PSIBLAST alignment of GI: 254780781 and protein with PDB id: 3eh0

>gi|256032569|pdb|3EH0|A Chain A, Crystal Structure Of Lpxd From Escherichia Coli Length = 341
>gi|256032570|pdb|3EH0|B Chain B, Crystal Structure Of Lpxd From Escherichia Coli Length = 341
>gi|256032571|pdb|3EH0|C Chain C, Crystal Structure Of Lpxd From Escherichia Coli Length = 341
 Score = 55.1 bits (131), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 41/170 (24%), Positives = 63/170 (37%), Gaps = 19/170 (11%)

Query: 107 HNFRIIPGTIVRHSAYIGPKAVL-MPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHIS 165
           +N  I    ++     +G   ++    FV   + IG GS +    T+    QIG+N  I 
Sbjct: 114 NNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQ 173

Query: 166 GGVGIGGV-----------LEPIQTGPTIIEDNCFIGARSEIVEG----CIIREGSVLGM 210
            G  +G             ++  Q G  II D   IGA + I  G     II  G ++  
Sbjct: 174 SGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDN 233

Query: 211 GVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGSYPSINLKGDIAGPHLYC 260
              I  +  I D     +  G + + S+ + G Y  I     I G    C
Sbjct: 234 QCQIAHNVVIGDNTA--VAGGVIMAGSLKI-GRYCMIGGASVINGHMEIC 280