PSIBLAST alignment of GI: 254780781 and protein with PDB id: 3mc4

>gi|294979842|pdb|3MC4|A Chain A, Crystal Structure Of WwRSP5WWP DOMAIN: BACTERIAL Transferase Hexapeptide Repeat: Serine O-Acetyltransferase From Brucella Melitensis Length = 287
>gi|294979843|pdb|3MC4|B Chain B, Crystal Structure Of WwRSP5WWP DOMAIN: BACTERIAL Transferase Hexapeptide Repeat: Serine O-Acetyltransferase From Brucella Melitensis Length = 287
 Score = 59.3 bits (142), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 44/116 (37%), Gaps = 8/116 (6%)

Query: 123 IGPKAVLMPSFVNMGAYIGEGSMIDT--WSTVGSCAQIGKNVHISGGVGIGGVLEPIQTG 180
               + +  + ++  A +G G  +D      VG  A +  NV I  GV +GG  +     
Sbjct: 156 QSRSSSIFQTDIHPAARLGSGLFLDHATGLVVGETAVVEDNVSILHGVTLGGTGKSSGDR 215

Query: 181 PTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKIIDRNTGEITYGEVPSY 236
              I     IGA ++I+    + + S +  G  + KS        G      VP+ 
Sbjct: 216 HPKIRQGVLIGAGAKILGNIQVGQXSKIAAGSVVLKSVPHNVTVAG------VPAR 265