PSIBLAST alignment of GI: 254780781 and protein with PDB id: 1kgq

gi|20150772|pdb|1KGQ|A Chain A, Crystal Structure Of Tetrahydrodipicolinate N- Succinyltransferase In Complex With L-2-Aminopimelate And Succinamide-Coa Length = 274
>gi|20150773|pdb|1KGT|A Chain A, Crystal Structure Of Tetrahydrodipicolinate N- Succinyltransferase In Complex With Pimelate And Succinyl- Coa Length = 274
 Score =  303 bits (775), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 153/282 (54%), Positives = 198/282 (70%), Gaps = 9/282 (3%)

Query: 5   VSTLEEIIDSFFEESNSKNE-SIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWI 63
           +  L+ +I+S FE        ++    ++AV   + LLD G +R+A + D G W THQW+
Sbjct: 1   MQQLQNVIESAFERRADITPANVDTVTREAVNQVIGLLDSGALRVAEKID-GQWVTHQWL 59

Query: 64  KKAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYI 123
           KKA+LLSF+IN  K++      + ++DK+P KF D+    F+K  FR++P   VR  A+I
Sbjct: 60  KKAVLLSFRINDNKVMDGAE--TRYYDKVPMKFADYDEARFQKEGFRVVPPATVRQGAFI 117

Query: 124 GPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTI 183
               VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTI
Sbjct: 118 ARNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTI 177

Query: 184 IEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS 243
           IEDNCFIGARSE+VEG I+ EGSV+ MGV++G+ST+I DR TGEI YG VP+ SVVV G+
Sbjct: 178 IEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVVSGN 237

Query: 244 YPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS 285
            PS +         LYCAVI+KKVD KTR K  IN LLR   
Sbjct: 238 LPSKDGS-----YSLYCAVIVKKVDAKTRGKVGINELLRTID 274