RPSBLAST alignment for GI: 254780781 and conserved domain: PRK00892

>gnl|CDD|179158 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional. Length = 343
 Score = 43.2 bits (103), Expect = 8e-05
 Identities = 28/106 (26%), Positives = 35/106 (33%), Gaps = 27/106 (25%)

Query: 111 IIPGTIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGI 170
           I P  ++  SA IG    + P      A IG G              IG  V I  G  I
Sbjct: 103 IHPSAVIDPSAKIGEGVSIGP-----NAVIGAG------------VVIGDGVVIGAGAVI 145

Query: 171 G-GVLEPIQTGPTIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIG 215
           G GV          I  +C + A   I     I    ++  G  IG
Sbjct: 146 GDGV---------KIGADCRLHANVTIYHAVRIGNRVIIHSGAVIG 182