RPSBLAST alignment for GI: 254780781 and conserved domain: cd04649

>gnl|CDD|100054 cd04649, LbH_THP_succinylT_putative, Putative 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (THP succinyltransferase), C-terminal left-handed parallel alpha-helix (LbH) domain: This group is composed of mostly uncharacterized proteins containing an N-terminal domain of unknown function and a C-terminal LbH domain with similarity to THP succinyltransferase LbH. THP succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA. It is the committed step in the succinylase pathway by which bacteria synthesize L-lysine and meso-diaminopimelate, a component of peptidoglycan. The enzyme is trimeric and displays the left-handed parallel alpha-helix (LbH) structural motif encoded by the hexapeptide repeat motif.. Length = 147
 Score = 49.3 bits (118), Expect = 1e-06
 Identities = 30/114 (26%), Positives = 46/114 (40%), Gaps = 5/114 (4%)

Query: 108 NFRIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISG 166
             RI     VR  AY+     +M   FVN  A      M++    + S   +GK   + G
Sbjct: 1   GVRIADADRVRLGAYLAEGTTVMHEGFVNFNAGTLGNCMVE--GRISSGVIVGKGSDVGG 58

Query: 167 GVGIGGVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKI 220
           G  I G L         I   C +GA S I  G  + +  ++  G+++   TK+
Sbjct: 59  GASIMGTLSGGGNNVISIGKRCLLGANSGI--GISLGDNCIVEAGLYVTAGTKV 110