BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780783|ref|YP_003065196.1| transcription regulator
protein [Candidatus Liberibacter asiaticus str. psy62]
         (149 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780783|ref|YP_003065196.1| transcription regulator protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040460|gb|ACT57256.1| transcription regulator protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 149

 Score =  313 bits (802), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 149/149 (100%), Positives = 149/149 (100%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ
Sbjct: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS
Sbjct: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSKV 149
           REYATTRSKLAKNMGLGRGRKKRVLTSKV
Sbjct: 121 REYATTRSKLAKNMGLGRGRKKRVLTSKV 149


>gi|315122005|ref|YP_004062494.1| transcription regulator protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495407|gb|ADR52006.1| transcription regulator protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 143

 Score =  254 bits (649), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 117/143 (81%), Positives = 128/143 (89%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MDDDA+FD SE+ LEMTV+IVAAYV NHVVPM DIGSL+ DVH+ L+ ++S  P QDN+ 
Sbjct: 1   MDDDATFDGSEKILEMTVNIVAAYVGNHVVPMGDIGSLVADVHTVLRNLISHNPGQDNLP 60

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            ERLKPAVPIRKSIENG LYCLEDGM+FKSLKRHL THHNMTP+EYRIKWNLASDYPMVS
Sbjct: 61  TERLKPAVPIRKSIENGLLYCLEDGMKFKSLKRHLMTHHNMTPEEYRIKWNLASDYPMVS 120

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
           REYA TRSKLAKNMGLGRGRKKR
Sbjct: 121 REYANTRSKLAKNMGLGRGRKKR 143


>gi|227821334|ref|YP_002825304.1| transcriptional regulatory protein, Ros/MucR family [Sinorhizobium
           fredii NGR234]
 gi|227340333|gb|ACP24551.1| transcriptional regulatory protein, Ros/MucR family [Sinorhizobium
           fredii NGR234]
          Length = 143

 Score =  162 bits (410), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 105/143 (73%), Gaps = 2/143 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++    S+E  +E+T +IVAAYVSNHVVP+A++ +LI DVHSAL    + AP    V 
Sbjct: 1   MSENTLGASNELLVELTAEIVAAYVSNHVVPVAELPTLIADVHSALNNTTAPAPVVVPV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THHN++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKPKPAVSVRKSVQDDQITCLECGGTFKSLKRHLMTHHNLSPEEYREKWDLPADYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
             YA  RS+LAK MGLG+ RK+R
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKRR 141


>gi|15964752|ref|NP_385105.1| transcription regulator protein [Sinorhizobium meliloti 1021]
 gi|307304328|ref|ZP_07584080.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
 gi|307319433|ref|ZP_07598860.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           AK83]
 gi|1709180|sp|P55323|MUCR_RHIME RecName: Full=Transcriptional regulatory protein mucR
 gi|642657|gb|AAA74239.1| putative zinc finger protein [Sinorhizobium meliloti]
 gi|15073930|emb|CAC45571.1| Transcriptional regulator of exopolysaccharide biosynthesis
           [Sinorhizobium meliloti 1021]
 gi|306894805|gb|EFN25564.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           AK83]
 gi|306902796|gb|EFN33389.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
          Length = 143

 Score =  161 bits (408), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 105/143 (73%), Gaps = 2/143 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + +   S+E  +E+T +IVAAYVSNHVVP+A++ +LI DVHSAL    + AP    V 
Sbjct: 1   MTETSLGTSNELLVELTAEIVAAYVSNHVVPVAELPTLIADVHSALNNTTAPAPVVVPV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THHN++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKPKPAVSVRKSVQDDQITCLECGGTFKSLKRHLMTHHNLSPEEYRDKWDLPADYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
             YA  RS+LAK MGLG+ RK+R
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKRR 141


>gi|222085297|ref|YP_002543827.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Agrobacterium radiobacter K84]
 gi|221722745|gb|ACM25901.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Agrobacterium radiobacter K84]
          Length = 143

 Score =  160 bits (405), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 103/142 (72%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A     +  +E+T DIVAAYVSNHVVP+ D+ +LI+DVHSAL    + AP    V 
Sbjct: 1   MTDTALGTGQDLLVELTADIVAAYVSNHVVPVTDLPNLISDVHSALSSTSAPAPAVTVV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+LA+DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDDQITCLECGGSFKSLKRHLMTHHSLSPEEYREKWDLAADYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|51012474|gb|AAT92553.1| transcriptional regulatory protein RosR [Rhizobium leguminosarum
           bv. trifolii]
 gi|51012476|gb|AAT92554.1| transcriptional regulatory protein RosR [Rhizobium leguminosarum
           bv. trifolii TA1]
 gi|170783772|gb|ACB37370.1| RosR [Rhizobium leguminosarum bv. viciae]
 gi|170783774|gb|ACB37371.1| RosR [Rhizobium leguminosarum bv. viciae]
 gi|170783778|gb|ACB37373.1| RosR [Rhizobium leguminosarum bv. trifolii]
 gi|170783780|gb|ACB37374.1| RosR [Rhizobium leguminosarum bv. phaseoli]
 gi|170783782|gb|ACB37375.1| RosR [Rhizobium leguminosarum bv. phaseoli]
          Length = 143

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 78/142 (54%), Positives = 104/142 (73%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A+ ++ E  +E+T DIVAAYVSNHVVP++D+ +LI+DVHSAL       P    V 
Sbjct: 1   MTDIATGNAPELLVELTADIVAAYVSNHVVPVSDLANLISDVHSALSNTSVPQPAAAIV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDEQITCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|86356889|ref|YP_468781.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Rhizobium etli CFN 42]
 gi|2497993|sp|Q52741|ROSR_RHIET RecName: Full=Transcriptional regulatory protein rosR; AltName:
           Full=Nodulation competitiveness determinant
 gi|1421774|gb|AAC44878.1| nodulation competitiveness determinant [Rhizobium etli]
 gi|86280991|gb|ABC90054.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Rhizobium etli CFN 42]
          Length = 143

 Score =  160 bits (404), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 78/142 (54%), Positives = 104/142 (73%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A+ ++ E  +E+T DIVAAYVSNHVVP++D+ +LI+DVHSAL       P    V 
Sbjct: 1   MTDMATGNAPELLVELTADIVAAYVSNHVVPVSDLANLISDVHSALSNTSVPQPAAAVV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDEQITCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|170783770|gb|ACB37369.1| RosR [Rhizobium gallicum bv. gallicum]
          Length = 143

 Score =  160 bits (404), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 78/142 (54%), Positives = 104/142 (73%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A+ ++ E  +E+T DIVAAYVSNHVVP++D+ +LI+DVHSAL       P    V 
Sbjct: 1   MTDMATGNAPELLVELTADIVAAYVSNHVVPVSDLANLISDVHSALSNTSVPQPAAAIV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDEQITCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|190890962|ref|YP_001977504.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Rhizobium etli CIAT 652]
 gi|218663386|ref|ZP_03519316.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Rhizobium etli IE4771]
 gi|190696241|gb|ACE90326.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Rhizobium etli CIAT 652]
          Length = 143

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/142 (54%), Positives = 103/142 (72%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A+ +  E  +E+T DIVAAYVSNHVVP++D+ +LI+DVHSAL       P    V 
Sbjct: 1   MTDMATGNGPELLVELTADIVAAYVSNHVVPVSDLANLISDVHSALSNTSVPQPAAAVV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDEQITCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|116251147|ref|YP_766985.1| nodulation competitiveness transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|241203745|ref|YP_002974841.1| MucR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|115255795|emb|CAK06876.1| putative nodulation competitiveness transcriptional regulator
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|170783776|gb|ACB37372.1| RosR [Rhizobium leguminosarum bv. trifolii]
 gi|240857635|gb|ACS55302.1| transcriptional regulator, MucR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 143

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/142 (54%), Positives = 103/142 (72%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A+  + E  +E+T DIVAAYVSNHVVP++D+ +LI+DVHSAL       P    V 
Sbjct: 1   MTDIATGSAPELLVELTADIVAAYVSNHVVPVSDLANLISDVHSALSNTSVPQPAAAIV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDEQITCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|150395838|ref|YP_001326305.1| MucR family transcriptional regulator [Sinorhizobium medicae
           WSM419]
 gi|6465846|emb|CAB61530.1| MucR protein [Sinorhizobium meliloti]
 gi|150027353|gb|ABR59470.1| transcriptional regulator, MucR family [Sinorhizobium medicae
           WSM419]
          Length = 143

 Score =  159 bits (403), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 78/143 (54%), Positives = 105/143 (73%), Gaps = 2/143 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + +   S+E  +E+T +IVAAYVSNHVVP+A++ +LI DVHSAL    + AP    V 
Sbjct: 1   MTETSLGTSNELLVELTAEIVAAYVSNHVVPVAELPTLIADVHSALNNTTAPAPVV--VP 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THHN++P++YR KW+L +DYPMV+
Sbjct: 59  VEKPKPAVSVRKSVQDDQITCLECGGTFKSLKRHLMTHHNLSPEDYRDKWDLPADYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
             YA  RS+LAK MGLG+ RK+R
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKRR 141


