>TIGR01883 PepT-like peptidase T-like protein; InterPro: IPR010162 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases . Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. This entry represents metallopeptidases belonging to MEROPS peptidase family M20 (clan MH), subfamily M20B. They are tripeptide aminopeptidases, commonly referred to as peptidase T, which have a substrate preference for hydrophobic peptides. .

Probab=100.00 E-value=0 Score=331.70 Aligned_cols=352 Identities=20% Similarity=0.259 Sum_probs=296.5 Q ss_pred HHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCEEEEEEEEECC-C--CCEEEEECCCCCCCCCCH Q ss_conf 9999999964999789968999999999997798489997058887624899999879-9--988999733681578887 Q gi|254780782|r 5 CLEHLIQLIKCPSVTPQDGGAFFILVNTLKLLGFSIEEKDFQTKNTSIVKNLYARFGT-E--APHLMFAGHIDVVPPGDF 81 (389) Q Consensus 5 ~v~~l~~lv~ips~s~~e~~~~~~l~~~l~~~G~~~~~~~~~~~~~~~~~~~~~~~g~-~--~~~ill~~H~Dtvp~~~~ 81 (389) T Consensus 2 l~~~FleLiQIdS~sg~Ek~i~~~lk~q~~~Lg~~v~~d~~~~e~G~~~~nLiarl~gtt~~~dtI~F~~H~DTv~pg~g 81 (363) T TIGR01883 2 LVEEFLELIQIDSESGKEKKILKVLKKQLTELGIDVKKDDVMDEVGSNDNNLIARLKGTTVKFDTIFFSGHMDTVKPGAG 81 (363) T ss_pred CHHHHHHEEECCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCHHHCCCCCCCEEEEECCEECCCEEEEECCCCCCCCCCC T ss_conf 00230100413788742789999999975442850012674021046898515862032213770488213254789888 Q ss_pred HHCCCCCCCEEEECCCCCCCCC----CCCCCHHHHHHHHCCCCCCCCCCCCCEEEEEEEECCCEECCCCCCCCCCCCCCC Q ss_conf 7725666422452133236544----333201245441000000011357834999752022011044211111000133 Q gi|254780782|r 82 NHWTYPPFSATIAEGKIYGRGI----VDMKGSIACFIAAVARFIPKYKNFGSISLLITGDEEGPAINGTKKMLSWIEKKG 157 (389) Q Consensus 82 ~~W~~~Pf~~~~~~g~l~GrG~----~D~Kg~ia~~l~a~~~l~~~~~~~~~i~~~~~~dEE~~~~~G~~~l~~~~~~~~ 157 (389) T Consensus 82 -------~epvvEdGi~~s~g~TiLGaDDKag~AAmleA~~vl~~e~~~Hg~IEfifTv~EE~Gl-iG~~~fd~----~k 149 (363) T TIGR01883 82 -------VEPVVEDGIVKSKGGTILGADDKAGVAAMLEAVKVLKEEETEHGTIEFIFTVKEELGL-IGAKLFDE----EK 149 (363) T ss_pred -------CCCEEECCEEEECCCEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCC-HHHHHCCH----HH T ss_conf -------7506606578707854205511889999999999864137687618999970433411-21122671----12 Q ss_pred CCCCEEEECCCCCCCCCCEEEEEEEEEEEEEEEEEEEECCCCHH-HHCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCEEE Q ss_conf 21203541456654343100123222357999999641231000-00012013455443201122334456644210146 Q gi|254780782|r 158 EKWDACIVGEPTCNHIIGDTIKIGRRGSLSGEITIHGKQGHVAY-PHLTENPIRGLIPLLHQLTNIGFDTGNTTFSPTNM 236 (389) Q Consensus 158 ~~~d~~i~~ep~~~~~~~~~i~~g~rG~~~~~i~v~G~~~Hs~~-p~~g~nAi~~~~~~i~~l~~~~~~~~~~~~~~~~~ 236 (389) T Consensus 150 itA~ygy~LD~~--G~vG-ni~~aApt~~kv~a~I~gk~A~aG~~PE~GiSaI~vA~~Ai~~~~lgRIDeE------tta 220 (363) T TIGR01883 150 ITAAYGYVLDAD--GEVG-NIVLAAPTQVKVDATIAGKDAHAGLVPEDGISAISVAAKAISKMRLGRIDEE------TTA 220 (363) T ss_pred HHHHHCEEECCC--CCEE-EEEECCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCC------CCC T ss_conf 112111165286--8622-0687187102544553178665576667676889999999862889775541------320 Q ss_pred EEEEEEECCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHH Q ss_conf 67655420466655432116651343420677999999999987653242034311232226631125786789999999 Q gi|254780782|r 237 EITTIDVGNPSKNVIPAQVKMSFNIRFNDLWNEKTLKEEIRSRLIKGIQNVPKLSHTVHFSSPVSPVFLTHDRKLTSLLS 316 (389) Q Consensus 237 ~i~~i~~g~~~~NvIP~~a~~~~diR~~~~~~~~~i~~~i~~~l~~~~~~~~~~~~~i~~~~~~~p~~~~~~~~l~~~l~ 316 (389) T Consensus 221 nIg~f~-GG~~tniv~de~~ivaearsl~~~K~ea~vQ~~~e~Fe~aaek-~Gat~e~e~~~~Y~gfK~~~~~~~~~i~k 298 (363) T TIGR01883 221 NIGSFE-GGVNTNIVQDELKIVAEARSLSDRKLEAQVQKMRERFEQAAEK-YGATVEVETRLIYEGFKLEEDDALVEIIK 298 (363) T ss_pred CCEEEE-CCCCCHHCCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHH-CCCEEEEHHHHHCCCCCCCCCCHHHHHHH T ss_conf 000332-8724000250899999874036200115777899999999986-08825431222211025488867999999 Q ss_pred HHHHHHHCCCCEEEECCCCCHHHHHH-HCCCEEEEEECCCCCCCCCCEEEHHHHHHHHHHHHHHH Q ss_conf 99999828995797414543588986-05989999004787368784047999999999999999 Q gi|254780782|r 317 KSIYNTTGNIPLLSTSGGTSDARFIK-DYCPVIEFGLVGRTMHALNENASLQDLEDLTCIYENFL 380 (389) Q Consensus 317 ~a~~~~~g~~~~~~~~gg~~d~~~~~-~~iP~v~fGp~~~~~H~pdE~i~i~~l~~~~~~~~~~i 380 (389) T Consensus 299 kaa~k~-g~~~~~~~sgGGsDANv~n~kG~pTv~Ls~Gy~~~Ht~~E~i~ie~lvK~ae~V~a~~ 362 (363) T TIGR01883 299 KAAKKI-GLKTEEKLSGGGSDANVLNEKGVPTVNLSAGYVKVHTEKEKISIEELVKLAELVVALA 362 (363) T ss_pred HHHHHH-CCCCHHHHCCCCCCHHHHHCCCCCHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHC T ss_conf 999861-7770033137874067651477323547531452225567224899998999998741

HHsearch alignment for GI: 254780782 and conserved domain: TIGR01883