA+LL 
Sbjct: 119 IESAFERRATLTMDEIEGSTRAIVTRVIDGLESGVFRVAEPDGQGGWTVNEWLKKAVLLY 178

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +   +F K   R++PG + R   Y G   VLM
Sbjct: 179 FRVNEMAVIDAQP--APFWDKVESRFAGFHEAEFRKAGVRVVPGAVARRGTYFGKDVVLM 236

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 237 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 296

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFI +ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 297 GARSEVVEGVVIGHHSVIGMGVFISQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 354

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD +TRSKTS+N LLR
Sbjct: 355 ----GSHSLYCAVIVKQVDARTRSKTSVNELLR 383


>gi|53719778|ref|YP_108764.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei K96243]
 gi|53723894|ref|YP_103206.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia mallei ATCC 23344]
 gi|67639497|ref|ZP_00438349.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei GB8 horse 4]
 gi|121600582|ref|YP_993385.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia mallei SAVP1]
 gi|124385370|ref|YP_001029179.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia mallei NCTC 10229]
 gi|126438722|ref|YP_001059481.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei 668]
 gi|126451030|ref|YP_001080892.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia mallei NCTC 10247]
 gi|134277646|ref|ZP_01764361.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 305]
 gi|162210038|ref|YP_333986.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei 1710b]
 gi|167004068|ref|ZP_02269842.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei PRL-20]
 gi|167816396|ref|ZP_02448076.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei 91]
 gi|167894888|ref|ZP_02482290.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei 7894]
 gi|167903276|ref|ZP_02490481.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei NCTC 13177]
 gi|167911517|ref|ZP_02498608.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei 112]
 gi|167919526|ref|ZP_02506617.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei BCC215]
 gi|217421459|ref|ZP_03452963.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 576]
 gi|237812820|ref|YP_002897271.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei MSHR346]
 gi|254177636|ref|ZP_04884291.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei ATCC 10399]
 gi|254179309|ref|ZP_04885908.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 1655]
 gi|254200159|ref|ZP_04906525.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei FMH]
 gi|254206498|ref|ZP_04912850.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei JHU]
 gi|254259493|ref|ZP_04950547.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 1710a]
 gi|254297196|ref|ZP_04964649.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 406e]
 gi|254358093|ref|ZP_04974366.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei 2002721280]
 gi|71153277|sp|Q62JB3|DAPD_BURMA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|71153278|sp|Q63T02|DAPD_BURPS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|166224201|sp|A3MKV6|DAPD_BURM7 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|166224202|sp|A2SB60|DAPD_BURM9 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|166224203|sp|A1V582|DAPD_BURMS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|166224205|sp|A3NAW0|DAPD_BURP6 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|52210192|emb|CAH36171.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei K96243]
 gi|52427317|gb|AAU47910.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei ATCC 23344]
 gi|121229392|gb|ABM51910.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei SAVP1]
 gi|124293390|gb|ABN02659.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei NCTC 10229]
 gi|126218215|gb|ABN81721.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 668]
 gi|126243900|gb|ABO06993.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei NCTC 10247]
 gi|134251296|gb|EBA51375.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 305]
 gi|147749755|gb|EDK56829.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei FMH]
 gi|147753941|gb|EDK61006.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei JHU]
 gi|148027220|gb|EDK85241.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei 2002721280]
 gi|157807235|gb|EDO84405.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 406e]
 gi|160698675|gb|EDP88645.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei ATCC 10399]
 gi|184209849|gb|EDU06892.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 1655]
 gi|217395201|gb|EEC35219.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 576]
 gi|237503996|gb|ACQ96314.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei MSHR346]
 gi|238520046|gb|EEP83510.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei GB8 horse 4]
 gi|243060506|gb|EES42692.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia mallei PRL-20]
 gi|254218182|gb|EET07566.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 1710a]
          Length = 275

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++   ++++AV   ++ LDRG +R+A + D G W  HQW+KKA
Sbjct: 5   LQQIIDNAWENRAELSPKAASAEIREAVAHAIEQLDRGALRVAEKID-GAWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ P+
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPA 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|291613909|ref|YP_003524066.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sideroxydans lithotrophicus ES-1]
 gi|291584021|gb|ADE11679.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Sideroxydans lithotrophicus ES-1]
          Length = 273

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 156/279 (55%), Positives = 201/279 (72%), Gaps = 15/279 (5%)

Query: 8   LEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           L+ II+  FE    + E  P++V    K+ + + ++ LD+G +R+A + D G W THQW+
Sbjct: 4   LQAIIEEAFER---RAEITPRNVDAQLKETINTVIEYLDQGKLRVAEKLD-GQWVTHQWV 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I     I    G++ ++DK+P+KF D+ +K+F +  FR++P    R  AYI
Sbjct: 60  KKAVLLSFRIEDNAFIK--GGFTNYFDKVPSKFADYNSKEFREGGFRVVPPAAARRGAYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+G Y+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 AKNVVLMPSYVNIGGYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPVQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGVFIG+STKI DR TGE+ YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVFIGQSTKIYDRETGEVHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LYCAVI+KKVD KT  K  IN LLR
Sbjct: 238 LPSSDGK-----YSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|220934326|ref|YP_002513225.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|254767081|sp|B8GPS1|DAPD_THISH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|219995636|gb|ACL72238.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 273

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 155/280 (55%), Positives = 204/280 (72%), Gaps = 9/280 (3%)

Query: 5   VSTLEEII-DSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+EII ++F   ++    ++   VKDAV   +D+LDRG  R+A + D G W  + W+
Sbjct: 1   MSKLQEIIIEAFERRADITPRNVETHVKDAVMEAIDMLDRGTARVAEKKD-GEWIVNDWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I+  + I    G++ ++DK+P+K+ D  ++DF +   R++P    R  +YI
Sbjct: 60  KKAVLLSFRIHDNQFIK--GGFTNYYDKVPSKWADANSRDFREGGARVVPPATARKGSYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPS+VN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 APGVVLMPSYVNIGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR   EI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDREKDEILYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS + K       LYCAVI+KKVDEKTRSK  IN LLRD
Sbjct: 238 LPSKDGK-----YSLYCAVIVKKVDEKTRSKVGINELLRD 272


>gi|294626538|ref|ZP_06705136.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succin [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292599105|gb|EFF43244.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succin [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
          Length = 337

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 144/273 (52%), Positives = 189/273 (69%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  D  G W  ++W+KKA+LL 
Sbjct: 69  IESAFERRATLTMDEIDGSTRAIVTRVIDGLESGQFRVAEPDGQGGWTVNEWLKKAVLLY 128

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +   +F K   R++PG + R  +Y G   VLM
Sbjct: 129 FRVNEMAVIDAQP--APFWDKVESRFAGFHEAEFRKAGVRVVPGAVARRGSYFGKDVVLM 186

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 187 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 246

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 247 GARSEVVEGVVIGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 304

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD KTRSKTS+N LLR
Sbjct: 305 ----GSHSLYCAVIVKQVDAKTRSKTSVNELLR 333


>gi|26246112|ref|NP_752151.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli CFT073]
 gi|227884921|ref|ZP_04002726.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli 83972]
 gi|300993613|ref|ZP_07180469.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 45-1]
 gi|71153284|sp|Q8FL11|DAPD_ECOL6 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|26106509|gb|AAN78695.1|AE016755_195 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli CFT073]
 gi|227838059|gb|EEJ48525.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli 83972]
 gi|300406536|gb|EFJ90074.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 45-1]
 gi|307552016|gb|ADN44791.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli ABU 83972]
 gi|315294609|gb|EFU53956.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 153-1]
          Length = 274

 Score =  293 bits (751), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 157/282 (55%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF ++    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFANYDEALFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|161723132|ref|YP_442540.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia thailandensis E264]
 gi|167619576|ref|ZP_02388207.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia thailandensis Bt4]
 gi|257138749|ref|ZP_05587011.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia thailandensis E264]
          Length = 275

 Score =  293 bits (751), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++   ++++AV   ++ LDRG +R+A + D G W  HQW+KKA
Sbjct: 5   LQQIIDNAWENRAELSPKAASAEIREAVAHAIEQLDRGALRVAEKID-GAWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GY+ ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYTQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|126454271|ref|YP_001066764.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei 1106a]
 gi|167739185|ref|ZP_02411959.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei 14]
 gi|167824776|ref|ZP_02456247.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei 9]
 gi|226198890|ref|ZP_03794453.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei Pakistan 9]
 gi|242314291|ref|ZP_04813307.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 1106b]
 gi|254189304|ref|ZP_04895815.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei Pasteur 52237]
 gi|166224204|sp|A3NWP3|DAPD_BURP0 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|126227913|gb|ABN91453.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 1106a]
 gi|157936983|gb|EDO92653.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei Pasteur 52237]
 gi|225928990|gb|EEH25014.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei Pakistan 9]
 gi|242137530|gb|EES23932.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei 1106b]
          Length = 275

 Score =  293 bits (751), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++   ++++AV   ++ LDRG +R+A + D G W  HQW+KKA
Sbjct: 5   LQQIIDNTWENRAELSPKAASAEIREAVAHAIEQLDRGALRVAEKID-GAWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ P+
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPA 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|146329782|ref|YP_001209716.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase
           [Dichelobacter nodosus VCS1703A]
 gi|146233252|gb|ABQ14230.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase
           [Dichelobacter nodosus VCS1703A]
          Length = 271

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 201/277 (72%), Gaps = 11/277 (3%)

Query: 8   LEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+  I++ FE+ S    ++    +  AV  TL LL+ G+IR+A     G W  ++WIKKA
Sbjct: 3   LQNTIETAFEKRSEISPKTADSALVTAVNETLALLEEGMIRVAEPTPEG-WKVNEWIKKA 61

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           ++LSF++    +I   +GY+ ++DK+ +++ D+    F     R++P  + R   ++G  
Sbjct: 62  VILSFRLYDNHVIP--HGYTHYFDKVASRYADYDEVRFNADGVRVVPPAVARRGTFLGKG 119

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS++N+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 120 VVLMPSYINIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQASPTIIED 179

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           +CFIGARSEIVEG I+ +G+V+ MGV+IG+STKI +R TGEITYG VP+ SVVV GS P+
Sbjct: 180 SCFIGARSEIVEGVIVEKGAVVSMGVYIGQSTKIYNRMTGEITYGRVPTGSVVVSGSLPA 239

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVIIK+VDEKTRSKTSIN LLR
Sbjct: 240 ED------GSHSLYCAVIIKQVDEKTRSKTSINELLR 270


>gi|254197777|ref|ZP_04904199.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei S13]
 gi|169654518|gb|EDS87211.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia pseudomallei S13]
          Length = 275

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++   ++++AV   ++ LDRG +R+A + D G W  HQW+KKA
Sbjct: 5   LQQIIDNAWENRAELSPKAASAEIREAVAHAIEQLDRGALRVAEKID-GAWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ P+
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPA 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDAKTRAKIGLNELLR 273


>gi|238026892|ref|YP_002911123.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Burkholderia glumae BGR1]
 gi|237876086|gb|ACR28419.1| Tetrahydrodipicolinate N-succinyltransferase [Burkholderia glumae
           BGR1]
          Length = 275

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 202/277 (72%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++ P +V++AV   ++ LDRG +R+A +   G W  HQW+KKA
Sbjct: 5   LQQIIDNAWETRAELSPKAAPAEVREAVAHAIEQLDRGALRVAEKQ-GGDWIVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF  +  +DF    FR++P  + R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFASYTAEDFAAGGFRVVPPAVARRGSFIARN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE++YG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVSYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GSHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|83655234|gb|ABC39297.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia thailandensis E264]
          Length = 312

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++   ++++AV   ++ LDRG +R+A + D G W  HQW+KKA
Sbjct: 42  LQQIIDNAWENRAELSPKAASAEIREAVAHAIEQLDRGALRVAEKID-GAWTVHQWLKKA 100

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GY+ ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 101 VLLSFRLEDNAPMPAG-GYTQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 159

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 160 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 219

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ PS
Sbjct: 220 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPS 279

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 280 KD------GTHSLYCAVIVKKVDAKTRAKVGLNELLR 310


>gi|167581467|ref|ZP_02374341.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia thailandensis TXDOH]
          Length = 275

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++   ++++AV   ++ LDRG +R+A + D G W  HQW+KKA
Sbjct: 5   LQQIIDNAWENRAELSPKAASAEIREAVAHAIEQLDRGALRVAEKID-GAWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GY+ ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNTPMPAG-GYTQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|156935319|ref|YP_001439235.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Cronobacter sakazakii ATCC BAA-894]
 gi|166224209|sp|A7MGS1|DAPD_ENTS8 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|156533573|gb|ABU78399.1| hypothetical protein ESA_03177 [Cronobacter sakazakii ATCC BAA-894]
          Length = 274

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + +  P +V    ++AV   + LLD G +R+A +  NG W TH
Sbjct: 1   MQQLQNVIESAFER---RADITPANVDAVTREAVNQVIALLDSGELRVAEKI-NGEWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF ++    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFANYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVFYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|320186586|gb|EFW61311.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shigella flexneri CDC 796-83]
          Length = 274

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 157/282 (55%), Positives = 200/282 (70%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD   +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPTNADTVTREAVNQVIALLDSSALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGHVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|77748586|ref|NP_641765.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xanthomonas axonopodis pv. citri str. 306]
          Length = 285

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 144/273 (52%), Positives = 189/273 (69%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  D  G W  ++W+KKA+LL 
Sbjct: 17  IESAFERRATLTMDEIDGSTRAIVTRVIDGLESGQFRVAEPDGQGGWTVNEWLKKAVLLY 76

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +   +F K   R++PG + R  +Y G   VLM
Sbjct: 77  FRVNEMAVIDAQP--APFWDKVESRFAGFHEAEFRKAGVRVVPGAVARRGSYFGKDVVLM 134

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 135 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 194

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 195 GARSEVVEGVVIGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 252

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD KTRSKTS+N LLR
Sbjct: 253 ----GSHSLYCAVIVKQVDAKTRSKTSVNELLR 281


>gi|237746593|ref|ZP_04577073.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Oxalobacter formigenes HOxBLS]
 gi|229377944|gb|EEO28035.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Oxalobacter formigenes HOxBLS]
          Length = 281

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 150/287 (52%), Positives = 200/287 (69%), Gaps = 12/287 (4%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDV-KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +T    L++II+  +E  +S        + + A+   +  LD G++R+A +  NG W  +
Sbjct: 1   MTQEEQLKQIIEDAWENRDSFTAGDASPILRAAIAEVIRQLDCGLLRVAEKK-NGEWTVN 59

Query: 61  QWIKKAILLSFQINPT---KIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIV 117
           QW KKA+LLSF++       + SDG+    ++DK+ +KF  +  +DF K  FR++P  + 
Sbjct: 60  QWTKKAVLLSFRLQENFSMPVGSDGSPALHFYDKVTSKFARYTQEDFAKGGFRVVPPAVA 119

Query: 118 RHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPI 177
           R  +YIG   V+MPSFVN+GAY+ EG+MIDTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+
Sbjct: 120 RLGSYIGKNVVMMPSFVNIGAYVDEGTMIDTWATVGSCAQIGKHVHLSGGVGIGGVLEPM 179

Query: 178 QTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYS 237
           Q  PTIIEDNCFIGARSEIVEG I+ E SV+ MGV+IG+ST+I DR    I YG VPS S
Sbjct: 180 QANPTIIEDNCFIGARSEIVEGVIVEENSVISMGVYIGQSTRIYDRENDRILYGRVPSGS 239

Query: 238 VVVPGSYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLRD 283
           VVVPG+ P      D  G + LYCAVI+K+VD +TR+KT+IN LLRD
Sbjct: 240 VVVPGNLP------DPGGKYSLYCAVIVKRVDAQTRAKTAINDLLRD 280


>gi|29654005|ref|NP_819697.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Coxiella burnetii RSA 493]
 gi|161831330|ref|YP_001596590.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Coxiella burnetii RSA 331]
 gi|71153282|sp|Q83DN1|DAPD_COXBU RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|189082812|sp|A9NCF0|DAPD_COXBR RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|29541271|gb|AAO90211.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Coxiella burnetii RSA 493]
 gi|161763197|gb|ABX78839.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Coxiella burnetii RSA 331]
          Length = 271

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 143/280 (51%), Positives = 202/280 (72%), Gaps = 11/280 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L+ II+  ++ + N   +++P+ +  A+  T++LLD G +RIA +  NG WNT++W 
Sbjct: 1   MTDLKTIIEEAYQNKDNFTTDTVPKKIHQAIHQTIELLDNGELRIAEKQ-NGQWNTNEWA 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           K AILL F+  P K    G  Y+ ++DKIP K+ +  ++   +   R++P  IVR  AY+
Sbjct: 60  KMAILLYFKTEPLKTFDAG--YTFFYDKIPLKYTNNTSQ--PQSGVRVVPHAIVRKGAYL 115

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPS++N+GAY+  G++IDTW+TVGSCAQIGKNVH+SGG GIGGVLEP+Q  PTI
Sbjct: 116 APNTVLMPSYINIGAYVDSGTLIDTWATVGSCAQIGKNVHLSGGAGIGGVLEPLQAHPTI 175

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IED+CFIGARSEIVEG ++ +GSV+ MGVF+G+ST I +R T EITYG +P+ SVV+PGS
Sbjct: 176 IEDDCFIGARSEIVEGVMVEKGSVISMGVFVGQSTPIYNRQTQEITYGRIPAGSVVIPGS 235

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS +        + Y A+I+K+VD+KTRSK S+N LLR+
Sbjct: 236 LPSKD-----GHYNRYSAIIVKQVDKKTRSKVSLNELLRE 270


>gi|237729472|ref|ZP_04559953.1| tetrahydrodipicolinate N-succinyltransferase [Citrobacter sp. 30_2]
 gi|226909201|gb|EEH95119.1| tetrahydrodipicolinate N-succinyltransferase [Citrobacter sp. 30_2]
          Length = 274

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 155/282 (54%), Positives = 202/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + +  P +V    ++AV   + LLD G +R+A + + G W TH
Sbjct: 1   MQQLQNVIESAFER---RADITPANVDTVTREAVNQVISLLDSGALRVAEKIE-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF ++    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFANYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|188577153|ref|YP_001914082.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84367473|dbj|BAE68631.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succin [Xanthomonas
           oryzae pv. oryzae MAFF 311018]
 gi|188521605|gb|ACD59550.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succin [Xanthomonas
           oryzae pv. oryzae PXO99A]
          Length = 398

 Score =  293 bits (749), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 187/273 (68%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  D  G W  + W+KKA+LL 
Sbjct: 130 IESAFERRATLTMDEIDGSTRAMVTRVIDGLESGEFRVAEPDGQGGWAVNAWLKKAVLLY 189

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +    F K   R++PG + R  +Y G   VLM
Sbjct: 190 FRVNEMAVIDAQP--APFWDKVESRFAGFHEAQFRKAGVRVVPGAVARRGSYFGKDVVLM 247

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 248 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 307

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 308 GARSEVVEGVVIGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 365

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD +TRSKTS+N LLR
Sbjct: 366 ----GSHSLYCAVIVKQVDARTRSKTSVNELLR 394


>gi|167846306|ref|ZP_02471814.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia pseudomallei B7210]
          Length = 275

 Score =  293 bits (749), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++   ++++AV   ++ LDRG +R+A + D G W  HQW+KKA
Sbjct: 5   LQQIIDNTWENRAELSPKAASAEIREAVAHAIEQLDRGALRVAEKID-GAWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ P+
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPA 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDAKTRAKIGLNELLR 273


