PSIBLAST alignment of GI: 254780781 and protein with PDB id: 3bxy

>gi|166235502|pdb|3BXY|A Chain A, Crystal Structure Of Tetrahydrodipicolinate N- Succinyltransferase From E. Coli Length = 285
 Score =  300 bits (769), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 155/281 (55%), Positives = 197/281 (70%), Gaps = 9/281 (3%)

Query: 6   STLEEIIDSFFEESNSKNE-SIPQDVKDAVQSTLDLLDRGIIRIASRDDNGHWNTHQWIK 64
             L+ II++ FE        +     ++AV   + LLD G +R+A + D G W THQW+K
Sbjct: 13  QQLQNIIETAFERRAEITPANADTVTREAVNQVIALLDSGALRVAEKID-GQWVTHQWLK 71

Query: 65  KAILLSFQINPTKIISDGNGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIG 124
           KA+LLSF+IN  ++I      S ++DK+P KF D+    F+K  FR++P   VR  A+I 
Sbjct: 72  KAVLLSFRINDNQVIEGAE--SRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQGAFIA 129

Query: 125 PKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTII 184
              VLMPS+VN+GAY+ EG+M+DTW+TVGSCAQIGKNVH+SGGVGIGGVLEP+Q  PTII
Sbjct: 130 RNTVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTII 189

Query: 185 EDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSY 244
           EDNCFIGARSE+VEG I+ EGSV+ MGV+IG+ST+I DR TG+I YG VP+ SVVV G+ 
Sbjct: 190 EDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGDIHYGRVPAGSVVVSGNL 249

Query: 245 PSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLLRDYS 285
           PS + K       LYCAVI+KKVD KTR K  IN LLR   
Sbjct: 250 PSKDGK-----YSLYCAVIVKKVDAKTRGKVGINELLRTID 285