PSIBLAST alignment of GI: 254780781 and protein with PDB id: 3fww

gi|225734164|pdb|3FWW|A Chain A, The Crystal Structure Of The Bifunctional N-Acetylglucosamine-1- Phosphate UridyltransferaseGLUCOSAMINE-1-Phosphate Acetyltransferase From Yersinia Pestis Co92 Length = 456
 Score = 56.2 bits (134), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 33/141 (23%), Positives = 57/141 (40%), Gaps = 9/141 (6%)

Query: 94  AKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKAVLMPSFVNMG-AYIGEGSMIDTWSTV 152
                         N  + P   +R  A +   A  + +FV +  A +G+GS     S +
Sbjct: 309 ISPYTVLEDARLDANCTVGPFARLRPGAELAEGA-HVGNFVEIKKARLGKGSKAGHLSYL 367

Query: 153 GSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGV 212
           G  A+IG  V+I  G  I    +      TII D+ F+G+ +++V    +  G+ +G G 
Sbjct: 368 G-DAEIGAGVNIGAGT-ITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVANGATIGAGT 425

Query: 213 FIGKSTKIIDRNTGEITYGEV 233
            + +     D    E+    V
Sbjct: 426 TVTR-----DVAENELVISRV 441