PSIBLAST alignment of GI: 254780781 and protein with PDB id: 3gvd

>gi|237640606|pdb|3GVD|A Chain A, Crystal Structure Of Serine Acetyltransferase Cyse From Yersinia Pestis Length = 276
>gi|237640607|pdb|3GVD|B Chain B, Crystal Structure Of Serine Acetyltransferase Cyse From Yersinia Pestis Length = 276
 Score = 62.4 bits (150), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 33/177 (18%), Positives = 62/177 (35%), Gaps = 10/177 (5%)

Query: 83  NGYSTWWDKIPAKFDDWKTKDFEKHNFRIIPGTIVRHSAYIGPKA-VLMPSFVNMGAYIG 141
           +     +         +      +    +        + Y+  +  V     ++  A IG
Sbjct: 95  DPAVDKYSTPLLYLKGFHALQAYRIGHWLWAQDRKALAIYLQNQVSVAFGVDIHPAATIG 154

Query: 142 EGSMIDT--WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEG 199
            G M+D      +G  A +  +V I   V +GG  +        I +   IGA ++I+  
Sbjct: 155 CGIMLDHATGIVIGETAVVENDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGN 214

Query: 200 CIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSYSVVVPGS-YPSINLKGDIAG 255
             +  G+ +G G  + +S        G      VP+  V  P S  PS+++     G
Sbjct: 215 IEVGRGAKIGAGSVVLQSVPAHTTAAG------VPARIVGKPESDKPSLDMDQHFNG 265