PSIBLAST alignment of GI: 254780781 and protein with PDB id: 3fs8

>gi|223674077|pdb|3FS8|A Chain A, Crystal Structure Of Qdtc, The Dtdp-3-Amino-3,6-Dideoxy-D- Glucose N-Acetyl Transferase From Thermoanaerobacterium Thermosaccharolyticum In Complex With Acetyl-Coa Length = 273
>gi|223674078|pdb|3FS8|B Chain B, Crystal Structure Of Qdtc, The Dtdp-3-Amino-3,6-Dideoxy-D- Glucose N-Acetyl Transferase From Thermoanaerobacterium Thermosaccharolyticum In Complex With Acetyl-Coa Length = 273
 Score = 47.4 bits (111), Expect = 0.002,   Method: Composition-based stats.
 Identities = 37/203 (18%), Positives = 69/203 (33%), Gaps = 34/203 (16%)

Query: 94  AKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVG 153
            +    +   +  +   I     ++  ++IG +++L    V+      +         +G
Sbjct: 18  GENVTIEDNVYIDYGCIIRDNVHIKKGSFIGARSILGEYLVDFYN---DRINKKHPLIIG 74

Query: 154 SCAQIGKNVHISGGVGIGGVLEPIQT----GPTIIEDNCFIGARSEIVEGCIIREGSVLG 209
             A I     I G   IG   +          T I +N  IG  S+I     I     + 
Sbjct: 75  ENALIRTENVIYGDTIIGDNFQTGHKVTIRENTKIGNNVKIGTLSDIQHHVYIGNYVNIH 134

Query: 210 MGVFIGKSTKIID--------RNTGEIT-------------YGEVPSYSVVVPGSYPSIN 248
             VF+G+ + I D          T + T             +  + + SVV+PG + + +
Sbjct: 135 SNVFVGEKSIIKDFVWLFPHVVLTNDPTPPSNELLGVTIELFAVIAARSVVLPGIHINED 194

Query: 249 LKGDIAGPHLYCAVIIKKVDEKT 271
                       AV+ K V ++T
Sbjct: 195 ALVGAG------AVVTKDVPKET 211