>gi|209548484|ref|YP_002280401.1| MucR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534240|gb|ACI54175.1| transcriptional regulator, MucR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 143

 Score =  158 bits (400), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 104/142 (73%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + A+ ++ E  +E+T DIVAAYVSNHVVP++D+ +LI+DVHSAL       P    V 
Sbjct: 1   MTEMATGNAPELLVELTADIVAAYVSNHVVPVSDLANLISDVHSALSNTSVPQPAAAIV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDEQITCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|217977836|ref|YP_002361983.1| transcriptional regulator, MucR family [Methylocella silvestris
           BL2]
 gi|217503212|gb|ACK50621.1| transcriptional regulator, MucR family [Methylocella silvestris
           BL2]
          Length = 137

 Score =  157 bits (398), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 99/141 (70%), Gaps = 9/141 (6%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP-- 61
           DAS   S  ++E+  DIV+AYVSN+ VP +D+ SLI DVHSAL RV S       V P  
Sbjct: 3   DAS--GSNSYIELAADIVSAYVSNNSVPASDLPSLINDVHSALLRVTSGV-----VAPIV 55

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           E  KPAVP +KS+ N  L CLEDG +FKSLKRHL+T +NM+PDEYR KW LA DYPMV+ 
Sbjct: 56  ETPKPAVPAKKSVTNDFLVCLEDGRKFKSLKRHLRTQYNMSPDEYREKWGLAPDYPMVAP 115

Query: 122 EYATTRSKLAKNMGLGRGRKK 142
            YA  RS LAK MGLG+ R++
Sbjct: 116 NYAKARSNLAKQMGLGQQRRR 136


>gi|15888254|ref|NP_353935.1| transcriptional regulator [Agrobacterium tumefaciens str. C58]
 gi|15155910|gb|AAK86720.1| transcriptional regulator [Agrobacterium tumefaciens str. C58]
          Length = 142

 Score =  157 bits (397), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 77/141 (54%), Positives = 101/141 (71%), Gaps = 2/141 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + A  ++ +  +E+T DIVAAYVSNHVVP+ ++  LI+DVH+AL    + AP    V 
Sbjct: 1   MTETAYGNAQDLLVELTADIVAAYVSNHVVPVTELPGLISDVHTALSG--TSAPASVAVN 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+MTP+EYR KW+L  DYPMV+
Sbjct: 59  VEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRK 141
             YA  RS+LAK MGLG+ RK
Sbjct: 119 PAYAEARSRLAKEMGLGQRRK 139


>gi|1710640|sp|P55324|ROSA_AGRRD RecName: Full=Transcriptional regulatory protein rosAr
 gi|599613|emb|CAA58116.1| rosAR [Agrobacterium tumefaciens]
          Length = 142

 Score =  157 bits (397), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 77/141 (54%), Positives = 101/141 (71%), Gaps = 2/141 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + A  ++ +  +E+T DIVAAYVSNHVVP+ ++  LI+DVH+AL    + AP    V 
Sbjct: 1   MTETAYGNAQDLLVELTADIVAAYVSNHVVPVTELPGLISDVHTALSG--TSAPASVAVN 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+MTP+EYR KW+L  DYPMV+
Sbjct: 59  VEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLQVDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRK 141
             YA  RS+LAK MGLG+ RK
Sbjct: 119 PAYAEARSRLAKEMGLGQRRK 139


>gi|325292293|ref|YP_004278157.1| Transcriptional regulatory protein [Agrobacterium sp. H13-3]
 gi|1710641|sp|Q04152|ROS_AGRTU RecName: Full=Transcriptional regulatory protein ros
 gi|142275|gb|AAA22106.1| ros protein [Agrobacterium tumefaciens]
 gi|325060146|gb|ADY63837.1| Transcriptional regulatory protein [Agrobacterium sp. H13-3]
          Length = 142

 Score =  157 bits (396), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 77/141 (54%), Positives = 101/141 (71%), Gaps = 2/141 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + A  ++ +  +E+T DIVAAYVSNHVVP+ ++  LI+DVH+AL    + AP    V 
Sbjct: 1   MTETAYGNAQDLLVELTADIVAAYVSNHVVPVTELPGLISDVHTALSG--TSAPASVAVN 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+MTP+EYR KW+L  DYPMV+
Sbjct: 59  VEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRK 141
             YA  RS+LAK MGLG+ RK
Sbjct: 119 PAYAEARSRLAKEMGLGQRRK 139


>gi|146339707|ref|YP_001204755.1| Ros/MucR family transcriptional regulator [Bradyrhizobium sp.
           ORS278]
 gi|146192513|emb|CAL76518.1| putative transcriptional regulatory protein, Ros/MucR family
           [Bradyrhizobium sp. ORS278]
          Length = 138

 Score =  156 bits (395), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 99/135 (73%), Gaps = 3/135 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + + F+++T DIV+AY+SN+  P A+I SLI+ VH+AL RV +    +    PE  +PAV
Sbjct: 5   AGKSFIDLTADIVSAYLSNNPTPAAEIPSLISQVHAALTRVAA---GRSEPAPEPTRPAV 61

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           P++KSI    L CLEDG +FKSL+RHL+T +NMTP++YR KWNL  DYPMV+  YA TRS
Sbjct: 62  PVKKSIHPDYLVCLEDGKRFKSLRRHLRTQYNMTPEQYRDKWNLPPDYPMVAPNYAVTRS 121

Query: 129 KLAKNMGLGRGRKKR 143
           +LAK MGLG+ R +R
Sbjct: 122 QLAKKMGLGQQRPER 136


>gi|148254483|ref|YP_001239068.1| MucR family transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146406656|gb|ABQ35162.1| transcriptional regulator, MucR family [Bradyrhizobium sp. BTAi1]
          Length = 138

 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 99/135 (73%), Gaps = 3/135 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + + F+++T DIV+AY+SN+  P A+I SLI+ VH+AL RV +    +    PE  +PAV
Sbjct: 5   AGKSFIDLTADIVSAYLSNNPTPAAEIPSLISQVHAALTRVAA---GRSEPAPEPARPAV 61

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           P++KSI    L CLEDG +FKSL+RHL+T +NMTP++YR KWNL  DYPMV+  YA TRS
Sbjct: 62  PVKKSIHPDYLVCLEDGKRFKSLRRHLRTQYNMTPEQYRDKWNLPPDYPMVAPNYAVTRS 121

Query: 129 KLAKNMGLGRGRKKR 143
           +LAK MGLG+ R +R
Sbjct: 122 QLAKKMGLGQQRPER 136


>gi|90418906|ref|ZP_01226817.1| transcriptional regulator protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336986|gb|EAS50691.1| transcriptional regulator protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 142

 Score =  155 bits (393), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 107/142 (75%), Gaps = 3/142 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MD   + +++E  +E+T ++VAAYVSN+ +P++++ +LI+D++ AL R  S AP    VQ
Sbjct: 1   MDQIENVENNEMLMELTAEVVAAYVSNNSLPVSELPALISDIYGALGRTNS-AP--QAVQ 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAVP++KS+ +  + CLEDG +FKSLKRHL TH+N++P+EYR KW+LA DYPMV+
Sbjct: 58  AEKPKPAVPVKKSVTDDYIICLEDGKKFKSLKRHLMTHYNLSPEEYREKWDLAPDYPMVA 117

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG  R++
Sbjct: 118 PNYAAARSRLAKQMGLGHKRRR 139


>gi|75676412|ref|YP_318833.1| ROSMUCR transcriptional regulator [Nitrobacter winogradskyi Nb-255]
 gi|74421282|gb|ABA05481.1| transcriptional regulator, MucR family [Nitrobacter winogradskyi
           Nb-255]
          Length = 137

 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 101/135 (74%), Gaps = 3/135 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           +S+ FL++T +IV+AY+SN+  P ++I +LI  VH+AL RV S    +  +  E  KPAV
Sbjct: 5   ASKSFLDLTAEIVSAYLSNNTTPASEIPALINQVHAALTRVSS---GRGELPAEPAKPAV 61

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           P+RKS+    L CLEDG +FKSLKRHL+T +NM+P++YR KW L +DYPMV+  YA TRS
Sbjct: 62  PVRKSMTADYLICLEDGKRFKSLKRHLRTQYNMSPEQYRDKWKLPADYPMVAPNYAVTRS 121

Query: 129 KLAKNMGLGRGRKKR 143
           +LAKNMGLG+ R++R
Sbjct: 122 QLAKNMGLGQQRRRR 136


>gi|114707178|ref|ZP_01440076.1| transcriptional regulator [Fulvimarina pelagi HTCC2506]
 gi|114537374|gb|EAU40500.1| transcriptional regulator [Fulvimarina pelagi HTCC2506]
          Length = 142

