HHsearch alignment of GI: 254780783 and MMDB domain: 2jsp_A_1-33

>2jsp_A (A:1-33) Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens}
Probab=99.00  E-value=9.4e-11  Score=90.09  Aligned_cols=32  Identities=50%  Similarity=0.795  Sum_probs=29.3

Q ss_pred             CCCCCCCCCCCHHHHCCCCCEEECCCCHHHHH
Q ss_conf             78545899857365138884597436100025
Q gi|254780783|r   59 VQPERLKPAVPIRKSIENGCLYCLEDGMQFKS   90 (149)
Q Consensus        59 ~~~~~~~PAv~i~kSi~~d~iiClecGk~~K~   90 (149)
                      ++++.+.|||+||+||++|+||||||||+||+
T Consensus         2 ~~~e~~~PaVpikkSvtpDyiicLEDGkk~KS   33 (33)
T 2jsp_A            2 VNVEKQKPAVSVRKSVQDDHIVCLECGGSFKS   33 (33)
T ss_dssp             CCSSCCBCCCCSSTTBCSSCEECTBTCCEESB
T ss_pred             CCCCCCCCCCCHHHCCCCCCEEEECCCCCHHH
T ss_conf             87666899988666468980687137830658