RPSBLAST alignment for GI: 254780781 and conserved domain: COG1044

>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl]. Length = 338
 Score = 52.2 bits (125), Expect = 1e-07
 Identities = 34/107 (31%), Positives = 46/107 (42%), Gaps = 9/107 (8%)

Query: 115 TIVRHSAYIGPKAVLMPSFVNMGAYIGEGSMIDTWSTVGSCAQIGKNVHISGGVGIGGVL 174
                +A I P AV+ P+     A IG+   I     +G+   IG+NV I  G  IG   
Sbjct: 94  RPFNPAAGIHPTAVIDPT-----ATIGKNVSIGPNVVIGAGVVIGENVVIGAGAVIG--- 145

Query: 175 EPIQTGP-TIIEDNCFIGARSEIVEGCIIREGSVLGMGVFIGKSTKI 220
           E ++ G  T+I  N  I     I    II  G+V+G   F    T I
Sbjct: 146 ENVKIGDGTVIHPNVTIYHNVVIGNNVIIHSGAVIGADGFGYAGTAI 192