 Score =  155 bits (391), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 104/135 (77%), Gaps = 3/135 (2%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           D++E  +E+T ++VAAYVSN+ +P++++ SLI+DV+ AL R    AP Q+  Q E+ +PA
Sbjct: 9   DNNEMLMELTAEVVAAYVSNNSLPVSELPSLISDVYGALGRTT--APAQEP-QAEKPRPA 65

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VPI+KS+ +  + CLEDG +FKSLKRHL TH+N++P+EYR KW+L +DYPMV+  YA  R
Sbjct: 66  VPIKKSVTDDYIICLEDGKKFKSLKRHLMTHYNLSPEEYRDKWDLPADYPMVAPNYAAAR 125

Query: 128 SKLAKNMGLGRGRKK 142
           S+LAK MGLG  R++
Sbjct: 126 SRLAKQMGLGHKRRR 140


>gi|118593473|ref|ZP_01550853.1| transcriptional regulator, MucR family protein [Stappia aggregata
           IAM 12614]
 gi|118433952|gb|EAV40610.1| transcriptional regulator, MucR family protein [Stappia aggregata
           IAM 12614]
          Length = 138

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 100/139 (71%), Gaps = 5/139 (3%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D+  D++   +++T DIV+AYVSN+ V   D+  LI +V+ ALQR  S        +PE 
Sbjct: 3   DSPVDAN--LIDLTADIVSAYVSNNTVASTDLPGLINEVYGALQRTAS---TSTEPEPEP 57

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           LKPAVP++KS+    + CLEDG +FKSLKRHL+TH+NMTP+EYR KW+L +DYPMV+  Y
Sbjct: 58  LKPAVPVKKSVMPDYIICLEDGKKFKSLKRHLRTHYNMTPEEYREKWDLGADYPMVAPNY 117

Query: 124 ATTRSKLAKNMGLGRGRKK 142
           A  RS+LAK MGLG+ RK+
Sbjct: 118 AAARSELAKKMGLGQQRKR 136


>gi|307946167|ref|ZP_07661502.1| transcriptional regulatory protein rosAr [Roseibium sp. TrichSKD4]
 gi|307769831|gb|EFO29057.1| transcriptional regulatory protein rosAr [Roseibium sp. TrichSKD4]
          Length = 138

 Score =  154 bits (390), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%), Gaps = 3/130 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E+T DIV+AYVSN+ V   D+ +LI +V+ ALQR  +        +PE LKPAVPI+K
Sbjct: 10  LIELTSDIVSAYVSNNTVASTDLPNLINEVYGALQRTAT---ASQEPEPEPLKPAVPIKK 66

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG +FKSLKRHL+TH++MTPDEYR KW L  DYPMV+  YA  RS+LAK
Sbjct: 67  SVMPDYIICLEDGKKFKSLKRHLRTHYDMTPDEYREKWELGPDYPMVAPNYAAARSELAK 126

Query: 133 NMGLGRGRKK 142
            MGLG+ RK+
Sbjct: 127 KMGLGQQRKR 136


>gi|92118139|ref|YP_577868.1| MucR family transcriptional regulator [Nitrobacter hamburgensis
           X14]
 gi|91801033|gb|ABE63408.1| transcriptional regulator, MucR family [Nitrobacter hamburgensis
           X14]
          Length = 137

 Score =  154 bits (389), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 101/135 (74%), Gaps = 3/135 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + + FL++T +IV+AYVSN+  P ++I +LI+ VH+AL RV S    +  +  E  KPAV
Sbjct: 5   AGKSFLDLTAEIVSAYVSNNTTPASEIPALISQVHAALTRVSS---GRGELPAEPAKPAV 61

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           P++KS+    L CLEDG +FKSLKRHL+T +NM+P++YR KW L +DYPMV+  YA TRS
Sbjct: 62  PVKKSMTADYLICLEDGKRFKSLKRHLRTQYNMSPEQYRDKWKLPADYPMVAPNYAVTRS 121

Query: 129 KLAKNMGLGRGRKKR 143
           +LAKNMGLG+ R++R
Sbjct: 122 QLAKNMGLGQQRRRR 136


>gi|16519655|ref|NP_443775.1| transcriptional regulator, Roc/MucR family [Sinorhizobium fredii
           NGR234]
 gi|2497992|sp|P55363|MUCR_RHISN RecName: Full=Transcriptional regulatory protein mucR homolog
 gi|2182305|gb|AAB91613.1| transcriptional regulator, Roc/MucR family [Sinorhizobium fredii
           NGR234]
          Length = 143

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 75/135 (55%), Positives = 98/135 (72%), Gaps = 2/135 (1%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+E   E+T +IVAAYVS HVVP A++ +LI DVHSAL    + AP    +  E+ KPAV
Sbjct: 9   SNELLAELTAEIVAAYVSTHVVPGAELPTLIADVHSALNNATAPAPVIAPI--EKPKPAV 66

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            IRKS+++  + CLE G  FKSLKRHL THHN++P++YR KW+L +DYPMV+  YA  RS
Sbjct: 67  SIRKSVQDDQITCLECGGAFKSLKRHLMTHHNLSPEDYREKWDLPADYPMVAPAYAEARS 126

Query: 129 KLAKNMGLGRGRKKR 143
           +LAK +GLG  RK+R
Sbjct: 127 RLAKEIGLGERRKRR 141


>gi|254501217|ref|ZP_05113368.1| ROS/MUCR transcriptional regulator protein [Labrenzia alexandrii
           DFL-11]
 gi|222437288|gb|EEE43967.1| ROS/MUCR transcriptional regulator protein [Labrenzia alexandrii
           DFL-11]
          Length = 138

 Score =  153 bits (386), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 71/130 (54%), Positives = 96/130 (73%), Gaps = 3/130 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +++T DIV+AYVSN+ V   ++  LI +V+ ALQ+    A   +  +PE LKPAVP++K
Sbjct: 10  LIDLTADIVSAYVSNNTVASTELPGLINEVYGALQKT---AAASNEPEPEPLKPAVPVKK 66

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG +FKSLKRHL+TH+NMTP+EYR KW+LA DYPMV+  YA  RS+LAK
Sbjct: 67  SVMPDFIICLEDGKKFKSLKRHLRTHYNMTPEEYREKWDLAPDYPMVAPNYAAARSELAK 126

Query: 133 NMGLGRGRKK 142
            MGLG+ RK+
Sbjct: 127 KMGLGQQRKR 136


>gi|254471857|ref|ZP_05085258.1| transcriptional regulator, MucR family [Pseudovibrio sp. JE062]
 gi|211959059|gb|EEA94258.1| transcriptional regulator, MucR family [Pseudovibrio sp. JE062]
          Length = 138

 Score =  153 bits (386), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 94/130 (72%), Gaps = 3/130 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E+T DIV+AYV N+ V  AD+  LI DV+ ALQ+           +PE LKPAVP++K
Sbjct: 10  LMELTADIVSAYVGNNTVASADLPVLINDVYVALQKTSGDL---SEPEPEPLKPAVPVKK 66

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+ N  + CLEDG +FKSLKRHL+TH++MTP+EYR KW L SDYPMV+  YA  RS+LAK
Sbjct: 67  SVTNDYIICLEDGKKFKSLKRHLRTHYDMTPEEYREKWGLPSDYPMVAPHYAAARSELAK 126

Query: 133 NMGLGRGRKK 142
            MGLG+ RK+
Sbjct: 127 KMGLGQQRKR 136


>gi|13475233|ref|NP_106797.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14025984|dbj|BAB52583.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 149

 Score =  152 bits (385), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 72/132 (54%), Positives = 94/132 (71%), Gaps = 3/132 (2%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           +  +E+T D+V+AYVSN+ VP+ D+ +LI  VH+AL+     A      +PE L+PAVPI
Sbjct: 10  DTLIELTADVVSAYVSNNPVPVGDLPALIGQVHAALK---GTAGFVSAAKPEALEPAVPI 66

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           RKS+    + CL+DG +FKSLKRHL THH +TPDEYR KW+L +DYPMV+  YA  RS L
Sbjct: 67  RKSVTPDYIICLDDGKKFKSLKRHLSTHHGLTPDEYRAKWHLPADYPMVAPNYAAARSAL 126

Query: 131 AKNMGLGRGRKK 142
           AK MGLGR  K+
Sbjct: 127 AKTMGLGRKPKE 138


>gi|85715574|ref|ZP_01046554.1| ROSMUCR transcriptional regulator [Nitrobacter sp. Nb-311A]
 gi|85697513|gb|EAQ35390.1| ROSMUCR transcriptional regulator [Nitrobacter sp. Nb-311A]
          Length = 137

 Score =  151 bits (382), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/131 (54%), Positives = 99/131 (75%), Gaps = 3/131 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           FL++T +IV+AYVSN+  P ++I  LI+ VH+AL RV S    +  +  E +KPAVPI+K
Sbjct: 9   FLDLTAEIVSAYVSNNTTPASEIPVLISQVHAALMRVSS---GRSELPVEPVKPAVPIKK 65