>gi|293394698|ref|ZP_06638990.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Serratia odorifera DSM 4582]
 gi|291422824|gb|EFE96061.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Serratia odorifera DSM 4582]
          Length = 274

 Score =  293 bits (749), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 157/282 (55%), Positives = 202/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIESAFER---RADITPANVDSVTREAVNQVIGLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN   I+ DG   + ++DK+P KF D+    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRIN-DNIVMDG-AETRYYDKVPMKFADYDEARFQQEGFRVVPPASVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|166712722|ref|ZP_02243929.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 398

 Score =  293 bits (749), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 188/273 (68%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  D +G W  + W+KKA+LL 
Sbjct: 130 IESAFERRATLTIDEIDGSTRALVTRVIDGLESGEFRVAEPDGHGGWAVNAWLKKAVLLY 189

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +    F K   R++PG + R  +Y G   VLM
Sbjct: 190 FRVNEMAVIDAQP--APFWDKVESRFAGFHEAQFRKAGVRVVPGAVARRGSYFGKDVVLM 247

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 248 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 307

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 308 GARSEVVEGVVIGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 365

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD +TRSKTS+N LLR
Sbjct: 366 ----GSHSLYCAVIVKQVDARTRSKTSVNELLR 394


>gi|331645308|ref|ZP_08346419.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli M605]
 gi|330910016|gb|EGH38526.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli AA86]
 gi|331046065|gb|EGI18184.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli M605]
          Length = 274

 Score =  293 bits (749), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 200/282 (70%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W  H
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVAH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF ++    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFANYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|253687334|ref|YP_003016524.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251753912|gb|ACT11988.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 275

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 155/279 (55%), Positives = 199/279 (71%), Gaps = 15/279 (5%)

Query: 8   LEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W THQW+
Sbjct: 5   LQNIIETAFER---RAEITPANADTVTREAVNQAISLLDSGALRVAEKID-GQWVTHQWL 60

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  +++      + ++DK+P KF ++    F++  FR++P   VR  A+I
Sbjct: 61  KKAVLLSFRINDNQVMEGSE--TRYYDKVPMKFANYDEARFQREGFRVVPPASVRQGAFI 118

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 119 ARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 178

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGEI YG VP+ SVVV G+
Sbjct: 179 IEDNCFIGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVVSGN 238

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 239 LPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 272


>gi|170768626|ref|ZP_02903079.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia albertii TW07627]
 gi|170122730|gb|EDS91661.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia albertii TW07627]
          Length = 274

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 155/282 (54%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + +LD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREAVNQVIAMLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      S ++DK+P KF ++    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQMVEGAE--SRYFDKVPMKFANYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|320540030|ref|ZP_08039686.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Serratia symbiotica str. Tucson]
 gi|320029879|gb|EFW11902.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Serratia symbiotica str. Tucson]
          Length = 274

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 152/282 (53%), Positives = 200/282 (70%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + E  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIESAFER---RAEMTPANVDTVTREAVNQVIGLLDNGTLRVAEKRD-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  K++      + ++DK+P KF  +    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNKVMEGAK--TRYYDKVPMKFAGYDEARFQKEGFRVVPPASVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG ++ EGSV+ MGV++G+ST+I DR TG++ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGMVVEEGSVISMGVYLGQSTRIYDRETGKVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|332994207|gb|AEF04262.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Alteromonas sp. SN2]
          Length = 274

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 146/279 (52%), Positives = 194/279 (69%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L+ II+  FE   N    S P +VK AV   + LL+ G  R+A +   G W  HQW+
Sbjct: 1   MNELKAIIEDAFENRDNISPSSAPAEVKQAVADAIALLNSGKARVAEKIA-GEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LL F+++   +I      S ++DK+P K+ ++  + F     RI+P   VR   ++
Sbjct: 60  KKAVLLFFRLHNNDVIEGAE--SRYYDKVPLKYSNYTAEQFANDGARIVPPAAVRTGTFV 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G  AV+MPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 GKNAVVMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG I+ EG+V+ MGV+I +ST+I DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVIVEEGAVISMGVYISQSTRIYDRETGEVHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS + K       LY A+I+KKVD KTR+K  IN LLR
Sbjct: 238 MPSPDGKYS-----LYAAIIVKKVDAKTRAKVGINALLR 271


>gi|239815697|ref|YP_002944607.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Variovorax paradoxus S110]
 gi|259586171|sp|C5CLT4|DAPD_VARPS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|239802274|gb|ACS19341.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Variovorax paradoxus S110]
          Length = 277

 Score =  292 bits (748), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 203/281 (72%), Gaps = 5/281 (1%)

Query: 4   IVSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L++IID+ +E+ +N  + + P +V+DAV+  +  L+ G +R+A+R+  G W  HQW
Sbjct: 1   MTQQLQQIIDAAWEDRANISSSAAPAEVRDAVEHVISELNNGKLRVATRESVGQWTVHQW 60

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF++   + +  G+    ++DK+P KF      + ++   RI+P  + R  +Y
Sbjct: 61  IKKAVLLSFRLKDNEQMQAGS--LGFYDKVPTKFSHLSANELKESGVRIVPPAVARRGSY 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   A+LMPS+VN+GAY+GEG+M+DTW+TVGSCAQIG NVH+SGGVGIGGVLEP+Q GPT
Sbjct: 119 IAKGAILMPSYVNIGAYVGEGTMVDTWATVGSCAQIGANVHLSGGVGIGGVLEPLQAGPT 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEG +I E SVLGMGV+IG+ST I +R+TGE ++G VPS SVV+ G
Sbjct: 179 IIEDNCFIGARSEVVEGVVIEENSVLGMGVYIGQSTPIFNRDTGETSFGRVPSGSVVISG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           + P     G       Y A+I+K VD +TRSKTS+N LLRD
Sbjct: 239 NLPKKTKSGQEY--STYAAIIVKTVDAQTRSKTSLNDLLRD 277


>gi|260596586|ref|YP_003209157.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Cronobacter turicensis z3032]
 gi|260215763|emb|CBA28172.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylateN-succinyltransferase
           [Cronobacter turicensis z3032]
          Length = 274

 Score =  292 bits (748), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + +  P +V    ++AV   + LLD G +R+A +  NG W TH
Sbjct: 1   MQQLQNVIESAFER---RADITPANVDAVTREAVNQVIALLDSGELRVAEKI-NGEWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF ++    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFANYDEARFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTKIYDRETGEVFYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKD-----GTYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|167837052|ref|ZP_02463935.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Burkholderia thailandensis MSMB43]
          Length = 275

 Score =  292 bits (748), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 146/276 (52%), Positives = 201/276 (72%), Gaps = 8/276 (2%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++IID+ +E  +    ++   ++++AV   ++ LDRG +R+A + D G W  HQW+KKA
Sbjct: 5   LQQIIDNAWENRAELSPKAASAEIREAVAHAIEQLDRGALRVAEKID-GAWTVHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GY+ ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYTQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            +         LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD-----GAYSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|161484690|ref|NP_778337.3| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xylella fastidiosa Temecula1]
 gi|71153317|sp|Q87F51|DAPD_XYLFT RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|28056083|gb|AAO27986.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xylella fastidiosa Temecula1]
          Length = 277

 Score =  292 bits (747), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 144/281 (51%), Positives = 192/281 (68%), Gaps = 12/281 (4%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           T+VS +E   D+F   S    E I   ++  V   +D L+ G  R+A  D++G W  ++W
Sbjct: 4   TLVSAIE---DAFARYSTLTVEEIEDSIRPTVNRVIDGLETGAFRVAEPDNHGGWKVNEW 60

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LL F+++ T I+      + +WDK+ ++F  +    F     R++PG I R  +Y
Sbjct: 61  LKKAVLLYFRVHDTTIVDAQP--APFWDKVESRFSGYDAVKFRAAGVRVVPGAIARRGSY 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
            G   VLMPSF N+GAY+GEG+MIDTW+TVGSCAQ+G + H+SGG  IGGVLEP+Q  P 
Sbjct: 119 FGKDVVLMPSFTNIGAYVGEGTMIDTWATVGSCAQLGAHCHLSGGAAIGGVLEPLQASPA 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIED+CFIGARSE+VEG I+   SV+GMGVFI +ST+I +R TGEI+YG VP YSVVV G
Sbjct: 179 IIEDHCFIGARSEVVEGVIVGHHSVIGMGVFISQSTRIYNRATGEISYGYVPPYSVVVSG 238

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
             P+ +      G H LYCAVI+K+VDEKTR+KTSIN LLR
Sbjct: 239 QLPAKD------GTHSLYCAVIVKQVDEKTRAKTSINELLR 273


>gi|187477919|ref|YP_785943.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Bordetella avium 197N]
 gi|123515304|sp|Q2L2J5|DAPD_BORA1 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|115422505|emb|CAJ49030.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bordetella avium 197N]
          Length = 273

 Score =  292 bits (747), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 152/277 (54%), Positives = 201/277 (72%), Gaps = 11/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+  I+  +E  +N        +V++AV+ T+D LD+G +R+A +  +G W  HQWIKKA
Sbjct: 5   LQTTIEKAWESRANLSPADASAEVREAVEHTIDALDQGRLRVADKS-SGEWIVHQWIKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++   +++  G    T++DK+  KF D+    F+   +R++P  + R  ++IG  
Sbjct: 64  VLLSFRLQDNEVM--GEAPLTFYDKVQTKFADFGAAAFKAGGYRVVPPAVARRGSFIGRN 121

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 122 VVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED 181

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG ++ E SVL MGVF+ +STKI DR TG ITYG VPS SVVVPGS PS
Sbjct: 182 NCFIGARSEVVEGVVVEENSVLAMGVFLSQSTKIFDRATGTITYGRVPSGSVVVPGSLPS 241

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H L CAVI+K+VD +TR+KTSIN LLR
Sbjct: 242 AD------GSHSLACAVIVKRVDAQTRAKTSINDLLR 272


>gi|218688041|ref|YP_002396253.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Escherichia coli ED1a]
 gi|218425605|emb|CAR06391.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Escherichia coli ED1a]
          Length = 274

 Score =  292 bits (747), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KK++LLSF+IN  ++I      S ++DK+P KF ++    F+K  FR++P   VR  
Sbjct: 57  QWLKKSVLLSFRINDNQVIEGAE--SRYFDKVPMKFANYDEALFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|209521618|ref|ZP_03270314.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia sp. H160]
 gi|295676834|ref|YP_003605358.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia sp. CCGE1002]
 gi|209497945|gb|EDZ98104.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia sp. H160]
 gi|295436677|gb|ADG15847.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Burkholderia sp. CCGE1002]
          Length = 275

 Score =  292 bits (747), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 203/277 (73%), Gaps = 10/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+ IID+ ++  +    ++ P +V++AV   ++ LD+G +R+A + D G W  +QW+KKA
Sbjct: 5   LQSIIDTAWDNRAELSPKAAPAEVREAVAHAIEQLDKGALRVAEKKD-GDWVVNQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++     +  G GYS ++DK+P+KF ++  +DF    FR++P  I R  ++I   
Sbjct: 64  VLLSFRLEDNAPMPAG-GYSQFYDKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKN 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+ N+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSYTNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SV+ MGV++G+STKI DR TGE+TYG +P+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H LYCAVI+KKVD KTR+K  +N LLR
Sbjct: 243 KD------GTHSLYCAVIVKKVDAKTRAKVGLNELLR 273


>gi|289670210|ref|ZP_06491285.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 402

 Score =  291 bits (746), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 188/273 (68%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  +  G W  + W+KKA+LL 
Sbjct: 134 IESAFERRATLTMDEIDGSTRAMVTRVIDGLESGEFRVAEPNGQGGWTVNAWLKKAVLLY 193

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +   +F K   R++PG + R  +Y G   VLM
Sbjct: 194 FRVNEMAVIDAQP--APFWDKVESRFAGFHEAEFRKAGVRVVPGAVARRGSYFGRDVVLM 251

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 252 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 311

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 312 GARSEVVEGVVIGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 369

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD KTRSKTS+N LLR
Sbjct: 370 ----GSHSLYCAVIVKQVDAKTRSKTSVNELLR 398


>gi|289662919|ref|ZP_06484500.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 401

 Score =  291 bits (746), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 188/273 (68%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  +  G W  + W+KKA+LL 
Sbjct: 133 IESAFERRATLTMDEIDGSTRAMVTRVIDGLESGEFRVAEPNGQGGWTVNAWLKKAVLLY 192

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +   +F K   R++PG + R  +Y G   VLM
Sbjct: 193 FRVNEMAVIDAQP--APFWDKVESRFAGFHEAEFRKAGVRVVPGAVARRGSYFGRDVVLM 250

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 251 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 310

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 311 GARSEVVEGVVIGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 368

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD KTRSKTS+N LLR
Sbjct: 369 ----GSHSLYCAVIVKQVDAKTRSKTSVNELLR 397


>gi|21960063|gb|AAM86690.1|AE013914_10 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis KIM 10]
 gi|45437443|gb|AAS62994.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis biovar Microtus str. 91001]
          Length = 289

 Score =  291 bits (746), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 152/284 (53%), Positives = 203/284 (71%), Gaps = 15/284 (5%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWN 58
           T +  L+ +I++ FE    + +  P +V    ++A+   +DLLD G +R+A + D G W 
Sbjct: 14  TKMQQLQNVIETAFER---RADITPANVDTVTREAITHVIDLLDTGALRVAEKID-GQWV 69

Query: 59  THQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVR 118
           THQW+KKA+LLSF+IN  +++      + ++DK+P KF  +    F++  FR++P   VR
Sbjct: 70  THQWLKKAVLLSFRINDNQVMEGAE--TRYYDKVPMKFAGYDEARFQREGFRVVPPATVR 127

Query: 119 HSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQ 178
             A+I    VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q
Sbjct: 128 KGAFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQ 187

Query: 179 TGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSV 238
             PTIIEDNCF+GARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGE+ YG VP+ SV
Sbjct: 188 ANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEVHYGRVPAGSV 247

Query: 239 VVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           VV G+ PS +         LYCAVI+KKVD KTRSK  IN LLR
Sbjct: 248 VVSGNLPSKD-----GSYSLYCAVIVKKVDAKTRSKVGINELLR 286


>gi|269138090|ref|YP_003294790.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Edwardsiella tarda EIB202]
 gi|267983750|gb|ACY83579.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Edwardsiella tarda EIB202]
 gi|304558134|gb|ADM40798.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Edwardsiella tarda FL6-60]
          Length = 274

 Score =  291 bits (746), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 155/282 (54%), Positives = 202/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + E  P +     ++AV   + LLD G +R+A +  NG W TH
Sbjct: 1   MQQLQTVIENAFER---RAEITPANADSITREAVSQVIALLDSGALRVAEKI-NGEWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF D+    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNRLMEGAE--TRFYDKVPMKFADYDEARFQREGFRVVPPASVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGVFIG+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVFIGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS   +GD +   LYCAVI+KKVD KT  K  IN LLR
Sbjct: 235 SGNLPS--KRGDYS---LYCAVIVKKVDAKTLGKVGINELLR 271


>gi|58426202|gb|AAW75239.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succin [Xanthomonas
           oryzae pv. oryzae KACC10331]
          Length = 439

 Score =  291 bits (746), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 187/273 (68%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  D  G W  + W+KKA+LL 
Sbjct: 171 IESAFERRATLTMDEIDGSTRAMVTRVIDGLESGEFRVAEPDGQGGWAVNAWLKKAVLLY 230

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +    F K   R++PG + R  +Y G   VLM
Sbjct: 231 FRVNEMAVIDAQP--APFWDKVESRFAGFHEAQFRKAGVRVVPGAVARRGSYFGKDVVLM 288

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 289 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 348

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 349 GARSEVVEGVVIGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 406

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD +TRSKTS+N LLR
Sbjct: 407 ----GSHSLYCAVIVKQVDARTRSKTSVNELLR 435


>gi|71275917|ref|ZP_00652200.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xylella fastidiosa Dixon]
 gi|71900003|ref|ZP_00682148.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xylella fastidiosa Ann-1]
 gi|170729330|ref|YP_001774763.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xylella fastidiosa M12]
 gi|71163294|gb|EAO13013.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xylella fastidiosa Dixon]
 gi|71730213|gb|EAO32299.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xylella fastidiosa Ann-1]
 gi|167964123|gb|ACA11133.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Xylella fastidiosa M12]
          Length = 300

 Score =  291 bits (746), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 143/284 (50%), Positives = 193/284 (67%), Gaps = 12/284 (4%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
            +VS +E   D+F   S    E I   ++  V   +D L+ G  R+A  D++G W  ++W
Sbjct: 27  ALVSAIE---DAFARYSTLTVEEIEDSIRPTVNRVIDGLETGAFRVAEPDNHGGWKVNEW 83

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LL F+++ T I+      + +WDK+ ++F  +    F     R++PG I R  +Y
Sbjct: 84  LKKAVLLYFRVHDTTIVDAQP--APFWDKVESRFSGYDAVKFRAAGVRVVPGAIARRGSY 141

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
            G   VLMPSF N+GAY+GEG+MIDTW+TVGSCAQ+G + H+SGG  IGGVLEP+Q  P 
Sbjct: 142 FGKDVVLMPSFTNIGAYVGEGTMIDTWATVGSCAQLGAHCHLSGGAAIGGVLEPLQASPA 201

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIED+CFIGARSE+VEG I+   SV+GMGVFI +ST+I +R TGEI+YG VP YSVVV G
Sbjct: 202 IIEDHCFIGARSEVVEGVIVGHHSVIGMGVFISQSTRIYNRATGEISYGYVPPYSVVVSG 261

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLRDYS 285
             P+ +      G H LYCAVI+K+VDEKTR+KTSIN LLR ++
Sbjct: 262 QLPAKD------GTHSLYCAVIVKQVDEKTRAKTSINELLRGFA 299


>gi|182680650|ref|YP_001828810.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xylella fastidiosa M23]
 gi|182630760|gb|ACB91536.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Xylella fastidiosa M23]
 gi|307579109|gb|ADN63078.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 300

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 144/281 (51%), Positives = 192/281 (68%), Gaps = 12/281 (4%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           T+VS +E   D+F   S    E I   ++  V   +D L+ G  R+A  D++G W  ++W
Sbjct: 27  TLVSAIE---DAFARYSTLTVEEIEDSIRPTVNRVIDGLETGAFRVAEPDNHGGWKVNEW 83

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LL F+++ T I+      + +WDK+ ++F  +    F     R++PG I R  +Y
Sbjct: 84  LKKAVLLYFRVHDTTIVDAQP--APFWDKVESRFSGYDAVKFRAAGVRVVPGAIARRGSY 141

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
            G   VLMPSF N+GAY+GEG+MIDTW+TVGSCAQ+G + H+SGG  IGGVLEP+Q  P 
Sbjct: 142 FGKDVVLMPSFTNIGAYVGEGTMIDTWATVGSCAQLGAHCHLSGGAAIGGVLEPLQASPA 201

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIED+CFIGARSE+VEG I+   SV+GMGVFI +ST+I +R TGEI+YG VP YSVVV G
Sbjct: 202 IIEDHCFIGARSEVVEGVIVGHHSVIGMGVFISQSTRIYNRATGEISYGYVPPYSVVVSG 261

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
             P+ +      G H LYCAVI+K+VDEKTR+KTSIN LLR
Sbjct: 262 QLPAKD------GTHSLYCAVIVKQVDEKTRAKTSINELLR 296


>gi|238918770|ref|YP_002932284.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Edwardsiella ictaluri 93-146]
 gi|259586143|sp|C5BHB3|DAPD_EDWI9 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|238868338|gb|ACR68049.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase,
           putative [Edwardsiella ictaluri 93-146]
          Length = 274

