RPSBLAST alignment for GI: 254780781 and conserved domain: PRK00892

>gnl|CDD|179158 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional. Length = 343
 Score = 45.1 bits (108), Expect = 2e-05
 Identities = 40/139 (28%), Positives = 55/139 (39%), Gaps = 28/139 (20%)

Query: 110 RIIPGTIVRHSAYIGPKAVLMP-SFVNMGAYIGEGSMI--DTW----STVGSCAQIGKNV 162
           +I  G  +  +A IG   V+     +  GA IG+G  I  D       T+    +IG  V
Sbjct: 114 KIGEGVSIGPNAVIGAGVVIGDGVVIGAGAVIGDGVKIGADCRLHANVTIYHAVRIGNRV 173

Query: 163 HISGGVGIG----------GVLEPI-QTGPTIIEDNCFIGARSEI----VEGCIIREGSV 207
            I  G  IG          G    I Q G  II D+  IGA + I    ++  +I EG  
Sbjct: 174 IIHSGAVIGSDGFGFANDRGGWVKIPQLGRVIIGDDVEIGANTTIDRGALDDTVIGEGVK 233

Query: 208 L------GMGVFIGKSTKI 220
           +         V IG+ T I
Sbjct: 234 IDNLVQIAHNVVIGRHTAI 252