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    L CLEDG +FKSLKRHL+T +NM+P++YR KW L +DYPMV+  YA TRS+LAK
Sbjct: 66  SMTADYLVCLEDGKRFKSLKRHLRTQYNMSPEQYRDKWKLPADYPMVAPNYAVTRSQLAK 125

Query: 133 NMGLGRGRKKR 143
           +MGLG+ R++R
Sbjct: 126 DMGLGQQRRRR 136


>gi|163759047|ref|ZP_02166133.1| transcriptional regulator [Hoeflea phototrophica DFL-43]
 gi|162283451|gb|EDQ33736.1| transcriptional regulator [Hoeflea phototrophica DFL-43]
          Length = 140

 Score =  150 bits (380), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 74/135 (54%), Positives = 100/135 (74%), Gaps = 4/135 (2%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           + S+  +E+T +IVAAYVSN+ V   D+ ++I+ VHSAL      AP ++ V  E+ KPA
Sbjct: 8   NGSDFLIELTAEIVAAYVSNNSVAANDLPNVISQVHSALGGAT--APVEEVV--EKPKPA 63

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VP+R+SI+N  L CLEDG +FKSLKRHL TH+ +TP++YR KW+LA DYPMV+  YA  R
Sbjct: 64  VPVRRSIQNDYLICLEDGQKFKSLKRHLMTHYGLTPEQYREKWDLAPDYPMVAPSYAEAR 123

Query: 128 SKLAKNMGLGRGRKK 142
           S+LAK MGLG+ RK+
Sbjct: 124 SRLAKEMGLGQKRKR 138


>gi|91976417|ref|YP_569076.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           BisB5]
 gi|91682873|gb|ABE39175.1| transcriptional regulator, MucR family [Rhodopseudomonas palustris
           BisB5]
          Length = 138

 Score =  150 bits (379), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 71/135 (52%), Positives = 96/135 (71%), Gaps = 2/135 (1%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + + F+E+T  IV+AYVSN+  P  +I  LI  VH+ALQR+ S  P    ++P   KPAV
Sbjct: 5   AGKSFIELTATIVSAYVSNNPTPAGEIPGLIGQVHAALQRLSSGRPETPALEPA--KPAV 62

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           P++KS+    L CLEDG +FKSLKRHL+T + MTP++YR KW L +DYPMV+  YA  RS
Sbjct: 63  PLKKSMTPEYLICLEDGKRFKSLKRHLRTQYKMTPEQYREKWGLPADYPMVAPNYAVERS 122

Query: 129 KLAKNMGLGRGRKKR 143
           +LAK MGLG+ R++R
Sbjct: 123 QLAKKMGLGQQRRRR 137


>gi|182678616|ref|YP_001832762.1| MucR family transcriptional regulator [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634499|gb|ACB95273.1| transcriptional regulator, MucR family [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 138

 Score =  149 bits (377), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 95/134 (70%), Gaps = 3/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S  ++E+  DIV+AYVSN+ VP +D+ SLI +VHSAL RV +         P   KPAVP
Sbjct: 7   SNSYIELAADIVSAYVSNNSVPASDLPSLINEVHSALLRVTTGTVTPTVEIP---KPAVP 63

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +KS+ N  + CLEDG +FKSLKRHL+T +NM+PDEYR KW L +DYPMV+  YA  RS 
Sbjct: 64  TKKSVTNEFIVCLEDGRKFKSLKRHLRTQYNMSPDEYREKWGLPADYPMVAPNYAKARSN 123

Query: 130 LAKNMGLGRGRKKR 143
           LAK MGLG+ R+++
Sbjct: 124 LAKQMGLGQQRRRK 137


>gi|222147959|ref|YP_002548916.1| transcriptional regulator [Agrobacterium vitis S4]
 gi|221734947|gb|ACM35910.1| transcriptional regulator [Agrobacterium vitis S4]
          Length = 143

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 76/141 (53%), Positives = 97/141 (68%), Gaps = 4/141 (2%)

Query: 4   DASFDSS--ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           + +F SS  +  +E+T DIVAAYVSNHVVP+ DI  LI+DVH+AL    S          
Sbjct: 3   ETAFGSSGNDLLVELTADIVAAYVSNHVVPIGDISHLISDVHTALSNTSSPV--PVVSVV 60

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           E+ KPAV +RKSI+   + CLE G  FKSLKRHL THH ++P+EYR KW+L  DYPMV+ 
Sbjct: 61  EKQKPAVAVRKSIQGDQIICLECGGSFKSLKRHLMTHHTLSPEEYREKWDLPVDYPMVAP 120

Query: 122 EYATTRSKLAKNMGLGRGRKK 142
            YA  RS+LAK MGLG+ R++
Sbjct: 121 AYAEARSRLAKEMGLGQRRRR 141


>gi|158422710|ref|YP_001524002.1| putative transcriptional regulator [Azorhizobium caulinodans ORS
           571]
 gi|158329599|dbj|BAF87084.1| putative transcriptional regulator [Azorhizobium caulinodans ORS
           571]
          Length = 180

 Score =  149 bits (375), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/128 (54%), Positives = 93/128 (72%), Gaps = 3/128 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S  ++E+  DIV+AYVSN+ V  AD+ +LI +VH+ALQRV   +  +    PE LKPAVP
Sbjct: 49  STTYIELAADIVSAYVSNNSVAAADLPNLINEVHAALQRV---SKGESEPAPEPLKPAVP 105

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           ++KS+    + CLEDG +FKSLKRHL+T +NM+P++YR KW L  DYPMV+  YA  RS+
Sbjct: 106 VKKSVTPDFIVCLEDGKKFKSLKRHLRTQYNMSPEQYREKWALPPDYPMVAPNYAAARSE 165

Query: 130 LAKNMGLG 137
           LAK MGLG
Sbjct: 166 LAKQMGLG 173


>gi|298293345|ref|YP_003695284.1| MucR family transcriptional regulator [Starkeya novella DSM 506]
 gi|296929856|gb|ADH90665.1| transcriptional regulator, MucR family [Starkeya novella DSM 506]
          Length = 154

 Score =  148 bits (374), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/132 (54%), Positives = 93/132 (70%), Gaps = 3/132 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           SS  +L +T D+VAA+V N+ VP  ++  LI  VH AL R+ + AP    V  E LKPAV
Sbjct: 7   SSVDYLGLTADVVAAFVGNNSVPATELPDLIAKVHGALLRLSTPAPA---VVEEVLKPAV 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           P++KS+    + CLEDG++FKSLKRHL+T +NMTP+EYR KW L +DYPMV+  YA  RS
Sbjct: 64  PVKKSVTPEYIICLEDGLKFKSLKRHLRTKYNMTPEEYRAKWGLPNDYPMVAPSYAEARS 123

Query: 129 KLAKNMGLGRGR 140
            LAK MGLG+ R
Sbjct: 124 NLAKKMGLGQQR 135


>gi|254419080|ref|ZP_05032804.1| ROS/MUCR transcriptional regulator protein [Brevundimonas sp. BAL3]
 gi|196185257|gb|EDX80233.1| ROS/MUCR transcriptional regulator protein [Brevundimonas sp. BAL3]
          Length = 142

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 73/136 (53%), Positives = 93/136 (68%), Gaps = 3/136 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            D     LEMT DIV+AYV N+ V    + +LI ++H+AL  V S  P +  V PE  +P
Sbjct: 1   MDEKPELLEMTADIVSAYVGNNTVTAEALPALIANIHAALSGV-SNGPVE--VPPEPKEP 57

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AVPIRKSI    L CLEDG +FKSLKRHL+T ++M+P++YR KW L  DYPMV+  YA  
Sbjct: 58  AVPIRKSINADFLICLEDGRKFKSLKRHLRTKYDMSPEDYRAKWGLPKDYPMVAPNYAKA 117

Query: 127 RSKLAKNMGLGRGRKK 142
           RS+LAK MGLG+G +K
Sbjct: 118 RSELAKQMGLGQGGRK 133


>gi|319784581|ref|YP_004144057.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170469|gb|ADV14007.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 141

 Score =  147 bits (371), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 71/135 (52%), Positives = 98/135 (72%), Gaps = 3/135 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           +S+  +E+T D+VAAYVSN+ VP+ ++ +LI+DVH+AL RV   A   +    ++ KPAV
Sbjct: 10  NSDALIELTADVVAAYVSNNPVPVGELPNLISDVHAALGRVGGTA---EQPPADKQKPAV 66

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
             ++S+ +  + CLEDG +FKSLKRHL TH+++TPD+YR KWNL   YPMV+  YA  RS
Sbjct: 67  NPKRSVHDDYIVCLEDGKKFKSLKRHLMTHYDLTPDQYREKWNLDPTYPMVAPNYAAARS 126

Query: 129 KLAKNMGLGRGRKKR 143
           +LAK MGLGR RK R
Sbjct: 127 QLAKKMGLGRKRKAR 141


>gi|260461752|ref|ZP_05809998.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
 gi|319785301|ref|YP_004144777.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|259032393|gb|EEW33658.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
 gi|317171189|gb|ADV14727.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 155