 Score =  291 bits (745), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 155/282 (54%), Positives = 202/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + E  P +     ++AV   + LLD G +R+A +  NG W TH
Sbjct: 1   MQQLQTVIENAFER---RAEITPANTDSITREAVSQVIALLDSGALRVAEKI-NGEWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF D+    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNRLMEGAE--TRFYDKVPMKFADYDEARFQREGFRVVPPASVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGVFIG+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVFIGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS   +GD +   LYCAVI+KKVD KT  K  IN LLR
Sbjct: 235 SGNLPS--KRGDYS---LYCAVIVKKVDAKTLGKVGINELLR 271


>gi|238784876|ref|ZP_04628876.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia bercovieri ATCC 43970]
 gi|238714193|gb|EEQ06205.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia bercovieri ATCC 43970]
          Length = 281

 Score =  291 bits (745), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 152/282 (53%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + E  P +V    ++A+   +DLLD G +R+A + D G W TH
Sbjct: 8   MQQLQNVIETAFER---RAEITPANVDTITREAINHVIDLLDTGALRVAEKID-GQWVTH 63

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF  +    F++  FR++P   VR  
Sbjct: 64  QWLKKAVLLSFRINDNQVMEGAE--TRYYDKVPMKFAGYDEARFQREGFRVVPPATVRKG 121

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 122 AFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 181

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCF+GARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 182 PTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVV 241

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 242 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 278


>gi|118602130|ref|YP_903345.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
 gi|118567069|gb|ABL01874.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
          Length = 271

 Score =  291 bits (744), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 192/276 (69%), Gaps = 8/276 (2%)

Query: 8   LEEIIDSFFEES-NSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           +++II+  FE+  N   +S   ++K AV   +  LD G  R+A +   G W  ++W+KKA
Sbjct: 1   MKDIIEQAFEDRVNINPQSASMEIKQAVAEAIHFLDSGQARVAEQKGVGDWVVNEWLKKA 60

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++    ++    G++ ++DK+ +KF D    +F     R++P    R  ++I   
Sbjct: 61  VLLSFRLEDNVVMQ--GGFTQYFDKVSSKFADMSADEFNATGVRVVPPASARRGSFIAKD 118

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS++N+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGG GIGGVLEP+Q  PTIIED
Sbjct: 119 TVLMPSYINIGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGAGIGGVLEPLQASPTIIED 178

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ +G+V+ MGV+IG+STKI +R T EITYG +P+ SVVVPG+ PS
Sbjct: 179 NCFIGARSEVVEGVIVEQGAVISMGVYIGQSTKIFNRKTKEITYGRIPAGSVVVPGNLPS 238

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            +         LYCAVI+K+V+ KTRSK  IN LLR
Sbjct: 239 KD-----GAYSLYCAVIVKQVNTKTRSKVGINELLR 269


>gi|237640599|pdb|3GOS|A Chain A, The Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2-
           Carboxylate N-Succinyltransferase From Yersinia Pestis
           Co92
 gi|237640600|pdb|3GOS|B Chain B, The Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2-
           Carboxylate N-Succinyltransferase From Yersinia Pestis
           Co92
 gi|237640601|pdb|3GOS|C Chain C, The Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2-
           Carboxylate N-Succinyltransferase From Yersinia Pestis
           Co92
          Length = 276

 Score =  291 bits (744), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 151/282 (53%), Positives = 202/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++A+   +DLLD G +R+A + D G W TH
Sbjct: 3   MQQLQNVIETAFER---RADITPANVDTVTREAITHVIDLLDTGALRVAEKID-GQWVTH 58

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF  +    F++  FR++P   VR  
Sbjct: 59  QWLKKAVLLSFRINDNQVMEGAE--TRYYDKVPMKFAGYDEARFQREGFRVVPPATVRKG 116

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 117 AFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 176

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCF+GARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 177 PTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEVHYGRVPAGSVVV 236

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTRSK  IN LLR
Sbjct: 237 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRSKVGINELLR 273


>gi|108806512|ref|YP_650428.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia pestis Antiqua]
 gi|108813120|ref|YP_648887.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia pestis Nepal516]
 gi|145598954|ref|YP_001163030.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia pestis Pestoides F]
 gi|149366958|ref|ZP_01888991.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis CA88-4125]
 gi|153947374|ref|YP_001399994.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia pseudotuberculosis IP 31758]
 gi|161484767|ref|NP_670439.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia pestis KIM 10]
 gi|161511343|ref|NP_994117.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia pestis biovar Microtus str. 91001]
 gi|162418585|ref|YP_001607774.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia pestis Angola]
 gi|165927146|ref|ZP_02222978.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165939856|ref|ZP_02228396.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|166011891|ref|ZP_02232789.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166211586|ref|ZP_02237621.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167400043|ref|ZP_02305561.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167419536|ref|ZP_02311289.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167425334|ref|ZP_02317087.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|167468857|ref|ZP_02333561.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis FV-1]
 gi|170023312|ref|YP_001719817.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia pseudotuberculosis YPIII]
 gi|218928209|ref|YP_002346084.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia pestis CO92]
 gi|229837748|ref|ZP_04457908.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis Pestoides A]
 gi|229840970|ref|ZP_04461129.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229843071|ref|ZP_04463221.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229903562|ref|ZP_04518675.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis Nepal516]
 gi|270487343|ref|ZP_06204417.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis KIM D27]
 gi|294503058|ref|YP_003567120.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis Z176003]
 gi|71153318|sp|Q8ZH69|DAPD_YERPE RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|123372699|sp|Q1CAN9|DAPD_YERPA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|123372990|sp|Q1CFE3|DAPD_YERPN RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|166224233|sp|A4TL95|DAPD_YERPP RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|167012029|sp|A7FFG6|DAPD_YERP3 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724198|sp|A9R398|DAPD_YERPG RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|226724199|sp|B1JQF7|DAPD_YERPY RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|108776768|gb|ABG19287.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis Nepal516]
 gi|108778425|gb|ABG12483.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis Antiqua]
 gi|115346820|emb|CAL19706.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis CO92]
 gi|145210650|gb|ABP40057.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis Pestoides F]
 gi|149290572|gb|EDM40648.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis CA88-4125]
 gi|152958869|gb|ABS46330.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pseudotuberculosis IP 31758]
 gi|162351400|gb|ABX85348.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis Angola]
 gi|165912259|gb|EDR30896.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|165921042|gb|EDR38266.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165989157|gb|EDR41458.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166207357|gb|EDR51837.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166962277|gb|EDR58298.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167050751|gb|EDR62159.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Antiqua str. UG05-0454]
 gi|167055734|gb|EDR65518.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|169749846|gb|ACA67364.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pseudotuberculosis YPIII]
 gi|229679332|gb|EEO75435.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis Nepal516]
 gi|229689947|gb|EEO82006.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis biovar Orientalis str. India 195]
 gi|229697336|gb|EEO87383.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229704125|gb|EEO91137.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis Pestoides A]
 gi|262361094|gb|ACY57815.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis D106004]
 gi|262365336|gb|ACY61893.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis D182038]
 gi|270335847|gb|EFA46624.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pestis KIM D27]
 gi|294353517|gb|ADE63858.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis Z176003]
 gi|320014175|gb|ADV97746.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pestis biovar Medievalis str. Harbin 35]
          Length = 274

 Score =  291 bits (744), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 151/282 (53%), Positives = 202/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++A+   +DLLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RADITPANVDTVTREAITHVIDLLDTGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF  +    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVMEGAE--TRYYDKVPMKFAGYDEARFQREGFRVVPPATVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCF+GARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTRSK  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRSKVGINELLR 271


>gi|301630236|ref|XP_002944228.1| PREDICTED: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase-like [Xenopus (Silurana)
           tropicalis]
          Length = 484

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/281 (53%), Positives = 203/281 (72%), Gaps = 8/281 (2%)

Query: 4   IVSTLEEIIDSFFEESNS-KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           IV  L+ IID+ +E+  +  ++S PQ+V+DAV+  +  LD G +R+ASR+  G W  HQW
Sbjct: 211 IVQQLQTIIDAAWEQRAAISSQSAPQEVRDAVEHVIHELDGGHLRVASREGTGQWTVHQW 270

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF++N    I+ G+    ++DK+P KF      +      R++P  + R  ++
Sbjct: 271 IKKAVLLSFRLNDNVAINAGD--LGFYDKVPTKFAGLDAGELAATGVRVVPPAVARRGSF 328

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   A+LMPS+VN+GAY+ EG+M+DTW+TVGSCAQ+GKNVH+SGGVG+GGVLEP+Q  PT
Sbjct: 329 IAKGAILMPSYVNIGAYVDEGTMVDTWATVGSCAQVGKNVHLSGGVGLGGVLEPLQANPT 388

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSEIVEG I+ E +V+ MGV+IG+ST I DR TGEI+YG VP+ +VV+ G
Sbjct: 389 IIEDNCFIGARSEIVEGVIVEENAVISMGVYIGQSTPIYDRATGEISYGRVPAGAVVISG 448

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S P      D     LY A+I+K+VD +TR+KTS+N LLRD
Sbjct: 449 SLPK-----DGGKYSLYAAIIVKRVDAQTRAKTSLNDLLRD 484


>gi|78047043|ref|YP_363218.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|78035473|emb|CAJ23118.1| Tetrahydrodipicolinate N-succinyltransferase [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 285

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 188/273 (68%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  D  G W  ++W+KKA+LL 
Sbjct: 17  IESAFERRATLTMDEIDGSTRAIVNRVIDGLESGQFRVAEPDGQGGWTVNEWLKKAVLLY 76

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +   +F K   R++PG + R  +Y G   VLM
Sbjct: 77  FRVNEMAVIEAQP--APFWDKVESRFAGFHEAEFRKAGVRVVPGAVARRGSYFGKDVVLM 134

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q   TIIED+CFI
Sbjct: 135 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASSTIIEDHCFI 194

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 195 GARSEVVEGVVIGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 252

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD KTRSKTS+N LLR
Sbjct: 253 ----GSHSLYCAVIVKQVDAKTRSKTSVNELLR 281


>gi|319793478|ref|YP_004155118.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate n-succinyltransferase
           [Variovorax paradoxus EPS]
 gi|315595941|gb|ADU37007.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Variovorax paradoxus EPS]
          Length = 277

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 148/281 (52%), Positives = 202/281 (71%), Gaps = 5/281 (1%)

Query: 4   IVSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L++IID+ +E+ +N    + P +V+DAV+S +  L+ G +R+A+R+  G W  HQW
Sbjct: 1   MTQQLQQIIDAAWEDRANISPSAAPAEVRDAVESVITELNNGKLRVATRESVGKWTVHQW 60

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF++   + +  G+    ++DK+P KF      + ++   RI+P  + R  +Y
Sbjct: 61  IKKAVLLSFRLKDNEQMQAGS--LGFFDKVPTKFSHLSAAELKESGVRIVPPAVARRGSY 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   A+LMPS+VN+GAY+GEG+M+DTW+TVGSCAQIG NVH+SGGVGIGGVLEP+Q GPT
Sbjct: 119 IAKGAILMPSYVNIGAYVGEGTMVDTWATVGSCAQIGANVHLSGGVGIGGVLEPLQAGPT 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEG +I E SVLGMGV+IG+ST I +R+TGE  +G VPS SVV+ G
Sbjct: 179 IIEDNCFIGARSEVVEGVVIEENSVLGMGVYIGQSTPIFNRDTGETFFGRVPSGSVVISG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           + P     G       Y A+I+K VD +TRSKTS+N LLRD
Sbjct: 239 NLPKKTKSGQ--DYSTYAAIIVKTVDAQTRSKTSLNDLLRD 277


>gi|332529213|ref|ZP_08405177.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Hylemonella gracilis ATCC 19624]
 gi|332041436|gb|EGI77798.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Hylemonella gracilis ATCC 19624]
          Length = 274

 Score =  290 bits (743), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 201/277 (72%), Gaps = 8/277 (2%)

Query: 8   LEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L++ I++ +E+    + +S PQD+ DAV S +  L+ G +R+A+R+  G W  HQW+KKA
Sbjct: 5   LQQTIEAAWEDRTKLSPKSAPQDIADAVDSVIAQLNNGTLRVATRESVGQWTVHQWVKKA 64

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++   +++  G+    ++DK+P KF D   ++      R++P  + R  +YI   
Sbjct: 65  VLLSFRLKDNELVRAGD--LGFYDKVPTKFSDLSAQEMAATGVRVVPPAVARRGSYIAKG 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           A+LMPS+VN+GAY+ EG+M+DTW+TVGSCAQ+GKNVH+SGGVG+GGVLEP+Q  PTIIED
Sbjct: 123 AILMPSYVNIGAYVDEGTMVDTWATVGSCAQVGKNVHLSGGVGLGGVLEPLQANPTIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSEIVEG I+ E SV+ MGV+IG+STKI DR TG+I  G VP+ SVVV G+ PS
Sbjct: 183 NCFIGARSEIVEGVIVEENSVISMGVYIGQSTKIYDRATGQIHQGRVPAGSVVVAGNLPS 242

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            + K       LY A+I+KKVD KTRS TS+N LLRD
Sbjct: 243 ADGK-----YSLYAAIIVKKVDAKTRSTTSLNDLLRD 274


>gi|317493192|ref|ZP_07951615.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918852|gb|EFV40188.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 274

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 154/282 (54%), Positives = 202/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++AV   + LLD G +R+A +  NG W TH
Sbjct: 1   MQQLQTLIENAFER---RADITPANVDNITREAVNQVIALLDSGELRVAEKI-NGEWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  K++      + ++DK+P KF D+    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNKLMEGAE--TRFYDKVPMKFADYDEARFQREGFRVVPPASVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|122879152|ref|YP_200624.6| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|162319802|ref|YP_450905.2| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 285

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 187/273 (68%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  D  G W  + W+KKA+LL 
Sbjct: 17  IESAFERRATLTMDEIDGSTRAMVTRVIDGLESGEFRVAEPDGQGGWAVNAWLKKAVLLY 76

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +    F K   R++PG + R  +Y G   VLM
Sbjct: 77  FRVNEMAVIDAQP--APFWDKVESRFAGFHEAQFRKAGVRVVPGAVARRGSYFGKDVVLM 134

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 135 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 194

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 195 GARSEVVEGVVIGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 252

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD +TRSKTS+N LLR
Sbjct: 253 ----GSHSLYCAVIVKQVDARTRSKTSVNELLR 281


>gi|293606181|ref|ZP_06688545.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Achromobacter piechaudii ATCC 43553]
 gi|292815441|gb|EFF74558.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Achromobacter piechaudii ATCC 43553]
          Length = 273

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 155/282 (54%), Positives = 202/282 (71%), Gaps = 13/282 (4%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           + + +T+E   D   + +N        +V++AV+ T+D LD G +R+A +  N  W  HQ
Sbjct: 3   LDLQTTIERAWD---DRTNLSPTDASAEVREAVEHTIDGLDLGRLRVAEKI-NDDWVVHQ 58

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           WIKKA+LLSF++N   I+  G     ++DK+P KF ++    F++  +R++P  + R  A
Sbjct: 59  WIKKAVLLSFRLNDNAIM--GQAPLQFYDKVPLKFSEYGDNAFKQGGYRVVPPAVARRGA 116

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           YI    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P
Sbjct: 117 YIARNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANP 176

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIEDNCFIGARSE+VEG I+ E SVL MGVF+ +STKI DR TG+ITYG VPS SVVVP
Sbjct: 177 TIIEDNCFIGARSEVVEGVIVEENSVLAMGVFLSQSTKIFDRATGKITYGRVPSGSVVVP 236

Query: 242 GSYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           GS PS +      G H L CAVI+K+VD +TR+KTSIN LLR
Sbjct: 237 GSLPSAD------GSHSLACAVIVKRVDAQTRAKTSINDLLR 272


>gi|165932824|ref|YP_001649613.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rickettsia rickettsii str. Iowa]
 gi|165907911|gb|ABY72207.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia rickettsii str. Iowa]
          Length = 282

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 147/286 (51%), Positives = 200/286 (69%), Gaps = 16/286 (5%)

Query: 1   MITIVSTLEE---IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHW 57
           M +++  +EE   I D  F++S SK  ++ Q + D+++S    L++G +R+  + +N  W
Sbjct: 9   MSSLIKEVEEAWQIKDKLFQDS-SKLITLKQTLNDSIES----LNQGTVRVCEKKENS-W 62

Query: 58  NTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFD-DWKTKDFEKHNFRIIPGTI 116
           + ++W+KKAILL F    +++ +  N Y++W+DK+  KF  D     F++   R +PG I
Sbjct: 63  HVNEWVKKAILLYFITTESQLYN--NNYNSWYDKVAPKFSADTDKNTFKEAAIRTVPGAI 120

Query: 117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP 176
           VR  AYI    V+MPSF+N+GAYI EG+MIDTW+T+GSCAQIGKN HISGG GIGGVLEP
Sbjct: 121 VRTGAYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHISGGTGIGGVLEP 180

Query: 177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY 236
           +   P IIEDNCFIGARSEI EG I+ EG+V+ MGVFIG STKI+ R+TGEI YG +P+Y
Sbjct: 181 LHAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIVYRDTGEIIYGRIPAY 240

Query: 237 SVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           SVVVPG  P+     +   P LYC VI+K+VD+ TR+K  IN LLR
Sbjct: 241 SVVVPGVLPA----KETGKPGLYCVVIVKQVDKTTRAKVRINDLLR 282


>gi|161378154|ref|NP_297407.3| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xylella fastidiosa 9a5c]
 gi|71153316|sp|Q9PH32|DAPD_XYLFA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
          Length = 277

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 144/284 (50%), Positives = 192/284 (67%), Gaps = 12/284 (4%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
            +VS +E   D+F   S    E I   ++  V   +D L+ G  R+A  D++G W  ++W
Sbjct: 4   ALVSPIE---DAFARYSTLTVEEIEDSIRPTVNRVIDGLETGAFRVAEPDNHGGWKVNEW 60

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LL F+++ T I+      + +WDKI ++F  +    F     R++PG I R  +Y
Sbjct: 61  LKKAVLLYFRVHDTMIVDAQP--APFWDKIESRFSGYDAAKFRAAGVRVVPGAIARRGSY 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
            G   VLMPSF N+GAY+GEG+MIDTW+TVGSCAQ+G + H+SGG  IGGVLEP+Q  P 
Sbjct: 119 FGKDVVLMPSFTNIGAYVGEGTMIDTWATVGSCAQLGAHCHLSGGAAIGGVLEPLQASPA 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIED+CFIGARSEIVEG I+   SV+ MGVFI +ST+I +R TGEI+YG VP YSVVV G
Sbjct: 179 IIEDHCFIGARSEIVEGVIVGHHSVISMGVFISQSTRIYNRATGEISYGYVPPYSVVVSG 238

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLRDYS 285
             P+ +      G H LYCAVI+K+VDEKTR+KTSIN LLR ++
Sbjct: 239 QLPAKD------GTHSLYCAVIVKQVDEKTRAKTSINELLRGFA 276


>gi|213615998|ref|ZP_03371824.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Salmonella enterica subsp. enterica serovar Typhi str.
           E98-2068]
          Length = 261

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 152/252 (60%), Positives = 190/252 (75%), Gaps = 8/252 (3%)

Query: 31  KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWWD 90
           ++AV+  + LLD G +R+A + D G W THQW+KKA+LLSF+IN  ++I DG   S ++D
Sbjct: 15  REAVKQVISLLDSGALRVAEKID-GQWVTHQWLKKAVLLSFRINDNQVI-DG-AESRYFD 71

