PSIBLAST alignment of GI: 254780781 and protein with PDB id: 1ssq

>gi|49259141|pdb|1SSQ|A Chain A, Serine Acetyltransferase- Complex With Cysteine Length = 267
>gi|49259142|pdb|1SSQ|D Chain D, Serine Acetyltransferase- Complex With Cysteine Length = 267
 Score = 58.2 bits (139), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 43/114 (37%), Gaps = 8/114 (7%)

Query: 127 AVLMPSFVNMGAYIGEGSMIDT--WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
           +V     ++  A IG G M D      VG  + I  +V I  GV +GG  +        +
Sbjct: 133 SVAFDVDIHPAAKIGHGIMFDHATGIVVGETSVIENDVSILQGVTLGGTGKESGDRHPKV 192

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSV 238
            +   IGA ++I+    + + + +G    +           G      VP+  V
Sbjct: 193 REGVMIGAGAKILGNIEVGKYAKIGANSVVLNPVPEYATAAG------VPARIV 240