 Score =  147 bits (370), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 94/137 (68%), Gaps = 4/137 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS-RAPCQDNVQPERLK 65
           F+++   +++T D+V+AYVSN+ VP+ ++ +LI  +H AL+R  + R   Q   +P    
Sbjct: 6   FENANNLIDLTADVVSAYVSNNPVPVGELPALIGQLHEALKRTAAGRVSAQ---EPTAFT 62

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVPIRKS+    +  LEDG +FKSLKRHL TH+ +TPDEYR KW L +DYPMV+  YA 
Sbjct: 63  PAVPIRKSVTPDYIISLEDGKKFKSLKRHLSTHYGLTPDEYRAKWGLPADYPMVAPNYAA 122

Query: 126 TRSKLAKNMGLGRGRKK 142
            RS LAK MGLGR  K+
Sbjct: 123 ARSALAKTMGLGRKPKE 139


>gi|197106177|ref|YP_002131554.1| transcriptional regulator [Phenylobacterium zucineum HLK1]
 gi|196479597|gb|ACG79125.1| transcriptional regulator [Phenylobacterium zucineum HLK1]
          Length = 171

 Score =  147 bits (370), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 94/145 (64%), Gaps = 8/145 (5%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           +   D     +EMT DIV+AYV N+ V  AD+  LI  VH AL  V S A   + V+ + 
Sbjct: 30  NGRMDEKTEVIEMTADIVSAYVGNNTVAAADLPGLIQSVHRALAGVSSGA---EAVEAQP 86

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            +PAVPIR+SI    L CLEDG +FKSLKRHL+T +NM+P+EYR KW L  DYPMV+  Y
Sbjct: 87  KEPAVPIRRSITPDYLVCLEDGRKFKSLKRHLRTKYNMSPEEYRAKWGLPKDYPMVAPNY 146

Query: 124 ATTRSKLAKNMGLGRG-----RKKR 143
           A  RS LAK MGLG+G     RKKR
Sbjct: 147 AKARSDLAKQMGLGQGGRQAPRKKR 171


>gi|13476351|ref|NP_107921.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14027112|dbj|BAB54066.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 141

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/135 (51%), Positives = 98/135 (72%), Gaps = 3/135 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           +++  +E+T D+VAAYVSN+ VP+ ++ +LI+DVH+AL RV   A   +    ++ KPAV
Sbjct: 10  NNDALIELTADVVAAYVSNNPVPVGELPNLISDVHAALGRVGGTA---EQPPADKQKPAV 66

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
             ++S+ +  + CLEDG +FKSLKRHL TH+++TPD+YR KWNL   YPMV+  YA  RS
Sbjct: 67  NPKRSVHDDYIVCLEDGKKFKSLKRHLMTHYDLTPDQYREKWNLDPSYPMVAPNYAAARS 126

Query: 129 KLAKNMGLGRGRKKR 143
           +LAK MGLGR RK R
Sbjct: 127 QLAKKMGLGRKRKAR 141


>gi|260462413|ref|ZP_05810621.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259031907|gb|EEW33175.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 141

 Score =  146 bits (368), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/135 (51%), Positives = 98/135 (72%), Gaps = 3/135 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           ++E  +E+T D+VAAYVSN+ VP+ ++ +LI+DVH+AL RV   A   +    ++ KPAV
Sbjct: 10  NNEALIELTADVVAAYVSNNPVPVGELPNLISDVHAALGRVGGTA---EQPPADKQKPAV 66

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
             ++S+ +  + CLEDG +FKSLKRHL TH+++TP++YR KWNL   YPMV+  YA  RS
Sbjct: 67  NPKRSVHDDYIVCLEDGKKFKSLKRHLMTHYDLTPEQYREKWNLDPSYPMVAPNYAAARS 126

Query: 129 KLAKNMGLGRGRKKR 143
           +LAK MGLGR RK R
Sbjct: 127 QLAKKMGLGRKRKAR 141


>gi|170742543|ref|YP_001771198.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168196817|gb|ACA18764.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 145

 Score =  145 bits (367), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 94/129 (72%), Gaps = 3/129 (2%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           ++S  ++E+  DIV+A+VS + VPMAD+ +LI  VH  L R+  + P ++  +PE L PA
Sbjct: 5   EASTDYIELAADIVSAFVSKNSVPMADLPALIASVHETLGRL-GKDPAEE--KPEPLTPA 61

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VPI+KSI    L CLEDG +FKSLKRHL++ + +TP+EYR +WNLA DYPMV+  YA  R
Sbjct: 62  VPIKKSITPDYLICLEDGKKFKSLKRHLRSRYGLTPEEYRARWNLAPDYPMVAPNYAAAR 121

Query: 128 SKLAKNMGL 136
           S+LAK MGL
Sbjct: 122 SELAKTMGL 130


>gi|298290678|ref|YP_003692617.1| MucR family transcriptional regulator [Starkeya novella DSM 506]
 gi|296927189|gb|ADH87998.1| transcriptional regulator, MucR family [Starkeya novella DSM 506]
          Length = 140

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 73/144 (50%), Positives = 98/144 (68%), Gaps = 10/144 (6%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D    DS   ++E+  DIV+AYVSN+ V   D+ +L+ DVH ALQRV      + + +
Sbjct: 1   MSDTKDADS---YIELAADIVSAYVSNNSVSANDLTALLGDVHGALQRV-----GKGDAE 52

Query: 61  P--ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
           P  E  KPAVPI++S+    + CLEDG +FKSLKRHL+T +N+TP+EYR KW L +DYPM
Sbjct: 53  PVAEPAKPAVPIKRSVAPEFIVCLEDGKKFKSLKRHLRTQYNLTPEEYREKWGLPADYPM 112

Query: 119 VSREYATTRSKLAKNMGLGRGRKK 142
           V+  YA  RS LAK MGLG+ R++
Sbjct: 113 VAPNYAAARSALAKEMGLGQQRRR 136


>gi|20803991|emb|CAD31568.1| PUTATIVE TRANSCRIPTIONAL REGULATOR PROTEIN [Mesorhizobium loti R7A]
          Length = 154

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/133 (51%), Positives = 91/133 (68%), Gaps = 3/133 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           ++  +E+T  +V+AYVSN+ VP+ ++  LI  +H AL+     A  +   +PE LKPAVP
Sbjct: 9   ADSLIELTAHVVSAYVSNNPVPVGELPGLIGQIHIALKGTAGGAAPE---KPEALKPAVP 65

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           IRKS+    +  LEDG +FKSLKRHL TH+ +TPDEYR KW L +DYPMV+  YA  RS 
Sbjct: 66  IRKSVTPDYIISLEDGKKFKSLKRHLATHYGLTPDEYRAKWELPADYPMVAPNYAAARSA 125

Query: 130 LAKNMGLGRGRKK 142
           LAK MGLGR  K+
Sbjct: 126 LAKTMGLGRKPKE 138


>gi|170750309|ref|YP_001756569.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656831|gb|ACB25886.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 137

 Score =  145 bits (366), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/140 (48%), Positives = 97/140 (69%), Gaps = 6/140 (4%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP-E 62
           DA+ +    +L ++VDIV+A+VSN+ VP  ++  LI  +H+ L  +      + +  P E
Sbjct: 2   DATGEGQPDYLTLSVDIVSAFVSNNPVPAPELPGLIAAIHATLHGL-----GEPSAPPAE 56

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
            L+PAVP+R+S++   + CLEDG +FKSLKRHL+TH+N+TP+EYR KW L  DYPMV+  
Sbjct: 57  ELRPAVPVRRSVQPDFIVCLEDGKKFKSLKRHLRTHYNLTPEEYRGKWGLPPDYPMVAPN 116

Query: 123 YATTRSKLAKNMGLGRGRKK 142
           YA  RS LAK+MGLG  R+K
Sbjct: 117 YAAARSSLAKSMGLGHQRRK 136


>gi|86750629|ref|YP_487125.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           HaA2]
 gi|86573657|gb|ABD08214.1| transcriptional regulator, MucR family [Rhodopseudomonas palustris
           HaA2]
          Length = 139

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/131 (52%), Positives = 93/131 (70%), Gaps = 2/131 (1%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E+T  IV+AYVSN+  P  ++ SL+  VH+ALQR+ S       ++P   KPAVP++K
Sbjct: 9   LIELTATIVSAYVSNNPTPAGEVPSLLGQVHAALQRLSSGRAEAPALEPA--KPAVPLKK 66

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    L CLEDG +FKSLKRHL+T + MTP++YR KW L SDYPMV+  YA  RS+LAK
Sbjct: 67  SMTPEYLICLEDGKRFKSLKRHLRTQYKMTPEQYREKWGLPSDYPMVAPNYAVERSQLAK 126

Query: 133 NMGLGRGRKKR 143
            MGLG+ R++R
Sbjct: 127 KMGLGQQRRRR 137


>gi|39934921|ref|NP_947197.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           CGA009]
 gi|192290450|ref|YP_001991055.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           TIE-1]
 gi|39648771|emb|CAE27293.1| putative transcriptional regulator MucR [Rhodopseudomonas palustris
           CGA009]
 gi|192284199|gb|ACF00580.1| transcriptional regulator, MucR family [Rhodopseudomonas palustris
           TIE-1]
          Length = 138

