PSIBLAST alignment of GI: 254780781 and protein with PDB id: 3cj8

>gi|170785257|pdb|3CJ8|A Chain A, Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- Carboxylate N-Succinyltransferase From Enterococcus Faecalis V583 Length = 236
>gi|170785258|pdb|3CJ8|B Chain B, Crystal Structure Of 2,3,4,5-Tetrahydropyridine-2- Carboxylate N-Succinyltransferase From Enterococcus Faecalis V583 Length = 236
 Score = 87.5 bits (215), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 54/181 (29%), Positives = 85/181 (46%), Gaps = 33/181 (18%)

Query: 103 DFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFV-NMGAYIGEGSMIDTWSTVGSCAQIGKN 161
           D +  N RI PG ++R    IG +AV+    + N+GA +G G+ ID  + +G  A +GK+
Sbjct: 86  DLKDINARIEPGALIREKVEIGDQAVIXXGAILNIGAVVGAGTXIDXGAVLGGRATVGKH 145

Query: 162 VHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKII 221
            HI  G  + GV+EP    P +IE+   IGA + ++EG                   +  
Sbjct: 146 CHIGAGTVLAGVIEPPSAAPVVIENEVVIGANAVVLEGVR---------------VGEGA 190

Query: 222 DRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYCAVIIKKVDEKTRSKTSINTLL 281
               G +   +VP+++VV                     A +IK++D+KT+SKT I   L
Sbjct: 191 VVAAGAVVVEDVPAHTVV-----------------AGVPAKVIKQIDDKTKSKTEILEEL 233

Query: 282 R 282
           R
Sbjct: 234 R 234