Query: 91  KIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWS 150
           K P KF D+    F+K  FR++P   VR  A+I    VLMPS+VN+GAY+ EG+M+DTW+
Sbjct: 72  KAPMKFADYDEARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWA 131

Query: 151 TVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGM 210
           TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIEDNCFIGARSE+VEG I+ EGSV+ M
Sbjct: 132 TVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISM 191

Query: 211 GVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEK 270
           GV++G+STKI DR TGE+ YG VP+ SVVV G+ PS + K       LYCAVI+KKVD K
Sbjct: 192 GVYLGQSTKIYDRETGEVHYGRVPAGSVVVSGNLPSKDGK-----YSLYCAVIVKKVDAK 246

Query: 271 TRSKTSINTLLR 282
           TR K  IN LLR
Sbjct: 247 TRGKVGINELLR 258


>gi|9104896|gb|AAF82927.1|AE003865_4 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Xylella fastidiosa 9a5c]
          Length = 299

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 144/284 (50%), Positives = 192/284 (67%), Gaps = 12/284 (4%)

Query: 3   TIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
            +VS +E   D+F   S    E I   ++  V   +D L+ G  R+A  D++G W  ++W
Sbjct: 26  ALVSPIE---DAFARYSTLTVEEIEDSIRPTVNRVIDGLETGAFRVAEPDNHGGWKVNEW 82

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LL F+++ T I+      + +WDKI ++F  +    F     R++PG I R  +Y
Sbjct: 83  LKKAVLLYFRVHDTMIVDAQP--APFWDKIESRFSGYDAAKFRAAGVRVVPGAIARRGSY 140

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
            G   VLMPSF N+GAY+GEG+MIDTW+TVGSCAQ+G + H+SGG  IGGVLEP+Q  P 
Sbjct: 141 FGKDVVLMPSFTNIGAYVGEGTMIDTWATVGSCAQLGAHCHLSGGAAIGGVLEPLQASPA 200

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIED+CFIGARSEIVEG I+   SV+ MGVFI +ST+I +R TGEI+YG VP YSVVV G
Sbjct: 201 IIEDHCFIGARSEIVEGVIVGHHSVISMGVFISQSTRIYNRATGEISYGYVPPYSVVVSG 260

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLRDYS 285
             P+ +      G H LYCAVI+K+VDEKTR+KTSIN LLR ++
Sbjct: 261 QLPAKD------GTHSLYCAVIVKQVDEKTRAKTSINELLRGFA 298


>gi|188992308|ref|YP_001904318.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xanthomonas campestris pv. campestris str. B100]
 gi|21112445|gb|AAM40682.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succin [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66574492|gb|AAY49902.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succin [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|167734068|emb|CAP52274.1| unnamed protein product [Xanthomonas campestris pv. campestris]
          Length = 390

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 141/273 (51%), Positives = 188/273 (68%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  D  G W  ++W+KKA+LL 
Sbjct: 122 IESAFERRAALTIDEIEGSTRAIVNRVIDGLESGEFRVAEPDGQGGWTVNEWLKKAVLLY 181

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +   +F +   R++PG + R  +Y G   VLM
Sbjct: 182 FRVNEMAVIDAQP--APFWDKVESRFAGFHEAEFRQAGVRVVPGAVARRGSYFGKDVVLM 239

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 240 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 299

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFI +ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 300 GARSEVVEGVVIGHHSVIGMGVFISQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 357

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD +TRSKTS+N LLR
Sbjct: 358 ----GSHSLYCAVIVKQVDARTRSKTSVNELLR 386


>gi|311107248|ref|YP_003980101.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           2 [Achromobacter xylosoxidans A8]
 gi|310761937|gb|ADP17386.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           2 [Achromobacter xylosoxidans A8]
          Length = 273

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 154/282 (54%), Positives = 203/282 (71%), Gaps = 13/282 (4%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           + + +T+E+  D   + +N        +V++AV+ T+D LD G +R+A +  N  W  HQ
Sbjct: 3   LDLQTTIEKAWD---DRANLSPTDASAEVREAVERTIDGLDLGRLRVAEKI-NDDWVVHQ 58

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           WIKKA+LLSF++N   I+  G     ++DK+P KF ++    F++  +R++P  + R  A
Sbjct: 59  WIKKAVLLSFRLNDNAIM--GQAPLQFYDKVPLKFSEYGDNAFKQGGYRVVPPAVARRGA 116

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           Y+    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P
Sbjct: 117 YLARNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANP 176

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIEDNCFIGARSE+VEG I+ E SVL MGVF+ +STKI DR TG+ITYG VPS SVVVP
Sbjct: 177 TIIEDNCFIGARSEVVEGVIVEENSVLAMGVFLSQSTKIYDRATGKITYGRVPSGSVVVP 236

Query: 242 GSYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           GS PS +      G H L CAVI+K+VD +TR+KTSIN LLR
Sbjct: 237 GSLPSAD------GSHSLACAVIVKRVDAQTRAKTSINDLLR 272


>gi|251790748|ref|YP_003005469.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Dickeya zeae Ech1591]
 gi|247539369|gb|ACT07990.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Dickeya zeae Ech1591]
          Length = 274

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 201/283 (71%), Gaps = 17/283 (6%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +V    ++AV   +  LD G++R+A +  NG W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANVDTVTREAVNQVISQLDSGVLRVAEKI-NGQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF  +    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQLMEGAE--TRYYDKVPMKFAGYDEARFQREGFRVVPPASVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGVFI +ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVFISQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ P+ +      G H LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPAKD------GSHSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|237748725|ref|ZP_04579205.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Oxalobacter formigenes OXCC13]
 gi|229380087|gb|EEO30178.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Oxalobacter formigenes OXCC13]
          Length = 281

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 149/282 (52%), Positives = 201/282 (71%), Gaps = 14/282 (4%)

Query: 8   LEEIIDSFFEESNS--KNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           L++II+  +E  +S    ++ P  ++ A+   +  LD G +R+A +  NG W  +QW KK
Sbjct: 7   LKQIIEEAWENRDSFAAGDTSPI-LRAAIAEVIRQLDCGQLRVAEKK-NGEWIVNQWTKK 64

Query: 66  AILLSFQIN---PTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           A+LLSF++       + +DG+    ++DK+ +KF ++  +DF K  FR++P  + R  +Y
Sbjct: 65  AVLLSFRLQENFAMPVGADGSPALHFYDKVTSKFANYTQEDFAKAGFRVVPPAVARLGSY 124

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           IG   V+MPSFVN+GAY+GEG+MIDTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q  PT
Sbjct: 125 IGKNVVMMPSFVNIGAYVGEGTMIDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQANPT 184

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSEIVEG I+ E SV+ MGV+IG+ST+I DR    I YG VPS SVVVPG
Sbjct: 185 IIEDNCFIGARSEIVEGVIVEENSVISMGVYIGQSTRIYDRENDRILYGRVPSGSVVVPG 244

Query: 243 SYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLRD 283
           + P      D  G + LYCAVI+K+V+  TR+KT+IN LLRD
Sbjct: 245 NIP------DPGGKYSLYCAVIVKRVNAVTRAKTAINDLLRD 280


>gi|123443488|ref|YP_001007461.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|238763983|ref|ZP_04624939.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia kristensenii ATCC 33638]
 gi|238787239|ref|ZP_04631038.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia frederiksenii ATCC 33641]
 gi|238792758|ref|ZP_04636389.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia intermedia ATCC 29909]
 gi|332160589|ref|YP_004297166.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
 gi|166224232|sp|A1JP86|DAPD_YERE8 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|122090449|emb|CAL13317.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia enterocolitica subsp. enterocolitica 8081]
 gi|238697800|gb|EEP90561.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia kristensenii ATCC 33638]
 gi|238724501|gb|EEQ16142.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia frederiksenii ATCC 33641]
 gi|238727866|gb|EEQ19389.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia intermedia ATCC 29909]
 gi|318606933|emb|CBY28431.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia enterocolitica subsp. palearctica Y11]
 gi|325664819|gb|ADZ41463.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
 gi|330859595|emb|CBX69935.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylateN-succinyltransferase
           [Yersinia enterocolitica W22703]
          Length = 274

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 151/282 (53%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++A+   +DLLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RADITPANVDTVTREAINHVIDLLDTGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF  +    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVMEGAE--TRYYDKVPMKFAGYDEARFQREGFRVVPPATVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCF+GARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|301049923|ref|ZP_07196846.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 185-1]
 gi|300298325|gb|EFJ54710.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Escherichia coli MS 185-1]
          Length = 274

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 200/282 (70%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  ++I      S ++DK+P KF ++    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVIEGAE--SRYFDKVPMKFANYDEALFQKEGFRVVPPAAVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNV +SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVPLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS + K       LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|21107601|gb|AAM36301.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succin [Xanthomonas
           axonopodis pv. citri str. 306]
          Length = 257

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 140/260 (53%), Positives = 183/260 (70%), Gaps = 9/260 (3%)

Query: 24  ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGN 83
           + I    +  V   +D L+ G  R+A  D  G W  ++W+KKA+LL F++N   +I    
Sbjct: 2   DEIDGSTRAIVTRVIDGLESGQFRVAEPDGQGGWTVNEWLKKAVLLYFRVNEMAVIDAQP 61

Query: 84  GYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEG 143
             + +WDK+ ++F  +   +F K   R++PG + R  +Y G   VLMPSF N+GAY+GEG
Sbjct: 62  --APFWDKVESRFAGFHEAEFRKAGVRVVPGAVARRGSYFGKDVVLMPSFTNIGAYVGEG 119

Query: 144 SMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIR 203
           +M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFIGARSE+VEG +I 
Sbjct: 120 TMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFIGARSEVVEGVVIG 179

Query: 204 EGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPH-LYCAV 262
             SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +      G H LYCAV
Sbjct: 180 HHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD------GSHSLYCAV 233

Query: 263 IIKKVDEKTRSKTSINTLLR 282
           I+K+VD KTRSKTS+N LLR
Sbjct: 234 IVKQVDAKTRSKTSVNELLR 253


>gi|238754811|ref|ZP_04616162.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia ruckeri ATCC 29473]
 gi|238706971|gb|EEP99337.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia ruckeri ATCC 29473]
          Length = 274

 Score =  289 bits (740), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 152/282 (53%), Positives = 200/282 (70%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + E  P +V    ++A+   ++LLD G +R+A + D G W TH
Sbjct: 1   MQQLQTVIENAFER---RAEMTPANVDTITREAINHVINLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  K++      + ++DK+P KF D+    F++  FR++    VR  
Sbjct: 57  QWLKKAVLLSFRINDNKVMEGAE--TRYYDKVPMKFADYDEARFQREGFRVVAPATVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCF+GARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KT  K  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|51597321|ref|YP_071512.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia pseudotuberculosis IP 32953]
 gi|186896426|ref|YP_001873538.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Yersinia pseudotuberculosis PB1/+]
 gi|71153319|sp|Q667I6|DAPD_YERPS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|226724197|sp|B2JZ37|DAPD_YERPB RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|51590603|emb|CAH22244.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Yersinia pseudotuberculosis IP 32953]
 gi|186699452|gb|ACC90081.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia pseudotuberculosis PB1/+]
          Length = 274

 Score =  289 bits (739), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 151/282 (53%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++A+   +DLLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RADITPANVDTVTREAITHVIDLLDTGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF  +    F+   FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVMEGAE--TRYYDKVPMKFAGYDEARFQHEGFRVVPPATVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCF+GARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTRSK  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRSKVGINELLR 271


>gi|319943841|ref|ZP_08018122.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Lautropia mirabilis ATCC 51599]
 gi|319743074|gb|EFV95480.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Lautropia mirabilis ATCC 51599]
          Length = 283

 Score =  289 bits (739), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 149/281 (53%), Positives = 203/281 (72%), Gaps = 14/281 (4%)

Query: 9   EEIIDSFFEESNSKNESI-PQDVKDAVQSTLDLLDRGIIRIASRDDNG------HWNTHQ 61
           + +I+S ++   + + S  PQDV+ AV+S L  LD G +R+A+R  +        WN HQ
Sbjct: 6   QALIESAWDNRQALSPSAAPQDVRQAVESVLADLDAGTLRVATRSADAAAEGAARWNVHQ 65

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           WIKKA+LLSF++     +    G   ++DK+P KFD    +DF +  +R++P  + R  +
Sbjct: 66  WIKKAVLLSFRLADN--VPMQAGMLQFFDKVPTKFDGMSAEDFARAGYRVVPPAVARRGS 123

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           +IG   VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIG+NVH+SGGVGIGGVLEP+Q  P
Sbjct: 124 FIGRNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGRNVHLSGGVGIGGVLEPLQANP 183

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIEDNCFIGARSE+VEG ++ E SVL MGV++ +STKI +R TG++ YG VPS SVVVP
Sbjct: 184 TIIEDNCFIGARSEVVEGVVVEENSVLAMGVYLSQSTKIYERETGKVYYGRVPSGSVVVP 243

Query: 242 GSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           GS PS +  G ++   L CAVI+K+VD +TR+KT+IN LLR
Sbjct: 244 GSLPSKD--GSVS---LACAVIVKRVDAQTRAKTAINDLLR 279


>gi|15619297|gb|AAL02781.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia conorii str. Malish 7]
          Length = 282

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 147/286 (51%), Positives = 199/286 (69%), Gaps = 16/286 (5%)

Query: 1   MITIVSTLEE---IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHW 57
           M +++  +EE   I D   ++S SK  ++ Q + D ++S    L++G IR+  + +N  W
Sbjct: 9   MSSLIKEIEEAWQIKDKLLQDS-SKLITLKQTLNDIIES----LNQGTIRVCEKQENS-W 62

Query: 58  NTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFD-DWKTKDFEKHNFRIIPGTI 116
           + ++W+KKAILL F    +++ +  N Y++W+DK+  KF  D     F++   R +PG +
Sbjct: 63  HVNEWVKKAILLYFITTESQLYN--NNYNSWYDKVAPKFSADTDKNTFKEAAIRKVPGAV 120

Query: 117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP 176
           VR   YI    V+MPSF+N+GAYI EG+MIDTW+T+GSCAQIGKN HISGG GIGGVLEP
Sbjct: 121 VRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHISGGTGIGGVLEP 180

Query: 177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY 236
           +Q  P IIEDNCFIGARSEI EG I+ EG+V+ MGVFIG STKI+ R+TGEI YG +P+Y
Sbjct: 181 LQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIVYRDTGEIIYGRIPAY 240

Query: 237 SVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           SVVVPG  P+     +   P LYC VI+K+VD+ TR+K SIN LLR
Sbjct: 241 SVVVPGVLPA----KEAGKPGLYCVVIVKQVDKTTRAKVSINDLLR 282


>gi|289208216|ref|YP_003460282.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Thioalkalivibrio sp. K90mix]
 gi|288943847|gb|ADC71546.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Thioalkalivibrio sp. K90mix]
          Length = 273

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 146/280 (52%), Positives = 203/280 (72%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S ++ II++ FE     N  ++  +V+DAV   + +LD G  R+A +   G W  ++W+
Sbjct: 1   MSDIKSIIETAFESRAEINPRNVETNVRDAVNEAMAMLDSGQARVAEKK-GGDWVVNEWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I   + I    G++ ++DK+P+K+ D  ++DF +   R++P    R  +YI
Sbjct: 60  KKAVLLSFRIAENEFIK--GGFTNYYDKVPSKYADTSSRDFREGGVRVVPPATARRGSYI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 APNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EG+V+ MGV++G+ST+I DR   EI YG VP+ +VVVPG+
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGAVISMGVYLGQSTRIYDRENDEILYGRVPAGAVVVPGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS + K       LYCAVI+K+VDEKT++K  +N LLRD
Sbjct: 238 LPSKDGK-----YSLYCAVIVKRVDEKTKAKVGLNALLRD 272


>gi|148260530|ref|YP_001234657.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidiphilium cryptum JF-5]
 gi|146402211|gb|ABQ30738.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidiphilium cryptum JF-5]
          Length = 644

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 193/277 (69%), Gaps = 2/277 (0%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + L   + + +E  +  + +     ++AV   L  LDRG +R+A     G W  HQW+K+
Sbjct: 369 TQLAAAVTAAWERRDQLSPAYQGSDREAVSDALARLDRGELRVAEPGPGG-WVVHQWLKQ 427

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           AIL+SF++ P + +  G G +  +DK+P KF DW    F     R +PG +VRHSA++G 
Sbjct: 428 AILMSFRLLPNRTMP-GAGGAPVFDKVPMKFGDWDDARFAAAGIRAVPGAVVRHSAHVGR 486

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMP F+N+GA +GE +MIDTWSTVGSCAQ+G+N HISGGVGIGGVLEP+Q  P IIE
Sbjct: 487 NTVLMPCFINVGARVGEDTMIDTWSTVGSCAQVGRNCHISGGVGIGGVLEPLQANPVIIE 546

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D+CFIGARSE+ EG I+  G+VL MGVF+G ST+I+DR TGE+ YG VP+YSVVVPG+ P
Sbjct: 547 DDCFIGARSEVAEGVIVERGAVLSMGVFLGASTRIVDRTTGEVIYGRVPAYSVVVPGTMP 606

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
              L     GP L CAVI+K+VD +TRSKT+IN LLR
Sbjct: 607 GKPLPDGTPGPSLACAVIVKRVDAQTRSKTAINELLR 643


>gi|326403723|ref|YP_004283805.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidiphilium multivorum AIU301]
 gi|325050585|dbj|BAJ80923.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidiphilium multivorum AIU301]
          Length = 279

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 192/277 (69%), Gaps = 2/277 (0%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + L   + + +E  +  + +     ++AV   L  LDRG +R+A     G W  HQW+K+
Sbjct: 4   TQLAAAVTAAWERRDQLSPAYQGSDREAVSDALARLDRGELRVAEPGPGG-WVVHQWLKQ 62

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           AIL+SF++ P + +  G G +  +DK+P KF DW    F     R +PG +VRHSA++G 
Sbjct: 63  AILMSFRLLPNRTMP-GAGGAPVFDKVPMKFGDWDDARFAAAGIRAVPGAVVRHSAHVGR 121

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMP F+N GA +GE +MIDTWSTVGSCAQ+G+N HISGGVGIGGVLEP+Q  P IIE
Sbjct: 122 NTVLMPCFINAGARVGEDTMIDTWSTVGSCAQVGRNCHISGGVGIGGVLEPLQANPVIIE 181

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D+CFIGARSE+ EG I+  G+VL MGVF+G ST+I+DR TGE+ YG VP+YSVVVPG+ P
Sbjct: 182 DDCFIGARSEVAEGVIVERGAVLSMGVFLGASTRIVDRTTGEVIYGRVPAYSVVVPGTMP 241

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
              L     GP L CAVI+K+VD +TRSKT+IN LLR
Sbjct: 242 GKPLPDGTPGPSLACAVIVKRVDAQTRSKTAINELLR 278


>gi|161723848|ref|NP_359880.2| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia conorii str. Malish 7]
 gi|71153305|sp|Q92J26|DAPD_RICCN RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
          Length = 274

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 147/286 (51%), Positives = 199/286 (69%), Gaps = 16/286 (5%)

Query: 1   MITIVSTLEE---IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHW 57
           M +++  +EE   I D   ++S SK  ++ Q + D ++S    L++G IR+  + +N  W
Sbjct: 1   MSSLIKEIEEAWQIKDKLLQDS-SKLITLKQTLNDIIES----LNQGTIRVCEKQEN-SW 54

Query: 58  NTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFD-DWKTKDFEKHNFRIIPGTI 116
           + ++W+KKAILL F    +++ +  N Y++W+DK+  KF  D     F++   R +PG +
Sbjct: 55  HVNEWVKKAILLYFITTESQLYN--NNYNSWYDKVAPKFSADTDKNTFKEAAIRKVPGAV 112