 Score =  145 bits (365), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 95/132 (71%), Gaps = 4/132 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP-ERLKPAVPIR 71
           ++E+T  IV+AYVSN+    ++I +LI  VH+ALQR+ +  P    V P E  KPAVP++
Sbjct: 9   YIELTASIVSAYVSNNATQASEIPALIGQVHAALQRLSAGRP---EVAPQEPAKPAVPVK 65

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           KS+    L CLEDG +FKSLKRHL+T + MTP++YR KW L +DYPMV+  YA  RS+LA
Sbjct: 66  KSVTPEYLICLEDGKRFKSLKRHLRTQYKMTPEQYREKWGLPADYPMVAPNYAVERSQLA 125

Query: 132 KNMGLGRGRKKR 143
           K MGLG+ R++R
Sbjct: 126 KKMGLGQQRRRR 137


>gi|316934990|ref|YP_004109972.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           DX-1]
 gi|315602704|gb|ADU45239.1| transcriptional regulator, MucR family [Rhodopseudomonas palustris
           DX-1]
          Length = 138

 Score =  145 bits (365), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 95/131 (72%), Gaps = 2/131 (1%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           ++E+T  IV+AYVS++    ++I +LI  VH+ALQR+ +  P    ++P   KPAVP++K
Sbjct: 9   YIELTASIVSAYVSHNATQASEIPALIGQVHAALQRLSASRPEAAPLEPS--KPAVPVKK 66

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    L CLEDG +FKSLKRHL+T + MTP++YR KW L +DYPMV+  YA  RS+LAK
Sbjct: 67  SVTPEYLICLEDGKRFKSLKRHLRTQYKMTPEQYREKWGLPADYPMVAPNYAVERSQLAK 126

Query: 133 NMGLGRGRKKR 143
            MGLG+ R++R
Sbjct: 127 KMGLGQQRRRR 137


>gi|209885755|ref|YP_002289612.1| transcriptional regulatory protein MucR [Oligotropha
           carboxidovorans OM5]
 gi|209873951|gb|ACI93747.1| transcriptional regulatory protein MucR [Oligotropha
           carboxidovorans OM5]
          Length = 137

 Score =  144 bits (364), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 98/138 (71%), Gaps = 6/138 (4%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP-ERL 64
           S  + + F+EM   IV+AYVSN+ VP ++I  LI  VH+AL RV + A      QP E  
Sbjct: 2   SEPAGKGFVEMAAGIVSAYVSNNTVPPSEIPGLIAQVHAALLRVATGA-----EQPVEAT 56

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVP++KS+ +  L CLEDG +FKSLKRHL++ +NM+P++YR KW L +DYPMV+  YA
Sbjct: 57  RPAVPVKKSMTSEYLVCLEDGKRFKSLKRHLRSRYNMSPEQYREKWGLPADYPMVAPNYA 116

Query: 125 TTRSKLAKNMGLGRGRKK 142
             RS+LAK MGLG+ R++
Sbjct: 117 VARSQLAKKMGLGQQRRR 134


>gi|296447404|ref|ZP_06889330.1| transcriptional regulator, MucR family [Methylosinus trichosporium
           OB3b]
 gi|296255107|gb|EFH02208.1| transcriptional regulator, MucR family [Methylosinus trichosporium
           OB3b]
          Length = 135

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/135 (51%), Positives = 94/135 (69%), Gaps = 3/135 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           +S   +E+  DIV+AYVSN+ VP AD+  LI +V+ AL RV +    +    P   KPAV
Sbjct: 2   TSTNNIELAADIVSAYVSNNSVPAADLPGLINEVYGALMRVGTGVVPEPAEAP---KPAV 58

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +RKS+ N  + CLEDG +FKSLKRHL+T + ++P+EYR KW LA+DYPMV+  YA  RS
Sbjct: 59  SVRKSVTNDFIVCLEDGKKFKSLKRHLRTQYGLSPEEYREKWGLAADYPMVAPNYAKARS 118

Query: 129 KLAKNMGLGRGRKKR 143
            LAK MGLG+ R++R
Sbjct: 119 NLAKQMGLGQQRRRR 133


>gi|163849882|ref|YP_001637925.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|218528514|ref|YP_002419330.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|240137108|ref|YP_002961577.1| Transcriptional regulatory protein mucR [Methylobacterium
           extorquens AM1]
 gi|163661487|gb|ABY28854.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|218520817|gb|ACK81402.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
 gi|240007074|gb|ACS38300.1| Transcriptional regulatory protein mucR [Methylobacterium
           extorquens AM1]
          Length = 145

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 91/129 (70%), Gaps = 1/129 (0%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV-VSRAPCQDNVQPERLKPAVPIR 71
           ++ +T DIVAAYVSN+ VP A++  LI ++H AL +V   RA     V  E L+PAVPI+
Sbjct: 10  YVALTADIVAAYVSNNPVPAAELAGLIGNIHGALIQVGTGRAAAPQPVAQEALQPAVPIK 69

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           KSI+   L CLEDG  FKSLKRHL+  +N++P++YR KW L+ DYPMV+  YA  RS LA
Sbjct: 70  KSIQPDYLVCLEDGRTFKSLKRHLRAKYNLSPEQYRAKWGLSPDYPMVAPNYAKARSDLA 129

Query: 132 KNMGLGRGR 140
           K +GLG+ R
Sbjct: 130 KAIGLGQVR 138


>gi|118593335|ref|ZP_01550719.1| transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118434013|gb|EAV40670.1| transcriptional regulator [Stappia aggregata IAM 12614]
          Length = 149

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 69/133 (51%), Positives = 96/133 (72%), Gaps = 7/133 (5%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV--VSRAPCQDNVQPERLKPAVPI 70
            +++T ++V+AYVSN+ V  +D+  LI  VH+AL  +  +S+ P     + E L PAVP+
Sbjct: 19  LVDLTAEVVSAYVSNNTVVSSDLPDLIKGVHAALSSINQLSQEP-----EVEELVPAVPV 73

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           RKS+    L CLEDG +FKSLKRHL+TH+++TP+EYR KW L SDYPMV+  YA  RS+L
Sbjct: 74  RKSVTGDFLICLEDGKKFKSLKRHLRTHYDLTPEEYRAKWGLPSDYPMVAPNYAAARSQL 133

Query: 131 AKNMGLGRGRKKR 143
           AK+MGLG+ R K+
Sbjct: 134 AKDMGLGQTRTKK 146


>gi|110633228|ref|YP_673436.1| MucR family transcriptional regulator [Mesorhizobium sp. BNC1]
 gi|110284212|gb|ABG62271.1| transcriptional regulator, MucR family [Chelativorans sp. BNC1]
          Length = 156

 Score =  144 bits (363), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 69/141 (48%), Positives = 98/141 (69%), Gaps = 3/141 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           D+ +  + +  +E+T D+VAAYVSN+ VP++++ +LI DVH+AL RV       + V  E
Sbjct: 19  DEQNTKNEDVLVELTADVVAAYVSNNPVPVSELSNLIADVHAALGRVTR---STEQVATE 75

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
           + KPAV  ++S+ +  + CLEDG +FKSLKRHL TH+ +TP++YR KW L   YPMV+  
Sbjct: 76  KQKPAVNPKRSVHDDYIICLEDGKKFKSLKRHLMTHYGLTPEQYREKWGLDPSYPMVAPN 135

Query: 123 YATTRSKLAKNMGLGRGRKKR 143
           YA  RS+LAK MGLGR RK +
Sbjct: 136 YAVARSQLAKKMGLGRKRKGK 156


>gi|254559120|ref|YP_003066215.1| MucR family transcriptional regulator [Methylobacterium extorquens
           DM4]
 gi|254266398|emb|CAX22162.1| Transcriptional regulatory protein mucR [Methylobacterium
           extorquens DM4]
          Length = 145

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 91/129 (70%), Gaps = 1/129 (0%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV-VSRAPCQDNVQPERLKPAVPIR 71
           ++ +T DIVAAYVSN+ VP A++  LI ++H AL +V   RA     V  E L+PAVPI+
Sbjct: 10  YVALTADIVAAYVSNNPVPAAELAGLIGNIHGALIQVGTGRAATPQPVAQEALQPAVPIK 69

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           KSI+   L CLEDG  FKSLKRHL+  +N++P++YR KW L+ DYPMV+  YA  RS LA
Sbjct: 70  KSIQPDYLVCLEDGRTFKSLKRHLRAKYNLSPEQYRAKWGLSPDYPMVAPNYAKARSDLA 129

Query: 132 KNMGLGRGR 140
           K +GLG+ R
Sbjct: 130 KAIGLGQVR 138


>gi|27378179|ref|NP_769708.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27351326|dbj|BAC48333.1| blr3068 [Bradyrhizobium japonicum USDA 110]
          Length = 138

 Score =  144 bits (362), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 72/139 (51%), Positives = 95/139 (68%), Gaps = 10/139 (7%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV----VSRAPCQDNVQPERL 64
            ++ F+E+T  IV+AY+ N+  P A+I +LI+ VH AL RV    V  AP       E  
Sbjct: 5   GAKNFIELTASIVSAYLGNNPTPAAEIPNLISQVHGALVRVSSGRVEAAPL------EPA 58

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           KPAV ++KSI    L CLEDG +FKSLKRHL+T +NMTP++YR KW L +DYPMV+  YA
Sbjct: 59  KPAVSLKKSIAPDYLVCLEDGKRFKSLKRHLRTQYNMTPEQYREKWGLPADYPMVAPNYA 118

Query: 125 TTRSKLAKNMGLGRGRKKR 143
             RS+LAK MGLG+ ++KR
Sbjct: 119 VARSQLAKQMGLGQQQRKR 137


>gi|13475111|ref|NP_106675.1| transcriptional regulatory protein [Mesorhizobium loti MAFF303099]
 gi|14025862|dbj|BAB52461.1| transcriptional regulatory protein [Mesorhizobium loti MAFF303099]
          Length = 154

 Score =  142 bits (358), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 90/133 (67%), Gaps = 3/133 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           ++  +E+T  +V+AYVSN+ VP+ ++  LI  +H AL+     A  + +   E LKPAVP
Sbjct: 9   ADNLIELTAHVVSAYVSNNPVPVGELPGLIGQIHIALKGTAGGAAPEKS---EALKPAVP 65

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           IRKS+    +  LEDG +FKSLKRHL TH+ +TPDEYR KW L +DYPMV+  YA  RS 
Sbjct: 66  IRKSVTPDYIISLEDGKKFKSLKRHLATHYGLTPDEYRAKWELPADYPMVAPNYAAARSA 125

Query: 130 LAKNMGLGRGRKK 142
           LAK MGLGR  K+
Sbjct: 126 LAKTMGLGRKPKE 138


>gi|188584498|ref|YP_001927943.1| MucR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179347996|gb|ACB83408.1| transcriptional regulator, MucR family [Methylobacterium populi
           BJ001]
          Length = 171

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 99/142 (69%), Gaps = 7/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           ++DD++ D     + + VDIV+AYV N+ + + ++  LIT VH AL ++ S  P +    
Sbjct: 3   LEDDSAGD----HVGLVVDIVSAYVGNNSLAVGELPGLITAVHGALAQL-SNKPAEPEEP 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P  L PAV IR+SI+   L CLEDG +FKSLKRHL+T +N++PDEYR +WNL  DYPMV+
Sbjct: 58  P--LVPAVSIRRSIQQDFLICLEDGKKFKSLKRHLRTRYNLSPDEYRARWNLPDDYPMVA 115

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA TRS+LA+ MGLG+ R+K
Sbjct: 116 PSYAATRSELARTMGLGQQRRK 137


>gi|13488062|ref|NP_085654.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14027903|dbj|BAB54495.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 153

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/130 (51%), Positives = 88/130 (67%), Gaps = 3/130 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E+T D+V+AYVSN+ VP+ ++ +LI  VH+AL+        +   +P  L PAVPI+K
Sbjct: 12  LIELTADVVSAYVSNNPVPIGELPALIGQVHTALKGTAGSVSAK---EPVVLNPAVPIKK 68

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG +FKSLKRHL T   +TPDEYR KW L+ DYPMV+  YA  RS LAK
Sbjct: 69  SVTPDYIICLEDGKKFKSLKRHLSTDFGLTPDEYRAKWGLSGDYPMVAPNYAAERSALAK 128

Query: 133 NMGLGRGRKK 142
            MGLGR  K+
Sbjct: 129 TMGLGRKPKE 138


>gi|221233935|ref|YP_002516371.1| transcriptional regulator [Caulobacter crescentus NA1000]
 gi|220963107|gb|ACL94463.1| transcriptional regulator [Caulobacter crescentus NA1000]
          Length = 139

 Score =  141 bits (355), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 72/136 (52%), Positives = 92/136 (67%), Gaps = 3/136 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +EMT  IV+AYV N+VV  AD+ +LI  VH+AL  V   AP  +   P   +PAVP++K
Sbjct: 7   LIEMTAGIVSAYVGNNVVSTADLPALIKQVHAALANV--GAPDAE-AAPTPKEPAVPVKK 63

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L CLEDG +FKSLKRHL+T ++MTP++YR KW L  DYPMV+  YA  RS LAK
Sbjct: 64  SITPDYLICLEDGRKFKSLKRHLRTKYDMTPEDYRAKWGLPKDYPMVAPNYAEARSNLAK 123

Query: 133 NMGLGRGRKKRVLTSK 148
            MGLG+G +K    +K
Sbjct: 124 QMGLGQGGRKPARKAK 139


>gi|312112925|ref|YP_004010521.1| MucR family transcriptional regulator [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311218054|gb|ADP69422.1| transcriptional regulator, MucR family [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 137

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 74/140 (52%), Positives = 96/140 (68%), Gaps = 5/140 (3%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D  F+++E  ++ T  IV+AYVSN+ V   D+ SLI +VHSAL R  S       V  E 
Sbjct: 3   DEKFENNE-LVDFTTQIVSAYVSNNAVVAGDLPSLIGEVHSALTRASSNVVI---VPKEE 58

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           LKPAV ++KS+    + CLEDG +FKSLKRHL+TH+NM+P+EYR KW L  +YPMV+ +Y
Sbjct: 59  LKPAVAVKKSLTPDYIICLEDGKKFKSLKRHLRTHYNMSPEEYREKWGLEPNYPMVAPKY 118

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           A  RS LAK MGLG+ RK R
Sbjct: 119 AEARSNLAKKMGLGQ-RKGR 137


>gi|188579771|ref|YP_001923216.1| MucR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179343269|gb|ACB78681.1| transcriptional regulator, MucR family [Methylobacterium populi
           BJ001]
          Length = 145

 Score =  140 bits (354), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 90/129 (69%), Gaps = 1/129 (0%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS-RAPCQDNVQPERLKPAVPIR 71
           ++ +T DIVAAYVSN+ VP A++  LI  +H AL +V S +A        E L+PAVPI+
Sbjct: 10  YVALTADIVAAYVSNNPVPAAELAGLIGSIHGALLQVGSGQAVAPQPAAQEPLQPAVPIK 69

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           KSI+   + CLEDG  FKSLKRHL+  +N++P++YR KW LA DYPMV+  YA  RS LA
Sbjct: 70  KSIQPDYIVCLEDGRTFKSLKRHLRAKYNLSPEQYRAKWGLAPDYPMVAPNYAKARSDLA 129

Query: 132 KNMGLGRGR 140
           K +GLG+ R
Sbjct: 130 KAIGLGQVR 138


>gi|254499989|ref|ZP_05112142.1| ROS/MUCR transcriptional regulator protein [Labrenzia alexandrii
           DFL-11]
 gi|222441456|gb|EEE48133.1| ROS/MUCR transcriptional regulator protein [Labrenzia alexandrii
           DFL-11]
          Length = 148

 Score =  140 bits (353), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 90/131 (68%), Gaps = 4/131 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           ++++T DIV+AYVSN +    D+ +LI  VHSAL   VS A        E L PAVP++K
Sbjct: 15  YVDLTADIVSAYVSNKIA-SGDLATLIATVHSAL---VSAAQTVQEPAVEELVPAVPVKK 70

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    + CLEDG +FKSLKRHL+TH +MTP++YR KWNL  DYPMV+  YA  RS LA+
Sbjct: 71  SILGDYIICLEDGKKFKSLKRHLRTHFDMTPEDYRAKWNLPVDYPMVAPNYAAARSDLAR 130

Query: 133 NMGLGRGRKKR 143
            MGLGR + +R
Sbjct: 131 KMGLGRKQGRR 141


>gi|16125201|ref|NP_419765.1| transcriptional regulator [Caulobacter crescentus CB15]
 gi|13422225|gb|AAK22933.1| transcriptional regulator [Caulobacter crescentus CB15]
          Length = 181

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 71/130 (54%), Positives = 90/130 (69%), Gaps = 3/130 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +EMT  IV+AYV N+VV  AD+ +LI  VH+AL  V   AP  +   P   +PAVP++K
Sbjct: 49  LIEMTAGIVSAYVGNNVVSTADLPALIKQVHAALANV--GAPDAE-AAPTPKEPAVPVKK 105

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L CLEDG +FKSLKRHL+T ++MTP++YR KW L  DYPMV+  YA  RS LAK
Sbjct: 106 SITPDYLICLEDGRKFKSLKRHLRTKYDMTPEDYRAKWGLPKDYPMVAPNYAEARSNLAK 165

Query: 133 NMGLGRGRKK 142
            MGLG+G +K
Sbjct: 166 QMGLGQGGRK 175


>gi|302382313|ref|YP_003818136.1| MucR family transcriptional regulator [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192941|gb|ADL00513.1| transcriptional regulator, MucR family [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 148