Query: 117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP 176
           VR   YI    V+MPSF+N+GAYI EG+MIDTW+T+GSCAQIGKN HISGG GIGGVLEP
Sbjct: 113 VRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHISGGTGIGGVLEP 172

Query: 177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY 236
           +Q  P IIEDNCFIGARSEI EG I+ EG+V+ MGVFIG STKI+ R+TGEI YG +P+Y
Sbjct: 173 LQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIVYRDTGEIIYGRIPAY 232

Query: 237 SVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           SVVVPG  P+     +   P LYC VI+K+VD+ TR+K SIN LLR
Sbjct: 233 SVVVPGVLPA----KEAGKPGLYCVVIVKQVDKTTRAKVSINDLLR 274


>gi|67459465|ref|YP_247089.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia felis URRWXCal2]
 gi|75536124|sp|Q4UKK3|DAPD_RICFE RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|67004998|gb|AAY61924.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia felis URRWXCal2]
          Length = 274

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 149/286 (52%), Positives = 199/286 (69%), Gaps = 16/286 (5%)

Query: 1   MITIVSTLEE---IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHW 57
           M +++  +EE   I D  F++S SK  ++ + + D ++S    L++G IR+  + +N  W
Sbjct: 1   MSSLIKEIEEAWQIKDKLFQDS-SKLITLKKTLNDIIES----LNQGTIRVCEKKEN-SW 54

Query: 58  NTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFD-DWKTKDFEKHNFRIIPGTI 116
             ++W+KKAILL F    +++ +  N Y++W+DK+  KF  D     F++   R +PG +
Sbjct: 55  EVNEWVKKAILLYFITTESQLYN--NNYNSWYDKVAPKFSADTDKNIFKEAAIRKVPGAV 112

Query: 117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP 176
           VR   YI    V+MPSF+N+GAYI EG+MIDTW+T+GSCAQIGKN HISGG GIGGVLEP
Sbjct: 113 VRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHISGGTGIGGVLEP 172

Query: 177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY 236
           +Q  P IIEDNCFIGARSEI EG I+ EG+V+ MGVFIG STKII R+TGEI YG +P+Y
Sbjct: 173 LQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIIYRDTGEIIYGRIPAY 232

Query: 237 SVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           SVVVPG  P+     +   P LYC VIIK+VD+ TR+K SIN LLR
Sbjct: 233 SVVVPGVLPA----KEAGKPGLYCVVIIKQVDKATRAKVSINDLLR 274


>gi|307129817|ref|YP_003881833.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Dickeya dadantii 3937]
 gi|306527346|gb|ADM97276.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Dickeya dadantii 3937]
          Length = 274

 Score =  289 bits (739), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 201/283 (71%), Gaps = 17/283 (6%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + +  P +V    ++AV   +  LD G++R+A +  NG W TH
Sbjct: 1   MQQLQNIIETAFER---RADITPANVDTVTREAVNQVISQLDSGMLRVAEKI-NGQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF  +    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQLMEGAE--TRYYDKVPMKFAGYDEARFQREGFRVVPPASVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGVFI +ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVFISQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ P+ +      G H LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPAKD------GSHSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|271499492|ref|YP_003332517.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Dickeya dadantii Ech586]
 gi|270343047|gb|ACZ75812.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Dickeya dadantii Ech586]
          Length = 274

 Score =  288 bits (738), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 154/282 (54%), Positives = 197/282 (69%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ II++ FE    + E  P  V    ++AV   +  LD G +R+A +  NG W TH
Sbjct: 1   MQQLQNIIETAFER---RAEITPASVDAVTREAVNQVISQLDSGALRVAEKI-NGQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN   ++      + ++DK+P KF  +    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNHLMEGAE--TRYYDKVPMKFAGYDEARFQREGFRVVPPASVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGVFIG+STKI DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVFIGQSTKIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KTR K  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTRGKVGINELLR 271


>gi|254490547|ref|ZP_05103733.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylophaga thiooxidans DMS010]
 gi|224464291|gb|EEF80554.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylophaga thiooxydans DMS010]
          Length = 273

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 154/280 (55%), Positives = 201/280 (71%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNES-IPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S +++II+  FE     N +    DV++AV   L +LD G  R+A +  NG W  +QW+
Sbjct: 1   MSDIQQIIEEAFERRADINPANADSDVRNAVNEALAMLDNGTARVAEKQ-NGDWVVNQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF++N  KI+  G   + ++DK+  KF  +   DF K   R++P   VR  +Y+
Sbjct: 60  KKAVLLSFRLNDNKIMPGGE--TNYFDKVEPKFASFNEDDFNKAGVRVVPPAAVRRGSYV 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPS+VN+GAY+  G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTI
Sbjct: 118 APGVVLMPSYVNIGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG ++ EGSV+ MGV+IG+STKI +R TGEITYG +P+ SVVV G+
Sbjct: 178 IEDNCFIGARSEVVEGVVVEEGSVISMGVYIGQSTKIFNRLTGEITYGRIPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS +         LYCAVI+K+VDEKTR K  IN LLRD
Sbjct: 238 LPSKD-----GSYSLYCAVIVKQVDEKTRGKVGINELLRD 272


>gi|77747803|ref|NP_636758.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|77761260|ref|YP_243922.2| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Xanthomonas campestris pv. campestris str. 8004]
          Length = 284

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 141/273 (51%), Positives = 188/273 (68%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   +   + I    +  V   +D L+ G  R+A  D  G W  ++W+KKA+LL 
Sbjct: 16  IESAFERRAALTIDEIEGSTRAIVNRVIDGLESGEFRVAEPDGQGGWTVNEWLKKAVLLY 75

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +   +F +   R++PG + R  +Y G   VLM
Sbjct: 76  FRVNEMAVIDAQP--APFWDKVESRFAGFHEAEFRQAGVRVVPGAVARRGSYFGKDVVLM 133

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEG+M+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 134 PSFTNIGAYVGEGTMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 193

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG +I   SV+GMGVFI +ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 194 GARSEVVEGVVIGHHSVIGMGVFISQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 251

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD +TRSKTS+N LLR
Sbjct: 252 ----GSHSLYCAVIVKQVDARTRSKTSVNELLR 280


>gi|239948148|ref|ZP_04699901.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239922424|gb|EER22448.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 275

 Score =  288 bits (737), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 137/254 (53%), Positives = 184/254 (72%), Gaps = 8/254 (3%)

Query: 30  VKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWW 89
           +K  +   +++L++G IR+  + +N +W  ++W+KKAILL F    +++ +  N Y++W+
Sbjct: 28  LKKTLNDIIEVLNQGTIRVCEKQEN-NWQVNEWVKKAILLYFITTESQLYN--NNYNSWY 84

Query: 90  DKIPAKFD-DWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDT 148
           DK+  KF  D     F++   R +PG +VR   YI    V+MPSF+N+GAYI EG+MIDT
Sbjct: 85  DKVAPKFSADIDKNTFKEAAIRKVPGAVVRTGTYIAKNVVIMPSFINIGAYIDEGTMIDT 144

Query: 149 WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208
           W+T+GSCAQIGKN HISGG GIGGVLEP+Q  P IIEDNCFIGARSEI EG I+ EG+V+
Sbjct: 145 WATIGSCAQIGKNCHISGGTGIGGVLEPLQAKPVIIEDNCFIGARSEIAEGVIVEEGAVI 204

Query: 209 GMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVD 268
            MGVFIG STKI+ R+TGEI YG +P+YSVVVPG  P+     ++  P LYC VI+K+VD
Sbjct: 205 SMGVFIGSSTKIVYRDTGEIIYGRIPAYSVVVPGVLPA----KEVGKPGLYCVVIVKQVD 260

Query: 269 EKTRSKTSINTLLR 282
           + TR+K SIN LLR
Sbjct: 261 KTTRAKVSINDLLR 274


>gi|78485633|ref|YP_391558.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Thiomicrospira crunogena XCL-2]
 gi|78363919|gb|ABB41884.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Thiomicrospira crunogena XCL-2]
          Length = 275

 Score =  288 bits (736), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 146/277 (52%), Positives = 198/277 (71%), Gaps = 8/277 (2%)

Query: 8   LEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+++I+  FE  +    +++  + K+A+   + LLD G +R+A +   G W  ++W+KKA
Sbjct: 5   LQKVIEEAFERRAEITPKTVDTETKEAINEAIMLLDSGKMRVAEQKGVGDWQVNEWLKKA 64

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF+     +++     + ++DK+P+KF DW   DFE+   R++P  + R  ++I P 
Sbjct: 65  VLLSFRTEENTVMNSSE--TRYFDKVPSKFADWSQADFEQAGIRVVPPAMARRGSFIAPS 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           +VLMPS+VN+GAY+  GSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 123 SVLMPSYVNIGAYVDSGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAAPTIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV G+ PS
Sbjct: 183 NCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVSGNLPS 242

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            +         LYCAVI+KKVD KT  K  IN LLRD
Sbjct: 243 KD-----GSYSLYCAVIVKKVDAKTLGKVGINELLRD 274


>gi|157828124|ref|YP_001494366.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rickettsia rickettsii str. 'Sheila Smith']
 gi|166224223|sp|A8GR33|DAPD_RICRS RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|157800605|gb|ABV75858.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia rickettsii str. 'Sheila Smith']
          Length = 274

 Score =  288 bits (736), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 199/286 (69%), Gaps = 16/286 (5%)

Query: 1   MITIVSTLEE---IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHW 57
           M +++  +EE   I D   ++S SK  ++ Q + D+++S    L++G +R+  + +N  W
Sbjct: 1   MSSLIKEVEEAWQIKDKLLQDS-SKLITLKQTLNDSIES----LNQGTVRVCEKKENS-W 54

Query: 58  NTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFD-DWKTKDFEKHNFRIIPGTI 116
           + ++W+KKAILL F    +++ +  N Y++W+DK+  KF  D     F++   R +PG I
Sbjct: 55  HVNEWVKKAILLYFITTESQLYN--NNYNSWYDKVAPKFSADTDKNTFKEAAIRTVPGAI 112

Query: 117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP 176
           VR  AYI    V+MPSF+N+GAYI EG+MIDTW+T+GSCAQIGKN HISGG GIGGVLEP
Sbjct: 113 VRTGAYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHISGGTGIGGVLEP 172

Query: 177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY 236
           +   P IIEDNCFIGARSEI EG I+ EG+V+ MGVFIG STKI+ R+TGEI YG +P+Y
Sbjct: 173 LHAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIVYRDTGEIIYGRIPAY 232

Query: 237 SVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           SVVVPG  P+     +   P LYC VI+K+VD+ TR+K  IN LLR
Sbjct: 233 SVVVPGVLPA----KETGKPGLYCVVIVKQVDKTTRAKVRINDLLR 274


>gi|238650449|ref|YP_002916301.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia peacockii str. Rustic]
 gi|238624547|gb|ACR47253.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia peacockii str. Rustic]
          Length = 274

 Score =  287 bits (735), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 199/286 (69%), Gaps = 16/286 (5%)

Query: 1   MITIVSTLEE---IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHW 57
           M +++  +EE   I D   ++S SK  ++ Q + D+++S    L++G IR+  + +N  W
Sbjct: 1   MSSLIKEVEEAWQIKDKLLQDS-SKLITLKQTLNDSIES----LNQGTIRVCEKKEN-SW 54

Query: 58  NTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFD-DWKTKDFEKHNFRIIPGTI 116
           + ++W+KKAILL F    +++ +  N Y++W+DK+  KF  D     F++   R +PG +
Sbjct: 55  HVNEWVKKAILLYFITTESQLYN--NNYNSWYDKVAPKFSADTDKNTFKEAAIRKVPGAV 112

Query: 117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP 176
           VR   YI    V+MPSF+N+GAYI EG+MIDTW+T+GSCAQIGKN HISGG GIGGVLEP
Sbjct: 113 VRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHISGGTGIGGVLEP 172

Query: 177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY 236
           +Q  P IIEDNCFIGARSEI EG I+ EG+V+ MGVFIG STKI+ R+TGEI YG +P+Y
Sbjct: 173 LQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIVYRDTGEIIYGRIPAY 232

Query: 237 SVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           SVVVPG  P+     +   P LYC VI+K+VD+ TR+K  IN LLR
Sbjct: 233 SVVVPGVLPA----KEAGKPGLYCVVIVKQVDKTTRAKVRINDLLR 274


>gi|145300064|ref|YP_001142905.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|166224194|sp|A4SQI5|DAPD_AERS4 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|142852836|gb|ABO91157.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase
           [Aeromonas salmonicida subsp. salmonicida A449]
 gi|148292097|emb|CAN84667.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Aeromonas salmonicida subsp. salmonicida]
          Length = 275

 Score =  287 bits (735), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 153/279 (54%), Positives = 198/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNE-SIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L++II++ FE  +S    S+    K A+  T+DLLD G  R+A +   G W  HQW+
Sbjct: 1   MTELQQIIEAAFERRDSITPGSVDAATKSAILQTIDLLDAGKARVAEKI-AGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LL F+IN   II   +  + ++DK+P KF D+  + F++   R++P    R  ++I
Sbjct: 60  KKAVLLYFRINDNGIIKGDD--AQYYDKVPLKFSDYTAEQFKEAGVRVVPPATARKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 APNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGEI YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LY AVI+KKVD KTR+K  IN LLR
Sbjct: 238 LPS-----KCGKYSLYAAVIVKKVDAKTRAKVGINALLR 271


>gi|229586438|ref|YP_002844939.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rickettsia africae ESF-5]
 gi|228021488|gb|ACP53196.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia africae ESF-5]
          Length = 274

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 200/286 (69%), Gaps = 16/286 (5%)

Query: 1   MITIVSTLEE---IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHW 57
           M +++  +EE   I D   ++S SK  ++ Q + D+++S    L++G IR+  + +N  W
Sbjct: 1   MSSLIKEIEEAWQIKDKLLQDS-SKLITLKQTLNDSIES----LNQGTIRVCEKQENS-W 54

Query: 58  NTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFD-DWKTKDFEKHNFRIIPGTI 116
           + ++W+KKAILL F    +++ +  N Y++W+DK+  KF  D     F++   R +PG +
Sbjct: 55  HVNEWVKKAILLYFITTESQLYN--NNYNSWYDKVAPKFSADTDKNTFKEAAIRKVPGAV 112

Query: 117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP 176
           VR   YI    V+MPSF+N+GAYI EG+MIDTW+T+GSCAQIGK+ HISGG GIGGVLEP
Sbjct: 113 VRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKHCHISGGTGIGGVLEP 172

Query: 177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY 236
           +Q  P IIEDNCFIGARSEI EG I+ EG+V+ MGVFIG STKI+ R+TGEI YG +P+Y
Sbjct: 173 LQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIVYRDTGEIIYGRIPAY 232

Query: 237 SVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           SVVVPG  P+     +   P LYC VI+K+VD+ TR+K SIN LLR
Sbjct: 233 SVVVPGVLPA----KEAGKPGLYCVVIVKQVDKTTRAKVSINDLLR 274


>gi|34580804|ref|ZP_00142284.1| 2345-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia sibirica 246]
 gi|28262189|gb|EAA25693.1| 2345-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia sibirica 246]
          Length = 282

 Score =  287 bits (734), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 146/286 (51%), Positives = 200/286 (69%), Gaps = 16/286 (5%)

Query: 1   MITIVSTLEE---IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHW 57
           M +++  +EE   I D   ++S SK  ++ Q + D+++S    L++G IR+  + +N  W
Sbjct: 9   MSSLIKEIEEAWQIKDKLLQDS-SKLITLKQTLNDSIES----LNQGTIRVCEKQENS-W 62

Query: 58  NTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFD-DWKTKDFEKHNFRIIPGTI 116
           + ++W+KKAILL F    +++ +  N Y++W+DK+  KF  D     F++   R +PG +
Sbjct: 63  HVNEWVKKAILLYFITTESQLYN--NNYNSWYDKVGPKFSADTDKNTFKEAAIRKVPGAV 120

Query: 117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP 176
           VR   YI    V+MPSF+N+GAYI EG+MIDTW+T+GSCAQIGK+ HISGG GIGGVLEP
Sbjct: 121 VRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKHCHISGGTGIGGVLEP 180

Query: 177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY 236
           +Q  P IIEDNCFIGARSEI EG I+ EG+V+ MGVFIG STKI+ R+TGEI YG +P+Y
Sbjct: 181 LQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIVYRDTGEIIYGRIPAY 240

Query: 237 SVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           SVVVPG  P+     +   P LYC VI+K+VD+ TR+K SIN LLR
Sbjct: 241 SVVVPGVLPA----KEAGKPGLYCVVIVKQVDKTTRAKVSINDLLR 282


>gi|227326534|ref|ZP_03830558.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 275

 Score =  287 bits (734), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 200/280 (71%), Gaps = 17/280 (6%)

Query: 8   LEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           L+ II++ FE    + E  P +     ++AV   ++LLD G +R+A + D G W THQW+
Sbjct: 5   LQNIIETAFER---RAEITPANADTVTREAVTQAINLLDSGALRVAEKID-GQWVTHQWL 60

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  K+I  G   + ++DK+P KF D+    F++   R+ P   VR  AYI
Sbjct: 61  KKAVLLSFRINDNKLIEGGE--TRFFDKVPMKFADYDEARFQREGVRVAPPASVRRGAYI 118

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 119 ARNTVLMPSYVNIGAYVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 178

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG ++ EGSV+ MGVFI +ST+I DR TGEI YG VP+ SVVV G+
Sbjct: 179 IEDNCFIGARSEVVEGVVVEEGSVISMGVFISQSTRIYDRETGEIHYGRVPAGSVVVSGN 238

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +      G H LYCA+I+KKVD KTR+K  IN LLR
Sbjct: 239 LPSKD------GSHSLYCAIIVKKVDAKTRAKVGINELLR 272


>gi|121607277|ref|YP_995084.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Verminephrobacter eiseniae EF01-2]
 gi|121551917|gb|ABM56066.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Verminephrobacter eiseniae EF01-2]
          Length = 277

 Score =  286 bits (733), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 145/279 (51%), Positives = 198/279 (70%), Gaps = 5/279 (1%)

Query: 6   STLEEIIDSFFEESNSKNE-SIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           S+L+ IID  +E+  S +  + P++  DAV   L  L+ G +R+A+R   G W  HQWIK
Sbjct: 3   SSLQTIIDQAWEQRASLSAGAAPKETLDAVAQVLSELNNGRLRVATRASVGQWTVHQWIK 62

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF+++   +I  G     ++DK+  KF     +  +    R++P  + RH ++I 
Sbjct: 63  KAVLLSFRLSDNAVIEAGA--LRFYDKVQPKFSHLDEQGMKAAGVRVVPPAVARHGSFIA 120

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
             AVLMP +VN+GA++G G+M+DTW+TVGSCAQIG +VH+SGGVGIGGVLEP+Q GPTII
Sbjct: 121 KGAVLMPCYVNVGAHVGAGTMVDTWATVGSCAQIGAHVHLSGGVGIGGVLEPLQAGPTII 180

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEG ++ E SVLGMGV++G+ST + DR +G+I+YG VPS SVVV GS 
Sbjct: 181 EDNCFIGARSEVVEGVVVEENSVLGMGVYLGQSTPLFDRASGQISYGRVPSGSVVVSGSL 240

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           P     G   G  +Y A+I+K+VD +TRSKTSIN LLR+
Sbjct: 241 PKTAANGAPYG--MYAAIIVKRVDAQTRSKTSINDLLRE 277


>gi|33592832|ref|NP_880476.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bordetella pertussis Tohama I]
 gi|33601166|ref|NP_888726.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bordetella bronchiseptica RB50]
 gi|61222455|sp|P0A4U8|DAPD_BORPE RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|61222458|sp|P0A4U9|DAPD_BORBR RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|4210609|emb|CAA08875.1| DapD [Bordetella pertussis Tohama I]
 gi|33572480|emb|CAE42051.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bordetella pertussis Tohama I]
 gi|33575601|emb|CAE32679.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bordetella bronchiseptica RB50]
 gi|332382245|gb|AEE67092.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Bordetella pertussis CS]
          Length = 273

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 151/277 (54%), Positives = 200/277 (72%), Gaps = 11/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+  I+  +E  +N        +V+DAV+ T+D LD G +R+A + D+  W  HQWIKKA
Sbjct: 5   LQTTIEQAWENRANLSPVDASAEVRDAVEHTIDGLDLGRLRVAEKIDD-QWIVHQWIKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF+++   ++  G G   ++DK+P KF  +    F+   +R++P  + R  A+I   
Sbjct: 64  VLLSFRLHDNAVM--GQGPLQFYDKVPTKFAGYGEAAFKAGGYRVVPPAVARRGAFIARN 121

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 122 VVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED 181

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG ++ E SVL MGVF+ +STKI DR TG+++YG VPS SVVVPGS PS
Sbjct: 182 NCFIGARSEVVEGVVVEENSVLAMGVFLSQSTKIYDRATGKVSYGRVPSGSVVVPGSLPS 241

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H L CAVI+K+VD +TR+KTSIN LLR
Sbjct: 242 ED------GSHSLACAVIVKRVDAQTRAKTSINDLLR 272


>gi|330993396|ref|ZP_08317331.1| succinyltransferase [Gluconacetobacter sp. SXCC-1]
 gi|329759426|gb|EGG75935.1| succinyltransferase [Gluconacetobacter sp. SXCC-1]
          Length = 282

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 147/279 (52%), Positives = 194/279 (69%), Gaps = 3/279 (1%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           ++L   I++ +E   + + +     ++AV++ L  LD G +R+A+  + G W  ++W+KK
Sbjct: 4   TSLRSQIEALWERRETLSTATTGADREAVETALLALDSGRLRVATPGEGG-WTVNEWLKK 62

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N  +++  G   +  +DK+P KF  W    F    FR +PG+IVR SA+I P
Sbjct: 63  AVLLSFRLNDNRLVEGGGAGAPSYDKVPLKFAGWDQATFADAGFRAVPGSIVRRSAFIAP 122

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN GAY+  G+M+DTW T+GSCAQIGKN HISGGVGIGGVLEP+Q  P IIE
Sbjct: 123 GVVLMPSFVNAGAYVDSGTMVDTWVTIGSCAQIGKNCHISGGVGIGGVLEPLQAAPVIIE 182

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D CFIGARSE+ EG ++  GSVL MGVF+G STKI+DR TGE+  G VP+YSVVVPG+ P
Sbjct: 183 DGCFIGARSEVAEGVVVERGSVLSMGVFLGASTKIVDRATGEVFMGRVPAYSVVVPGTLP 242

Query: 246 SINLKGDIAG--PHLYCAVIIKKVDEKTRSKTSINTLLR 282
                       P L CAVI+K+VDE+TRSKTSIN LLR
Sbjct: 243 PRQATSTDGRPLPSLDCAVIVKRVDERTRSKTSINDLLR 281


>gi|238751454|ref|ZP_04612946.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia rohdei ATCC 43380]
 gi|238710321|gb|EEQ02547.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia rohdei ATCC 43380]
          Length = 274

 Score =  286 bits (732), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 200/282 (70%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++A+   +DLLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RADITPANVDTVTREAINHVIDLLDTGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF  +    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVMEGAE--TRYYDKVPMKFAGYDEARFQREGFRVVPPATVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCF+GARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KT  K  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|33596611|ref|NP_884254.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bordetella parapertussis 12822]
 gi|61212737|sp|Q7W8Y2|DAPD_BORPA RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|33573312|emb|CAE37295.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bordetella parapertussis]
          Length = 273

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 151/277 (54%), Positives = 200/277 (72%), Gaps = 11/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+  I+  +E  +N        +V+DAV+ T+D LD G +R+A + D+  W  HQWIKKA
Sbjct: 5   LQTTIEQAWENRANLSPVDASAEVRDAVEHTIDGLDLGRLRVAEKIDD-QWIVHQWIKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF+++   ++  G G   ++DK+P KF  +    F+   +R++P  + R  A+I   
Sbjct: 64  VLLSFRLHDNAVM--GQGPLQFYDKVPTKFAGYGEAAFKAGGYRVVPPAVARRGAFIARN 121

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 122 VVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED 181

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG ++ E SVL MGVF+ +STKI DR TG+++YG VPS SVVVPGS PS
Sbjct: 182 NCFIGARSEVVEGVVVEENSVLAMGVFLSQSTKIYDRATGKVSYGRVPSGSVVVPGSLPS 241

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H L CAVI+K+VD +TR+KTSIN LLR
Sbjct: 242 ED------GSHSLTCAVIVKRVDAQTRAKTSINDLLR 272


>gi|330813518|ref|YP_004357757.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486613|gb|AEA81018.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 275

 Score =  286 bits (732), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 155/279 (55%), Positives = 203/279 (72%), Gaps = 9/279 (3%)

Query: 8   LEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           LE  I+  +E  ++ ++     +  A++ T++ LD+G IR++ +  + +W  H+WIKKAI
Sbjct: 3   LENTINQAWEVRDTISKDSDSKIITAIEHTIESLDQGKIRVSEKKGD-NWIVHEWIKKAI 61

Query: 68  LLSFQINPTKIISDGNGYSTWWDK---IPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           LLSF++N  + +S    YS+W+DK   I  K   W  +D  K  FR++P + VR  +++G
Sbjct: 62  LLSFRVNEMETLS--GPYSSWYDKAHLIKGKTAGWNKEDHVKAGFRMVPNSPVRKGSFVG 119

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
             AVLMP F+N+G Y+ EG+MIDTWSTVGSCAQIGKN HISGGVGIGGVLEP+Q  P II
Sbjct: 120 KNAVLMPCFINIGGYVDEGTMIDTWSTVGSCAQIGKNCHISGGVGIGGVLEPLQASPVII 179

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+ EG I+REGSV+ MGV++G STKI DR T  I+YG++P YSVVV GS 
Sbjct: 180 EDNCFIGARSEVAEGVIVREGSVISMGVYLGASTKIYDRKTKSISYGKIPPYSVVVAGSM 239

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           PS N   D  GP+LYCAVI+K VDEKTRSKTS+N LLR+
Sbjct: 240 PSNN---DKDGPNLYCAVIVKTVDEKTRSKTSVNDLLRE 275


>gi|227114684|ref|ZP_03828340.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Pectobacterium carotovorum subsp. brasiliensis PBR1692]
          Length = 275

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 156/280 (55%), Positives = 200/280 (71%), Gaps = 17/280 (6%)

Query: 8   LEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           L+ II++ FE    + E  P +     ++AV   ++LLD G +R+A + D G W THQW+
Sbjct: 5   LQNIIETAFER---RAEITPANTDTVTREAVNQAINLLDSGALRVAEKID-GQWVTHQWL 60

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  ++I  G   + ++DK+P KF D+    F++   R+ P   VR  AYI
Sbjct: 61  KKAVLLSFRINDNQLIEGGE--TRFFDKVPMKFADYDEARFQREGVRVAPPASVRRGAYI 118

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 119 ARNTVLMPSYVNIGAYVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 178

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG ++ EGSV+ MGVFI +ST+I DR TGEI YG VP+ SVVV G+
Sbjct: 179 IEDNCFIGARSEVVEGVVVEEGSVISMGVFISQSTRIYDRETGEIHYGRVPAGSVVVSGN 238

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +      G H LYCA+I+KKVD KTR+K  IN LLR
Sbjct: 239 LPSKD------GSHSLYCAIIVKKVDAKTRAKVGINELLR 272


>gi|238759953|ref|ZP_04621107.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia aldovae ATCC 35236]
 gi|238796604|ref|ZP_04640111.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia mollaretii ATCC 43969]
 gi|238701860|gb|EEP94423.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia aldovae ATCC 35236]
 gi|238719582|gb|EEQ11391.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Yersinia mollaretii ATCC 43969]
          Length = 274

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 149/282 (52%), Positives = 200/282 (70%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I++ FE    + +  P +V    ++A+   +DLLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIETAFER---RADITPANVDTVTREAINHVIDLLDTGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  +++      + ++DK+P KF  +    F++  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNQVMEGAE--TRYYDKVPMKFAGYDEARFQREGFRVVPPATVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCF+GARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS +         LYCAVI+KKVD KT  K  IN LLR
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAKTLGKVGINELLR 271


>gi|117619705|ref|YP_855711.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|166224193|sp|A0KHG0|DAPD_AERHH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|117561112|gb|ABK38060.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 275

 Score =  285 bits (730), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 152/279 (54%), Positives = 196/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNE-SIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L++II++ FE  +S    S+    K A+   +DLLD G  R+A +   G W  HQW+
Sbjct: 1   MTELQQIIEAAFERRDSITPGSVDAATKAAILQAIDLLDSGKARVAEKI-AGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LL F+IN   II   +  + ++DK+P KF D+  + F+    R++P    R  ++I
Sbjct: 60  KKAVLLYFRINDNGIIKGDD--AQYYDKVPLKFSDYSAEQFKAAGVRVVPPATARKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 APNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGEI YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LY AVI+KKVD KTR+K  IN LLR
Sbjct: 238 LPS-----KCGKYSLYAAVIVKKVDAKTRAKVGINALLR 271


>gi|163857111|ref|YP_001631409.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Bordetella petrii DSM 12804]
 gi|226724154|sp|A9IR78|DAPD_BORPD RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THP succinyltransferase;
           Short=Tetrahydropicolinate succinylase
 gi|163260839|emb|CAP43141.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Bordetella petrii]
          Length = 273

 Score =  285 bits (730), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 199/277 (71%), Gaps = 11/277 (3%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+  I++ +E  +N        +V++AV+ T+  LD G +R+A + + G W  HQWIKKA
Sbjct: 5   LQTTIENAWENRTNLSPVDATAEVREAVEQTIAALDLGRLRVAEKTEAG-WIVHQWIKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++    I+  G     ++DK+P KF ++    F+   +R++P  + R  A+I   
Sbjct: 64  VLLSFRLQDNAIM--GQAPMQFYDKVPLKFAEYGDTAFQHGGYRVVPPAVARRGAFIARN 121

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 122 VVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED 181

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG ++ E SVL MGVF+ +STKI DR TG++TYG VPS SVVVPGS PS
Sbjct: 182 NCFIGARSEVVEGVVVEENSVLAMGVFLSQSTKIYDRATGKVTYGRVPSGSVVVPGSLPS 241

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H L CAVI+K+VD +TR+KTSIN LLR
Sbjct: 242 ED------GSHSLVCAVIVKRVDAQTRAKTSINDLLR 272


>gi|304413221|ref|ZP_07394694.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Candidatus Regiella insecticola LSR1]
 gi|304284064|gb|EFL92457.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Candidatus Regiella insecticola LSR1]
          Length = 271

 Score =  285 bits (729), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 203/278 (73%), Gaps = 9/278 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
           +  L+ +I+  F+   ++ + I    +  +   ++ LD G++R+A +  NG W THQW+K
Sbjct: 1   MQQLQTVIEQAFD-LRTEPDKIDSSARIVINQMINELDTGLLRVAEKI-NGQWITHQWLK 58

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF IN  ++IS    +  ++DKIP KF +  T  F+    R++P   VR  A++ 
Sbjct: 59  KAVLLSFLINENQLISGAETH--YYDKIPLKFSNHDTARFQLEGVRVVPPASVRKGAFVA 116

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           P A+LMPS+VN+GA+I EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTII
Sbjct: 117 PGAILMPSYVNIGAFIDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTII 176

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEG I+ E +V+ MGV++G+ST+I DR T +I+YG +P+ SVVV G+ 
Sbjct: 177 EDNCFIGARSEVVEGVIVEENTVISMGVYLGQSTRIYDRETKKISYGRIPAGSVVVSGTL 236

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           PS   +GD +   LYCA+I+KKVD KTR+KTSIN LLR
Sbjct: 237 PS--QEGDHS---LYCAIIVKKVDAKTRAKTSINELLR 269


>gi|294140000|ref|YP_003555978.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella violacea DSS12]
 gi|293326469|dbj|BAJ01200.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella violacea DSS12]
          Length = 274

 Score =  285 bits (728), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 149/279 (53%), Positives = 202/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNES-IPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L + I++ FE     + S +   ++  V+  +++LD+G +R+A + D G W+ HQW+
Sbjct: 1   MEALRQRIEAAFEARAEISPSTVDASIRADVERVINMLDKGEVRVAEKID-GQWHVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I    +I DG G + ++DK+P KF D+    F++   R++P   VR  ++I
Sbjct: 60  KKAVLLSFRIFDNAVI-DG-GETKYFDKVPMKFADYDEARFKEEAIRVVPPATVRKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G   VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTI
Sbjct: 118 GKNTVLMPSYVNLGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGV++G+ST+I DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEVHYGRVPAGSVVVSGT 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS          +LY A+I+KKVD KTR K  IN LLR
Sbjct: 238 LPS-----KCGKYNLYAAIIVKKVDAKTRGKVGINELLR 271


>gi|317405180|gb|EFV85521.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Achromobacter xylosoxidans C54]
          Length = 273

 Score =  285 bits (728), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 152/282 (53%), Positives = 203/282 (71%), Gaps = 13/282 (4%)

Query: 2   ITIVSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQ 61
           + + +T+E+  D   + +N        +V++AV+ T+D LD G +R+A +  N  W  HQ
Sbjct: 3   LDLQTTIEKAWD---DRANLSPVDASAEVREAVEHTIDGLDLGRLRVAEKI-NDDWVVHQ 58

Query: 62  WIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSA 121
           WIKKA+LLSF++    I+  G     ++DK+P KF ++    F++  +R++P  + R  A
Sbjct: 59  WIKKAVLLSFRLYDNAIM--GQAPLQFYDKVPLKFSEYGDNAFKQGGYRVVPPAVARRGA 116

Query: 122 YIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGP 181
           +IG   VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  P
Sbjct: 117 FIGRNVVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANP 176

Query: 182 TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVP 241
           TIIEDNCFIGARSE+VEG I+ E SVL MGV++ +STKI DR TG++TYG VPS SVVVP
Sbjct: 177 TIIEDNCFIGARSEVVEGVIVEENSVLAMGVYLSQSTKIYDRATGKVTYGRVPSGSVVVP 236

Query: 242 GSYPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
           GS PS +      G H L CAVI+K+VD +TR+KTSIN LLR
Sbjct: 237 GSLPSAD------GSHSLACAVIVKRVDAQTRAKTSINDLLR 272


>gi|157964259|ref|YP_001499083.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rickettsia massiliae MTU5]
 gi|157844035|gb|ABV84536.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia massiliae MTU5]
          Length = 282

 Score =  284 bits (727), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 198/286 (69%), Gaps = 16/286 (5%)

Query: 1   MITIVSTLEE---IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHW 57
           M +++  +EE   + D   ++S SK  ++ Q + D+++S    L++G+IR+  + +N  W
Sbjct: 9   MSSLIKEIEEAWQMKDKLLQDS-SKLITLKQTLNDSIES----LNQGMIRVCEKKEN-SW 62

Query: 58  NTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFD-DWKTKDFEKHNFRIIPGTI 116
             ++W+KKAILL F    +++ +  N Y +W+DK+  KF  D     F++   R + G +
Sbjct: 63  QVNEWVKKAILLYFITTESQLYN--NNYDSWYDKVAPKFSADTDKNTFKEAAIRKVFGAV 120

Query: 117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP 176
           VR   YI    V+MPSF+N+GAYI EG+MIDTW+T+GSCAQIGKN HISGG GIGGVLEP
Sbjct: 121 VRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHISGGTGIGGVLEP 180

Query: 177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY 236
           +Q  P IIEDNCFIGARSEI EG I+ EG+V+ MGVFIG STKI+ R+TGEI YG +P+Y
Sbjct: 181 LQAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIVYRDTGEIIYGRIPAY 240

Query: 237 SVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           SVVVPG  P+     +   P LYC VI+K+VD+ TR+K +IN LLR
Sbjct: 241 SVVVPGVLPA----KEAGKPGLYCVVIVKQVDKTTRAKVNINDLLR 282


>gi|319786518|ref|YP_004145993.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317465030|gb|ADV26762.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 302

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 144/273 (52%), Positives = 192/273 (70%), Gaps = 9/273 (3%)

Query: 11  IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I D+F   +N   + I    +  V+  +  L+ G  R+A  D NG W  ++W+KKA+LL 
Sbjct: 37  IEDAFERRANLTLDEIDGSTRPLVERAISGLESGEFRVAEPDGNGGWQVNEWLKKAVLLY 96

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   ++    G   +WDK+P +F  +   +F K   R++PGT+ R  +Y G   VLM
Sbjct: 97  FRVNDMVVMEGAPG--PFWDKVPLRFQGYGEAEFRKLGVRVVPGTVARRGSYFGKDVVLM 154

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSFVN+GA++GEG+M+DTW+TVGSCAQ+GK+ HISGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 155 PSFVNIGAHVGEGTMVDTWATVGSCAQVGKHCHISGGAGIGGVLEPLQASPTIIEDHCFI 214

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG ++   SV+GMGVFIG+ST+I +R TGEI+YG VP  SVVV GS P+ +  
Sbjct: 215 GARSEVVEGVVVGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPGSVVVSGSLPAAD-- 272

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD KTR+KTSIN LLR
Sbjct: 273 ----GSHSLYCAVIVKQVDAKTRAKTSINELLR 301


>gi|157825383|ref|YP_001493103.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rickettsia akari str. Hartford]
 gi|166224222|sp|A8GMH0|DAPD_RICAH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|157799341|gb|ABV74595.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia akari str. Hartford]
          Length = 274

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 147/285 (51%), Positives = 195/285 (68%), Gaps = 14/285 (4%)

Query: 1   MITIVSTLEEI--IDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWN 58
           M +++  +EE   I     + +SK   + + + D + S    L++G IR+  + +N  W 
Sbjct: 1   MSSLIKEIEEAWQIKGQLLQDSSKLIMLKKTLNDVIAS----LNQGAIRVCEKKEN-SWE 55

Query: 59  THQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFD-DWKTKDFEKHNFRIIPGTIV 117
            ++W+KKAILL F    +++ +  N Y++W+DK+  KF  D     F++   R +PG +V
Sbjct: 56  VNEWVKKAILLYFITTESQLYN--NNYNSWYDKVAPKFSVDTDENIFKEAAIRKVPGAVV 113

Query: 118 RHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPI 177
           R   YI    V+MPSF+N+GAYI EG+MIDTW+T+GSCAQIGK+ HISGG GIGGVLEP+
Sbjct: 114 RTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKHCHISGGTGIGGVLEPL 173

Query: 178 QTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYS 237
           Q  P IIEDNCFIGARSEI EG I+ EG+V+ MGVFIG STKII R+TGEI YG +P+YS
Sbjct: 174 QAKPVIIEDNCFIGARSEIAEGVIVEEGAVISMGVFIGSSTKIIYRDTGEIIYGRIPAYS 233

Query: 238 VVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           VVVPG  P+     +   P LYCAVIIK+VD+ TRSK SIN LLR
Sbjct: 234 VVVPGVLPA----KEAGKPGLYCAVIIKQVDKTTRSKVSINDLLR 274


>gi|50119968|ref|YP_049135.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Pectobacterium atrosepticum SCRI1043]
 gi|71153286|sp|Q6D8E6|DAPD_ERWCT RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|49610494|emb|CAG73939.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pectobacterium atrosepticum SCRI1043]
          Length = 275

 Score =  283 bits (725), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 154/277 (55%), Positives = 197/277 (71%), Gaps = 11/277 (3%)

Query: 8   LEEIIDSFFEESNSKNESIPQDV-KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+ II++ FE       +    V ++AV   ++LLD G +R+A + D G W THQW+KKA
Sbjct: 5   LQNIIETAFERRADITPANADTVTREAVNQAINLLDSGALRVAEKID-GQWVTHQWLKKA 63

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF+IN  ++I  G   + ++DK+P KF D+    F++   R+ P   VR  AYI   
Sbjct: 64  VLLSFRINDNQLIEGGE--TRFFDKVPMKFADYDEARFQREGVRVAPPASVRRGAYIARN 121

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPS+VN+GAY+ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 122 TVLMPSYVNIGAYVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED 181

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG ++ EGSV+ MGVFI +ST+I DR TGEI YG VP+ SVVV G+ PS
Sbjct: 182 NCFIGARSEVVEGVVVEEGSVISMGVFISQSTRIYDRETGEIHYGRVPAGSVVVSGNLPS 241

Query: 247 INLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            +      G H +YCA+I+KKVD KTR K  IN LLR
Sbjct: 242 KD------GSHSMYCAIIVKKVDAKTRGKVGINELLR 272


>gi|330830758|ref|YP_004393710.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Aeromonas veronii B565]
 gi|328805894|gb|AEB51093.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Aeromonas veronii B565]
          Length = 275

 Score =  283 bits (724), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 197/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNE-SIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           ++ L++II++ FE  ++    S+    K A+   +DLLD G  R+A +   G W  HQW+
Sbjct: 1   MTELQQIIEAAFERRDTITPGSVDSATKSAILQAIDLLDSGKARVAEKI-AGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LL F+IN   II   +  + ++DK+P KF ++  + F++   R++P    R  ++I
Sbjct: 60  KKAVLLYFRINDNGIIKGDD--AQYYDKVPLKFSNYTAEQFKEAGVRVVPPATARKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
            P  VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 APNTVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGVFIG+ST+I DR TGEI YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS           LY AVI+KKVD KTR+K  IN LLR
Sbjct: 238 LPS-----KCGKYSLYAAVIVKKVDAKTRAKVGINALLR 271


>gi|33151814|ref|NP_873167.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus ducreyi 35000HP]
 gi|71153288|sp|Q7VNC4|DAPD_HAEDU RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|33148035|gb|AAP95556.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Haemophilus ducreyi 35000HP]
          Length = 274

 Score =  283 bits (723), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 155/280 (55%), Positives = 197/280 (70%), Gaps = 15/280 (5%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +L+ +I++ FE    + E  P+ V    + A+++ ++ LD G  R+A +   G W THQW
Sbjct: 2   SLQAVIEAAFER---RAEITPKTVDVETRVAIETVIEKLDSGEYRVAEKI-GGEWVTHQW 57

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           +KKA+LLSF+IN  +II DG   + ++DK+  KF D+    F +  FR++P   VR  AY
Sbjct: 58  LKKAVLLSFRINDNQII-DG-AETKYYDKVALKFADYTESRFAEEGFRVVPSATVRKGAY 115

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I    VLMPS+VN+GAY+GEG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PT
Sbjct: 116 IAKNCVLMPSYVNIGAYVGEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPT 175

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           II DNCFIGARSE+VEG I+ EG V+ MGVFIG+ST+I DR TGEI YG VP+ SVVV G
Sbjct: 176 IIGDNCFIGARSEVVEGVIVEEGCVISMGVFIGQSTRIYDRETGEIHYGRVPAGSVVVSG 235

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S PS           LYCAVI+KKVD KT  K  IN LLR
Sbjct: 236 SLPS-----KCGKYSLYCAVIVKKVDAKTLGKVGINELLR 270


>gi|221133318|ref|ZP_03559623.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Glaciecola sp. HTCC2999]
          Length = 274

 Score =  282 bits (722), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 152/280 (54%), Positives = 197/280 (70%), Gaps = 9/280 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQ-DVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ II+S F+  ++ + S    ++K AV   +DLL+ G  R+A + D G W  HQW+
Sbjct: 1   MSDLQTIIESAFDARDTISPSTASAELKAAVNQAIDLLNSGEARVAEKID-GEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LL F+     +I      S ++DK+P KF D+ T+ F K   R++P   VR   +I
Sbjct: 60  KKAVLLFFRCYNNDVIEGAE--SKFYDKVPLKFTDYTTERFAKEGMRVVPPAAVRTGTFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G   VLMPS+VN+GA++ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 GKNVVLMPSYVNIGAFVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG ++ EG+V+ MGV+IG+ST+I DR TGEI YG VP+ SVVV GS
Sbjct: 178 IEDNCFIGARSEIVEGVVVEEGAVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVSGS 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            PS           LY AVI+KKVD KTR+K  IN LLR+
Sbjct: 238 LPS-----KCGTYSLYAAVIVKKVDAKTRAKVGINALLRE 272


>gi|15604068|ref|NP_220583.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rickettsia prowazekii str. Madrid E]
 gi|6647496|sp|Q9ZDX0|DAPD_RICPR RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|3860759|emb|CAA14660.1| 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SUCCINYLTRANSFERASE
           (dapD) [Rickettsia prowazekii]
 gi|292571789|gb|ADE29704.1| 2,3,4,5-tetrahydropyridine-2-carboxylateN-succinyltransferase
           [Rickettsia prowazekii Rp22]
          Length = 274

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 144/274 (52%), Positives = 187/274 (68%), Gaps = 14/274 (5%)

Query: 16  FEESNSKNESIPQD------VKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILL 69
            EE+    E+I  D      +K  +  ++  L++GIIR+  +  N  W  ++W+KKAILL
Sbjct: 8   IEEAWQIKENILHDSSKLIKLKKILNESIASLNQGIIRVCEKQGN-QWKVNEWVKKAILL 66

Query: 70  SFQINPTKIISDGNGYSTWWDKIPAKFD-DWKTKDFEKHNFRIIPGTIVRHSAYIGPKAV 128
            F    +++ +  N Y++W+DK+  KF  D     F++   R +PG IVR   YI    V
Sbjct: 67  YFITTESQLYN--NNYNSWYDKVAPKFPADTDKNIFKEAAIRKVPGAIVRTGTYIAKNVV 124

Query: 129 LMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNC 188
           +MPSF+N+GAYI EG+MIDTW+T+GSCAQIGKN HISGG GIGGVLEP+Q  P IIEDNC
Sbjct: 125 IMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHISGGAGIGGVLEPLQAKPVIIEDNC 184

Query: 189 FIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSIN 248
           F+GARSEI EG I+ EGSV+ MGVFIG STKI+ R+TGEI YG +P+YSVVVPG  P   
Sbjct: 185 FVGARSEIAEGVIVEEGSVISMGVFIGSSTKIVYRDTGEIIYGRIPAYSVVVPGILPP-- 242

Query: 249 LKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
              ++  P LYC VI+K+VD+ TR K SIN LLR
Sbjct: 243 --PEVGKPGLYCVVIVKQVDKTTRGKVSINDLLR 274


>gi|157803354|ref|YP_001491903.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rickettsia canadensis str. McKiel]
 gi|157784617|gb|ABV73118.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia canadensis str. McKiel]
          Length = 274

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 140/254 (55%), Positives = 180/254 (70%), Gaps = 12/254 (4%)

Query: 34  VQSTLDL----LDRGIIRIASRDDNGHWNTHQWIKKAILLSFQINPTKIISDGNGYSTWW 89
           +Q TL+     L++G IR+  + +NG W  ++W+KKAILL F    +++ S  N Y++W+
Sbjct: 28  LQKTLNYIIESLNQGTIRVCEKKENG-WQVNEWVKKAILLYFITTESQLYS--NNYNSWY 84

Query: 90  DKIPAKFD-DWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDT 148
           DK+  KF  D     F++ + R +PG  VR   YI    V+MPSF+N+GAYI E +MIDT
Sbjct: 85  DKVAPKFSADIDKNIFKEASIRTVPGAFVRTGTYIAKNVVIMPSFINLGAYIDERTMIDT 144

Query: 149 WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVL 208
           W+T+GSCAQIGKN HISGG GIGGVLEP+Q  P IIEDNCFIGARSEI EG I+ EG+V+
Sbjct: 145 WATIGSCAQIGKNCHISGGTGIGGVLEPLQAKPVIIEDNCFIGARSEIAEGVIVEEGAVI 204

Query: 209 GMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVD 268
            MG FIG STKI+ R+TGEI YG VP+YSVVVPG  P+     +   P LYC VIIK+VD
Sbjct: 205 SMGAFIGSSTKIVYRDTGEIIYGRVPAYSVVVPGVLPA----KEAGKPGLYCVVIIKQVD 260

Query: 269 EKTRSKTSINTLLR 282
           + TR++ SIN LLR
Sbjct: 261 KTTRARVSINDLLR 274


>gi|261822602|ref|YP_003260708.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Pectobacterium wasabiae WPP163]
 gi|261606615|gb|ACX89101.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Pectobacterium wasabiae WPP163]
          Length = 275

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 155/280 (55%), Positives = 197/280 (70%), Gaps = 17/280 (6%)

Query: 8   LEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           L+ II++ FE    + E  P +     ++AV   + LLD G +R+A + D G W THQW+
Sbjct: 5   LQNIIETAFER---RAEITPANADTVTREAVTQAISLLDSGALRVAEKID-GQWVTHQWL 60

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN   +I  G   + ++DK+P KF D+    F++   R+ P   VR  AYI
Sbjct: 61  KKAVLLSFRINDNHLIEGGE--TRFFDKVPMKFADYDEARFQREGVRVAPPASVRRGAYI 118

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 119 ARNTVLMPSYVNIGAYVDEGTMVDTWVTVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 178

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG ++ EGSV+ MGVFI +ST+I DR TGEI YG VP+ SVVV G+
Sbjct: 179 IEDNCFIGARSEVVEGVVVEEGSVISMGVFISQSTRIYDRETGEIHYGRVPAGSVVVSGN 238

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +      G H +YCA+I+KKVD KTR K  IN LLR
Sbjct: 239 LPSKD------GSHSMYCAIIVKKVDAKTRGKVGINELLR 272


>gi|325921722|ref|ZP_08183551.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Xanthomonas gardneri ATCC 19865]
 gi|325547799|gb|EGD18824.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Xanthomonas gardneri ATCC 19865]
          Length = 395

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 189/273 (69%), Gaps = 10/273 (3%)

Query: 12  IDSFFEESNSKN-ESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAILLS 70
           I+S FE   S   + I    +  V   +D L+ G  R+A  D  G W  ++W+KKA+LL 
Sbjct: 127 IESAFERRASLTIDEIDGSTRAIVTRVIDGLESGEFRVAEPDGQGGWTVNEWLKKAVLLY 186

Query: 71  FQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLM 130
           F++N   +I      + +WDK+ ++F  +   +F K   R++PG + R  +Y G   VLM
Sbjct: 187 FRVNEMAVIEAQP--APFWDKVESRFAGFNEAEFRKAGVRVVPGAVARRGSYFGKDVVLM 244

Query: 131 PSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFI 190
           PSF N+GAY+GEGSM+DTW+TVGSCAQIGK+ H+SGG GIGGVLEP+Q  PTIIED+CFI
Sbjct: 245 PSFTNIGAYVGEGSMVDTWATVGSCAQIGKHCHLSGGAGIGGVLEPLQASPTIIEDHCFI 304

Query: 191 GARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLK 250
           GARSE+VEG ++   SV+GMGVFIG+ST+I +R TGEI+YG VP YSVVV G  PS +  
Sbjct: 305 GARSEVVEGVVVGHHSVIGMGVFIGQSTRIYNRATGEISYGYVPPYSVVVSGQLPSKD-- 362

Query: 251 GDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
               G H LYCAVI+K+VD KTRSKTS+N LLR
Sbjct: 363 ----GSHSLYCAVIVKQVDAKTRSKTSVNELLR 391


>gi|91205958|ref|YP_538313.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia bellii RML369-C]
 gi|122425310|sp|Q1RHE0|DAPD_RICBR RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|91069502|gb|ABE05224.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Rickettsia bellii RML369-C]
          Length = 275

 Score =  282 bits (721), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 147/286 (51%), Positives = 193/286 (67%), Gaps = 16/286 (5%)

Query: 1   MITIVSTLEE---IIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHW 57
           M T +  +EE   I D   ++S   +       K  +Q  ++ L++G IR+  +  N  W
Sbjct: 1   MFTYIKEIEEAWQIKDKLLQDSVKLSA-----FKKTLQDVIENLNKGTIRVCEKQ-NSSW 54

Query: 58  NTHQWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFD-DWKTKDFEKHNFRIIPGTI 116
             + W+KKAILL F    +++ +  N Y++W+DK+  KF  D +   F++   R +PG+ 
Sbjct: 55  QVNDWVKKAILLYFMTTESQLYN--NNYNSWYDKVAPKFPFDAELNKFKEAGIRKVPGSF 112

Query: 117 VRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEP 176
           VR   YI    V+MPSF+N+GAYI EG+MIDTW+T+GSCAQIGKN HISGG GIGGVLEP
Sbjct: 113 VRTGTYIAKNVVIMPSFINIGAYIDEGTMIDTWATIGSCAQIGKNCHISGGTGIGGVLEP 172

Query: 177 IQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY 236
           +Q  P IIEDNCFIGARSEI EG I+ EG+V+ MGVFIG STKI+ R++GEI YG VP+ 
Sbjct: 173 LQAKPVIIEDNCFIGARSEIAEGVIVEEGAVVSMGVFIGASTKIVYRDSGEIIYGIVPAC 232

Query: 237 SVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           SVVVPG  P  N + D   P LYCAVI+K+VD+ TR+K SIN LLR
Sbjct: 233 SVVVPGVLP--NKEAD--KPGLYCAVIVKQVDKNTRAKVSINELLR 274


>gi|296115062|ref|ZP_06833704.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295978399|gb|EFG85135.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 282

 Score =  282 bits (721), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 146/279 (52%), Positives = 193/279 (69%), Gaps = 3/279 (1%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           +TL+  I++ +E  ++ +    +  +  V++ L  LD G +R+A+    G W  ++W+KK
Sbjct: 4   TTLQSQIEALWERRDTLSPRSGEADRAPVEAALSELDAGRLRVATPGAEG-WVVNEWLKK 62

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++N  ++  +G   +  +DK+P KF  W    F +  FR +PG IVR SA++ P
Sbjct: 63  AVLLSFRLNDNRLAPNGCAGAPAFDKVPLKFAGWDEGAFTQAGFRAVPGAIVRRSAFVAP 122

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
             VLMPSFVN GAY+  G+M+DTW T+GSCAQIGKN HISGGVGIGGVLEP+Q  P IIE
Sbjct: 123 GVVLMPSFVNAGAYVDSGTMVDTWVTIGSCAQIGKNCHISGGVGIGGVLEPLQAAPVIIE 182

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           D CFIGARSE+ EG ++  GSVL MGVF+G STKI+DR TGE+  G VP+YSVVVPG+ P
Sbjct: 183 DGCFIGARSEVAEGVVVERGSVLSMGVFLGASTKIVDRTTGEVFMGRVPAYSVVVPGTLP 242

Query: 246 SINLKGDIAG--PHLYCAVIIKKVDEKTRSKTSINTLLR 282
                       P L CAVI+K+VDE+TRSKTSIN LLR
Sbjct: 243 PRQATSADGKPLPSLDCAVIVKRVDERTRSKTSINDLLR 281


>gi|124266996|ref|YP_001021000.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Methylibium petroleiphilum PM1]
 gi|124259771|gb|ABM94765.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Methylibium petroleiphilum PM1]
          Length = 275

 Score =  281 bits (720), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 195/277 (70%), Gaps = 7/277 (2%)

Query: 6   STLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKK 65
           + L+  ID+ +E   +   +   +V++AV+  +  L++G +R+A R   G W  +QW+KK
Sbjct: 4   TQLQSTIDAAWESRATITAANAPEVREAVEQVISDLNKGRLRVAERQGVGQWQVNQWVKK 63

Query: 66  AILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGP 125
           A+LLSF++   KI+  G+    ++DK+  KF             R++P  + R  +YI  
Sbjct: 64  AVLLSFRLTDNKIMRAGD--LGFFDKVDTKFAHLDEAAMRATGVRVVPPAVARRGSYIAK 121

Query: 126 KAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIE 185
            AVLMPS+VN+GAY+ E +M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIE
Sbjct: 122 GAVLMPSYVNIGAYVDENTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIE 181

Query: 186 DNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP 245
           DNCFIGARSE+VEG I+ E SV+ MGV+IG+STKI DR TGE++YG VP+ SVVV G+ P
Sbjct: 182 DNCFIGARSEVVEGVIVEENSVISMGVYIGQSTKIYDRATGEVSYGRVPAGSVVVSGNLP 241

Query: 246 SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
           S + K       LYCAVI+KKVD +TR+KTSIN LLR
Sbjct: 242 SADGK-----YSLYCAVIVKKVDAQTRAKTSINELLR 273


>gi|119471170|ref|ZP_01613702.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Alteromonadales bacterium TW-7]
 gi|119445826|gb|EAW27108.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Alteromonadales bacterium TW-7]
          Length = 275

 Score =  281 bits (719), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 146/280 (52%), Positives = 205/280 (73%), Gaps = 11/280 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNES-IPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +S L+ +I++ ++  +  + S +  DVK A+   L+LLD G  R+A +  +G W  HQW+
Sbjct: 1   MSDLKTMIENAWDNRDCISPSTVSSDVKQAIIDALELLDSGAARVAEKI-SGEWVVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I   + ++DG   + ++DK+P KF D+  + F++   R++P  + R  +++
Sbjct: 60  KKAVLLSFRIRDNQPMNDG--VNQFYDKVPLKFSDYTPEQFQQGGMRVVPNAVARKGSFV 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G   VLMPS+VN+GAY+ +G+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 GKNVVLMPSYVNIGAYVDDGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG ++ EG+V+ MGV+I +ST+I DR TGEI YG VP+ +VVVPG+
Sbjct: 178 IEDNCFIGARSEIVEGVVVEEGAVISMGVYISQSTRIYDRETGEIHYGRVPAGAVVVPGA 237

Query: 244 YPSINLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLR 282
            PS +      G H LY A+I+KKVD++TR K  IN LLR
Sbjct: 238 LPSKD------GTHSLYAAIIVKKVDQQTREKVGINALLR 271


>gi|89900831|ref|YP_523302.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Rhodoferax ferrireducens T118]
 gi|122479225|sp|Q21WT2|DAPD_RHOFD RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|89345568|gb|ABD69771.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Rhodoferax ferrireducens T118]
          Length = 274

 Score =  281 bits (719), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 141/281 (50%), Positives = 201/281 (71%), Gaps = 8/281 (2%)

Query: 4   IVSTLEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L+ IID+ +E+ +N  + + P++V DAV+  +  L+ G +R+A+R+  G W THQW
Sbjct: 1   MTQQLQSIIDAAWEDRANLSSAAAPKEVLDAVEHVISDLNAGRLRVATRESVGQWTTHQW 60

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF++   +++  G+    ++DK+P KF     +  +    R++P  + R  +Y
Sbjct: 61  IKKAVLLSFRLTDNQVMKAGD--LGFYDKVPTKFAHLDEEAMKASGVRVVPPAVARRGSY 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           +    +LMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPT
Sbjct: 119 LAKGVILMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPT 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSE+VEG I+ E SV+ MGV++G+ST I DR T  ++YG +PS SVV+ G
Sbjct: 179 IIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTPIYDRATDTVSYGRIPSGSVVISG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S P    K       LY A+I+K+VD +TR+KTS+N LLRD
Sbjct: 239 SLPKNEGKYS-----LYAAIIVKRVDAQTRAKTSLNDLLRD 274


>gi|121604714|ref|YP_982043.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Polaromonas naphthalenivorans CJ2]
 gi|120593683|gb|ABM37122.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Polaromonas naphthalenivorans CJ2]
          Length = 275

 Score =  281 bits (719), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 140/277 (50%), Positives = 197/277 (71%), Gaps = 8/277 (2%)

Query: 8   LEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+  ID+ +E  +N  + S P++V +AV+  ++ L+ G +R+A+R+  G W  HQW+KKA
Sbjct: 6   LQATIDAAWENRANLSSASAPKEVLEAVEHAIEQLNNGTLRVATREGVGQWTVHQWLKKA 65

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++   +++  G     ++DK+P KF +   ++      R++P  + R  ++I   
Sbjct: 66  VLLSFRLKDNELMRAGE--LGFYDKVPTKFANLSEQEMRATGVRVVPPAVARRGSFIAKG 123

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
           A+LMPS+VN+GAY+ EG+M+DTW+ VGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTIIED
Sbjct: 124 AILMPSYVNIGAYVDEGTMVDTWAAVGSCAQIGKNVHLSGGVGIGGVLEPMQANPTIIED 183

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCFIGARSE+VEG I+ E SVL MGV+IG+ST I DR +  ++YG +P+ SVVV G+ P 
Sbjct: 184 NCFIGARSEVVEGVIVEENSVLSMGVYIGQSTPIYDRESDTVSYGRIPAGSVVVSGNLPK 243

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              K       LYCAVI+K+VD KTR+ TS+N LLRD
Sbjct: 244 AGGK-----YSLYCAVIVKRVDAKTRATTSLNDLLRD 275


>gi|167624898|ref|YP_001675192.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shewanella halifaxensis HAW-EB4]
 gi|189082821|sp|B0TP86|DAPD_SHEHH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|167354920|gb|ABZ77533.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella halifaxensis HAW-EB4]
          Length = 274

 Score =  281 bits (718), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 152/282 (53%), Positives = 201/282 (71%), Gaps = 15/282 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDVKDAVQSTLD----LLDRGIIRIASRDDNGHWNTH 60
           +  L + I++ FE   ++ E  P  V+ +V++ ++    +LD G  R+A + D G W+ H
Sbjct: 1   MEALRQRIEAAFE---ARAEITPTTVEPSVRADVEKVIAMLDTGEARVAEKID-GQWHVH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+I   ++I DG   + ++DK+P KF D+    F K   R++P   VR  
Sbjct: 57  QWLKKAVLLSFRIFDNQVI-DG-AETKYFDKVPMKFADYDEARFRKEAIRVVPPAAVRKG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           ++IG   VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q G
Sbjct: 115 SFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAG 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TGE+ YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGEVHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            G+ PS           LY A+I+KKVDEKTR K  IN LLR
Sbjct: 235 AGNLPS-----KCGTYSLYAAIIVKKVDEKTRGKVGINELLR 271


>gi|170727623|ref|YP_001761649.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shewanella woodyi ATCC 51908]
 gi|169812970|gb|ACA87554.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella woodyi ATCC 51908]
          Length = 274

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 149/279 (53%), Positives = 198/279 (70%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L + I++ FE  +     ++   V+  V+  +++LD G  R+A + D G W+ HQW+
Sbjct: 1   MEALRQRIEAAFEVRAEISPSTVEPSVRADVEKAINMLDTGEARVAEKID-GQWHVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I    +I DG   + ++DK+P KF D+    F +   R++P   VR  ++I
Sbjct: 60  KKAVLLSFRIFDNAVI-DG-AETKYFDKVPMKFADYDEARFREEAIRVVPPAAVRKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G   VLMPS+VN+GAY+ EGSM+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTI
Sbjct: 118 GKNTVLMPSYVNLGAYVDEGSMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGV++G+ST+I DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIFDRETGEIHYGRVPAGSVVVSGT 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS          +LY A+I+KKVD KTR+K  IN LLR
Sbjct: 238 LPS-----KCGTYNLYAAIIVKKVDAKTRAKVGINELLR 271


>gi|157376296|ref|YP_001474896.1| 2,3,4,5-tetrahydropyridine-2-carboxylate N-succinyltransferase
           [Shewanella sediminis HAW-EB3]
 gi|189082823|sp|A8FY45|DAPD_SHESH RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|157318670|gb|ABV37768.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella sediminis HAW-EB3]
          Length = 274

 Score =  280 bits (717), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 149/279 (53%), Positives = 199/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L + I++ FE  +     S+   V+  V+  + +LD+G  R+A + D G W+ HQW+
Sbjct: 1   MEALRQRIEAAFEARAEITPNSVEPSVRADVEKAISMLDKGEARVAEKID-GQWHVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I    +I DG G + ++DK+P KF D+    F++   R++P   VR  ++I
Sbjct: 60  KKAVLLSFRIFDNGVI-DG-GETKYFDKVPMKFADYDEARFKEEAIRVVPPATVRKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G   VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTI
Sbjct: 118 GKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGV++G+ST+I DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEVHYGRVPAGSVVVSGT 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS          +LY A+I+KKVD KTR K  IN LLR
Sbjct: 238 LPS-----KCGTYNLYAAIIVKKVDAKTRGKVGINELLR 271


>gi|2392550|pdb|1TDT|A Chain A, Three-Dimensional Structure Of Tetrahydrodipicolinate-N-
           Succinlytransferase
 gi|2392551|pdb|1TDT|B Chain B, Three-Dimensional Structure Of Tetrahydrodipicolinate-N-
           Succinlytransferase
 gi|2392552|pdb|1TDT|C Chain C, Three-Dimensional Structure Of Tetrahydrodipicolinate-N-
           Succinlytransferase
          Length = 259

 Score =  280 bits (715), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 195/270 (72%), Gaps = 15/270 (5%)

Query: 5   VSTLEEIIDSFFEESNSKNESIPQDV----KDAVQSTLDLLDRGIIRIASRDDNGHWNTH 60
           +  L+ +I+S FE    + +  P +V    ++AV   + LLD G +R+A + D G W TH
Sbjct: 1   MQQLQNVIESAFER---RADITPANVDTVTREAVNQVIGLLDSGALRVAEKID-GQWVTH 56

Query: 61  QWIKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHS 120
           QW+KKA+LLSF+IN  K++ DG   + ++DK+P KF D+    F+K  FR++P   VR  
Sbjct: 57  QWLKKAVLLSFRINDNKVM-DG-AETRYYDKVPMKFADYDEARFQKEGFRVVPPATVRQG 114

Query: 121 AYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
           A+I    VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  
Sbjct: 115 AFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAN 174

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVV 240
           PTIIEDNCFIGARSE+VEG I+ EGSV+ MGV++G+ST+I DR TGEI YG VP+ SVVV
Sbjct: 175 PTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVV 234

Query: 241 PGSYPSINLKGDIAGPHLYCAVIIKKVDEK 270
            G+ PS +         LYCAVI+KKVD K
Sbjct: 235 SGNLPSKD-----GSYSLYCAVIVKKVDAK 259


>gi|119774273|ref|YP_927013.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shewanella amazonensis SB2B]
 gi|166224224|sp|A1S4N7|DAPD_SHEAM RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|119766773|gb|ABL99343.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella amazonensis SB2B]
          Length = 274

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 200/279 (71%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L + I++ FE  +N    S+   V+  V++ +++LD+G +R+A + D G W+ +QW+
Sbjct: 1   MEALRQRIEAAFEARANITPSSVEPGVRADVETVINMLDKGEMRVAEKID-GQWHVNQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I    +I  G   + ++DK+P KF D+    F     R++P   VR  ++I
Sbjct: 60  KKAVLLSFRIFDNGVIEGGE--TKYFDKVPMKFADYDEARFRAEAIRVVPPAAVRKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G   VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTI
Sbjct: 118 GKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG ++ EGSV+ MGV+IG+ST+I DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVSGT 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS          +LY A+I+KKVDEKTR K  IN LLR
Sbjct: 238 LPS-----SCGKYNLYAAIIVKKVDEKTRGKVGINELLR 271


>gi|120611155|ref|YP_970833.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Acidovorax citrulli AAC00-1]
 gi|166224189|sp|A1TQ21|DAPD_ACIAC RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|120589619|gb|ABM33059.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidovorax citrulli AAC00-1]
          Length = 274

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 199/281 (70%), Gaps = 8/281 (2%)

Query: 4   IVSTLEEIIDSFFEESNSKNESI-PQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L+ IID+ +E   S + S  P++V+DAV+  +  LD G +R+A+R+  G W  HQW
Sbjct: 1   MTQQLQNIIDTAWENRASLSPSAAPREVQDAVEHVIAELDAGKLRVATREGVGQWTVHQW 60

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF++   ++I  G+    ++DK+P KF      +      R++P  + R  ++
Sbjct: 61  IKKAVLLSFRLKDNELIEAGS--LGFYDKVPTKFAGRSAAEMAATGVRVVPPAVARRGSF 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   A+LMPS+VN+GAY+ EG+M+DTW+TVGSCAQ+GK+VH+SGGVG+GGVLEP+Q  PT
Sbjct: 119 IAKGAILMPSYVNIGAYVDEGTMVDTWATVGSCAQVGKHVHLSGGVGLGGVLEPLQANPT 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSEIVEG I+ E SV+ MGV+IG+ST I DR T  ++YG VP+ SVVV G
Sbjct: 179 IIEDNCFIGARSEIVEGVIVEENSVISMGVYIGQSTPIYDRATDTVSYGRVPAGSVVVSG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S P    KGD     +Y A+I+KKVD KTRS TS+N LLRD
Sbjct: 239 SLP----KGD-GKYSMYAAIIVKKVDAKTRSTTSLNDLLRD 274


>gi|126173685|ref|YP_001049834.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shewanella baltica OS155]
 gi|152999974|ref|YP_001365655.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shewanella baltica OS185]
 gi|160874595|ref|YP_001553911.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shewanella baltica OS195]
 gi|217974063|ref|YP_002358814.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Shewanella baltica OS223]
 gi|304409559|ref|ZP_07391179.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella baltica OS183]
 gi|307303917|ref|ZP_07583670.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella baltica BA175]
 gi|166224225|sp|A3D2K2|DAPD_SHEB5 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|166224226|sp|A6WLA3|DAPD_SHEB8 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|189082820|sp|A9KUK2|DAPD_SHEB9 RecName: Full=2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
           N-succinyltransferase; AltName:
           Full=Tetrahydrodipicolinate N-succinyltransferase;
           Short=THDP succinyltransferase; Short=THP
           succinyltransferase; Short=Tetrahydropicolinate
           succinylase
 gi|125996890|gb|ABN60965.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella baltica OS155]
 gi|151364592|gb|ABS07592.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella baltica OS185]
 gi|160860117|gb|ABX48651.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella baltica OS195]
 gi|217499198|gb|ACK47391.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella baltica OS223]
 gi|304352077|gb|EFM16475.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella baltica OS183]
 gi|306912815|gb|EFN43238.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella baltica BA175]
 gi|315266836|gb|ADT93689.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Shewanella baltica OS678]
          Length = 274

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 150/279 (53%), Positives = 202/279 (72%), Gaps = 9/279 (3%)

Query: 5   VSTLEEIIDSFFE-ESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L + I++ FE  ++    ++   V+D VQ+ +++LD+G +R+A + D G W+ HQW+
Sbjct: 1   MEALRQRIEAAFEARADITPSTVDASVRDDVQNVINMLDKGEVRVAEKID-GQWHVHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+I    +I DG   + ++DK+P KF ++    F+    R++P   VR  ++I
Sbjct: 60  KKAVLLSFRIFDNVVI-DG-AETKYFDKVPLKFAEYDEARFKAEAIRVVPSATVRKGSFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
           G   VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q GPTI
Sbjct: 118 GKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSEIVEG ++ EGSV+ MGV+IG+ST+I DR TGE+ YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIYDRETGEVHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLR 282
            PS   K       LY A+I+KKVD KTR K  IN LLR
Sbjct: 238 LPSACGK-----YSLYAAIIVKKVDAKTRGKVGINELLR 271


>gi|209542533|ref|YP_002274762.1| 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530210|gb|ACI50147.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 281

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 147/279 (52%), Positives = 194/279 (69%), Gaps = 5/279 (1%)

Query: 7   TLEEIIDSFFEESNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
            L   I++ +E  ++ + +     ++AV+  L  LD G +R+A+  D G W  ++W+KKA
Sbjct: 6   ALRTHIEAAWERRDTLSSATKGADREAVEHALAGLDSGALRVATPTDAG-WVVNEWLKKA 64

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++N + ++      + ++DK+P KF  W    F +  FR +PG IVR SAYI P 
Sbjct: 65  VLLSFRLNDSHVMPAAP--APFFDKVPLKFQGWDEAQFGQAAFRAVPGAIVRRSAYIAPG 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            VLMPSFVN GA +  G+M+DTW T+GSCAQIG+N HISGGVGIGGVLEP+Q  P IIED
Sbjct: 123 VVLMPSFVNAGARVESGTMVDTWVTIGSCAQIGRNCHISGGVGIGGVLEPLQAAPVIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYP- 245
           +CFIGARSE+ EG I+  GSVL MGVF+  STKI+DR TGE+  G VP+YSVVVPG+ P 
Sbjct: 183 DCFIGARSEVAEGVIVERGSVLSMGVFLSASTKIVDRTTGEVFVGRVPAYSVVVPGTLPP 242

Query: 246 -SINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
            + +       P L CAVI+K+VDE+TRSKTSIN LLRD
Sbjct: 243 RTPHAADGTPLPALACAVIVKRVDERTRSKTSINELLRD 281


>gi|326317532|ref|YP_004235204.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323374368|gb|ADX46637.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
           [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 274

 Score =  278 bits (712), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 147/281 (52%), Positives = 200/281 (71%), Gaps = 8/281 (2%)

Query: 4   IVSTLEEIIDSFFEESNSKNESI-PQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQW 62
           +   L+ IID+ +E   S + S  P++V+DAV+  +  LD G +R+A+R+  G W  HQW
Sbjct: 1   MTQQLQNIIDTAWENRASLSPSAAPREVQDAVEHVIAELDAGKLRVATREGVGQWTVHQW 60

Query: 63  IKKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAY 122
           IKKA+LLSF++   ++I  G+    ++DK+P KF     ++      R++P  + R  ++
Sbjct: 61  IKKAVLLSFRLKDNELIEAGS--LGFYDKVPTKFAGRSAEEMAAIGVRVVPPAVARRGSF 118

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPT 182
           I   A+LMPS+VN+GAY+ EG+M+DTW+TVGSCAQ+GK+VH+SGGVG+GGVLEP+Q  PT
Sbjct: 119 IARGAILMPSYVNIGAYVDEGTMVDTWATVGSCAQVGKHVHLSGGVGLGGVLEPLQANPT 178

Query: 183 IIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPG 242
           IIEDNCFIGARSEIVEG I+ E SV+ MGV+IG+ST I DR T  ++YG VP+ SVVV G
Sbjct: 179 IIEDNCFIGARSEIVEGVIVEENSVISMGVYIGQSTPIYDRTTDTVSYGRVPAGSVVVSG 238

Query: 243 SYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
           S P    KGD     +Y A+I+KKVD KTRS TS+N LLRD
Sbjct: 239 SLP----KGD-GKYSMYAAIIVKKVDAKTRSTTSLNDLLRD 274


>gi|260219434|emb|CBA26279.1| 2,3,4,5-tetrahydropyridine-2,6-dicarboxylateN-succinyltransferase
           [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 274

 Score =  278 bits (712), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 143/277 (51%), Positives = 199/277 (71%), Gaps = 8/277 (2%)

Query: 8   LEEIIDSFFEE-SNSKNESIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKA 66
           L+ +I++ +E+ +N    S P +V +AV+  L+ LD G +R+A+R+  G W THQWIKKA
Sbjct: 5   LQSVIEAAWEDRANISVASAPAEVLEAVEHVLNELDAGRLRVATREGVGQWTTHQWIKKA 64

Query: 67  ILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPK 126
           +LLSF++   ++I  G+    ++DK+P KF     +  +    R++P  + R  ++ G  
Sbjct: 65  VLLSFRLKDNEVIQSGD--LGFYDKVPTKFAGMSAEALKATGVRVVPPAVARRGSFQGKG 122

Query: 127 AVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIED 186
            +LMPS+ N+G+Y+ EG+M+DTW+TVGSCAQIGK+VH+SGGVGIGGVLEP+Q GPTIIED
Sbjct: 123 VILMPSYCNIGSYVDEGTMVDTWATVGSCAQIGKHVHLSGGVGIGGVLEPMQAGPTIIED 182

Query: 187 NCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPS 246
           NCF+GARSE+VEG I+ E SV+ MGV+IG+ST I DR T  ++YG +P+ SVVV GS P 
Sbjct: 183 NCFVGARSEVVEGVIVEENSVISMGVYIGQSTPIYDRATDTVSYGRIPAGSVVVSGSLP- 241

Query: 247 INLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRD 283
              KGD     +Y A+I+KKVD KTRS TS+N LLRD
Sbjct: 242 ---KGD-GKYSMYAAIIVKKVDAKTRSTTSLNDLLRD 274


>gi|218196689|gb|EEC79116.1| hypothetical protein OsI_19753 [Oryza sativa Indica Group]
          Length = 468

 Score =  278 bits (711), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 148/277 (53%), Positives = 200/277 (72%), Gaps = 10/277 (3%)

Query: 9   EEIIDSFFEESNSKNESI-PQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIKKAI 67
           E IID+ +E   S + S  P++V+DAV+  +  LD G +R+A+R+  G W  HQWIKKA+
Sbjct: 200 ENIIDTAWENRASLSPSAAPREVQDAVEHVIAELDAGKLRVATREGVGQWTVHQWIKKAV 259

Query: 68  LLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA 127
           LLSF++   ++I  G+    ++DK+P KF     ++      R++P  + R  ++I   A
Sbjct: 260 LLSFRLKDNELIEAGS--LGFYDKVPTKFAGRSAEEMAATGVRVVPPAVARRGSFIARGA 317

Query: 128 VLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDN 187
           +LMPS+VN+GAY+ EG+M+DTW+TVGSCAQ+GK+VH+SGGVG+GGVLEP+Q  PTIIEDN
Sbjct: 318 ILMPSYVNIGAYVDEGTMVDTWATVGSCAQVGKHVHLSGGVGLGGVLEPLQANPTIIEDN 377

Query: 188 CFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSI 247
           CFIGARSEIVEG I+ E SV+ MGV+IG+ST I DR T  ++YG VP+ SVVV GS P  
Sbjct: 378 CFIGARSEIVEGVIVEENSVISMGVYIGQSTPIYDRTTDTVSYGRVPAGSVVVSGSLP-- 435

Query: 248 NLKGDIAGPH-LYCAVIIKKVDEKTRSKTSINTLLRD 283
             KGD  G + +Y A+I+KKVD KTRS TS+N LLRD
Sbjct: 436 --KGD--GKYSMYAAIIVKKVDAKTRSTTSLNDLLRD