 Score =  140 bits (352), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 75/140 (53%), Positives = 95/140 (67%), Gaps = 3/140 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           D    D     LEMT DIV+AYV N+ V   D+ SLI+++H+AL +V +       V+PE
Sbjct: 2   DTTRMDERSELLEMTADIVSAYVGNNSVSANDLPSLISNIHAALSQVST---GVVEVEPE 58

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
             +PAVPIRKSI    L CLEDG +FKSLKRHL+T ++M+P+EYR KW L  DYPMV+  
Sbjct: 59  VKEPAVPIRKSISPDFLICLEDGRKFKSLKRHLRTKYDMSPEEYRAKWGLPKDYPMVAPN 118

Query: 123 YATTRSKLAKNMGLGRGRKK 142
           YA  RS LAK MGLG+G +K
Sbjct: 119 YAKARSDLAKQMGLGQGGRK 138


>gi|154246781|ref|YP_001417739.1| MucR family transcriptional regulator [Xanthobacter autotrophicus
           Py2]
 gi|154160866|gb|ABS68082.1| transcriptional regulator, MucR family [Xanthobacter autotrophicus
           Py2]
          Length = 139

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 93/130 (71%), Gaps = 3/130 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           ++E+  DIV+AYVSN+ V + D+ SLI +V+  LQR+ S    ++    E  KPAV ++K
Sbjct: 10  YIELATDIVSAYVSNNTVALTDLPSLIHEVYGTLQRLSS---GEEEPVSEPAKPAVAVKK 66

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG +FKSLKRHL+T ++MTP++YR KW L +DYPMV+  YA  RS+LAK
Sbjct: 67  SVHPDFIICLEDGKKFKSLKRHLRTRYDMTPEQYREKWGLPADYPMVAPNYAAARSELAK 126

Query: 133 NMGLGRGRKK 142
            MGLG+ R++
Sbjct: 127 QMGLGQQRRR 136


>gi|328544572|ref|YP_004304681.1| ROS/MUCR transcriptional regulator protein [polymorphum gilvum
           SL003B-26A1]
 gi|326414314|gb|ADZ71377.1| ROS/MUCR transcriptional regulator protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 117

 Score =  139 bits (349), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 87/118 (73%), Gaps = 3/118 (2%)

Query: 25  VSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLED 84
           +SN+ V   D+ +LI DV++ALQR       Q   +PE LKPAVP++KS+    + CLED
Sbjct: 1   MSNNTVASTDLPALINDVYTALQRTSG---AQAEPEPEPLKPAVPVKKSVMPDYIICLED 57

Query: 85  GMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKK 142
           G +FKSLKRHL+TH++MTP+EYR KW+L +DYPMV+  YA  RS+LAK MGLG+ RK+
Sbjct: 58  GKKFKSLKRHLRTHYDMTPEEYREKWDLPADYPMVAPNYAAARSELAKKMGLGQQRKR 115


>gi|154246181|ref|YP_001417139.1| MucR family transcriptional regulator [Xanthobacter autotrophicus
           Py2]
 gi|154160266|gb|ABS67482.1| transcriptional regulator, MucR family [Xanthobacter autotrophicus
           Py2]
          Length = 154

 Score =  138 bits (348), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 90/129 (69%), Gaps = 4/129 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           L++ VDIVAA+V N+ VP+ ++ +LI  V + L ++   AP    V  E LKPAVP++KS
Sbjct: 14  LDLVVDIVAAFVGNNTVPVGELPALIASVSTTLGQL--DAPAAAPV--EELKPAVPVKKS 69

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    + CLEDG  FKSLKRHL+T ++MTP+ YR KW L  DYPMV+  YA  RS+LAK 
Sbjct: 70  VTADFIVCLEDGKNFKSLKRHLRTAYDMTPEAYREKWGLPHDYPMVAPSYAAARSELAKT 129

Query: 134 MGLGRGRKK 142
           MGLG+ RK+
Sbjct: 130 MGLGQARKQ 138


>gi|299133488|ref|ZP_07026682.1| transcriptional regulator, MucR family [Afipia sp. 1NLS2]
 gi|298591324|gb|EFI51525.1| transcriptional regulator, MucR family [Afipia sp. 1NLS2]
          Length = 137

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 69/139 (49%), Positives = 95/139 (68%), Gaps = 8/139 (5%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR--APCQDNVQPER 63
           S  + + F+EM   IV+AYVSN+ V  +DI +LI  VH+AL RV +   AP       E 
Sbjct: 2   SEPAGKNFVEMAAGIVSAYVSNNTVQPSDIPALIAQVHAALLRVATGGDAPV------EA 55

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            +PAV ++KS+ +  L CLEDG +FKSLKRHL++ +NM+P++YR KW L  DYPMV+  Y
Sbjct: 56  ARPAVSVKKSMTSEYLVCLEDGKRFKSLKRHLRSQYNMSPEQYRKKWGLPPDYPMVAPNY 115

Query: 124 ATTRSKLAKNMGLGRGRKK 142
           A  RS+LAK MGLG+ R++
Sbjct: 116 AVARSQLAKKMGLGQQRRR 134


>gi|240141629|ref|YP_002966109.1| putative transcriptional regulator MucR [Methylobacterium
           extorquens AM1]
 gi|240011606|gb|ACS42832.1| Putative transcriptional regulator MucR [Methylobacterium
           extorquens AM1]
          Length = 175

 Score =  137 bits (346), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 89/127 (70%), Gaps = 3/127 (2%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           + VDIV+AYV N+ + + ++  LIT VH AL  + ++    +   P    PAV IR+SI+
Sbjct: 14  LVVDIVSAYVGNNSLAVGELPGLITSVHGALAHLSNKPSEPEEPAP---TPAVSIRRSIQ 70

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              L CLEDG +FKSLKRHL+T +N++PDEYR +WNL  DYPMV+  YA TRS+LA+ MG
Sbjct: 71  QDFLICLEDGKKFKSLKRHLRTRYNLSPDEYRARWNLPDDYPMVAPSYAATRSELARTMG 130

Query: 136 LGRGRKK 142
           LG+ R+K
Sbjct: 131 LGQQRRK 137


>gi|315499459|ref|YP_004088262.1| transcriptional regulator, mucr family [Asticcacaulis excentricus
           CB 48]
 gi|315417471|gb|ADU14111.1| transcriptional regulator, MucR family [Asticcacaulis excentricus
           CB 48]
          Length = 147

 Score =  137 bits (345), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 86/127 (67%), Gaps = 4/127 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           + V+IV AYVSN+ VP A++  LI  V  AL  + S  P    V+PE   PAV I+KS+ 
Sbjct: 10  LVVEIVTAYVSNNSVPAAELPQLIQSVSGALNSLAS-GPV---VEPENKTPAVSIKKSVG 65

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              + CLEDG +FKSLKRHL + +N+TPDEYR +WNL  DYPMV+  YA  RS LAK MG
Sbjct: 66  TDYIICLEDGRRFKSLKRHLASKYNLTPDEYRARWNLPKDYPMVAPAYAEARSNLAKQMG 125

Query: 136 LGRGRKK 142
           LG+G +K
Sbjct: 126 LGQGGRK 132


>gi|218533114|ref|YP_002423930.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218525417|gb|ACK86002.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 175

 Score =  137 bits (345), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 90/129 (69%), Gaps = 3/129 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           + + VDIV+AYV N+ + + ++  LIT VH AL  + ++    +   P    PAV IR+S
Sbjct: 12  VALVVDIVSAYVGNNSLAVGELPGLITSVHGALAHLSNKPSEPEEPAP---TPAVSIRRS 68

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I+   L CLEDG +FKSLKRHL+T +N++PDEYR +WNL  DYPMV+  YA TRS+LA+ 
Sbjct: 69  IQQDFLICLEDGKKFKSLKRHLRTRYNLSPDEYRARWNLPDDYPMVAPSYAATRSELART 128

Query: 134 MGLGRGRKK 142
           MGLG+ R+K
Sbjct: 129 MGLGQQRRK 137


>gi|154245782|ref|YP_001416740.1| MucR family transcriptional regulator [Xanthobacter autotrophicus
           Py2]
 gi|154159867|gb|ABS67083.1| transcriptional regulator, MucR family [Xanthobacter autotrophicus
           Py2]
          Length = 155

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 94/142 (66%), Gaps = 4/142 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D  S  +S  +++   +IVAAYVSN+ V   ++ +LI  V+ AL ++ +  P    V 
Sbjct: 1   MSDSDSNSTSPSYIDFATEIVAAYVSNNSVSATELPALIESVYRALGQLGT--PAAPVV- 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E  KPAVP++KS+    + CLEDG +FKSLKRHL+T + MTP+ YR KW L  DYPMV+
Sbjct: 58  -EEQKPAVPVKKSVTPEYIVCLEDGKKFKSLKRHLRTSYGMTPEVYREKWGLPKDYPMVA 116

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAKNMGLG+ RKK
Sbjct: 117 PAYAAARSELAKNMGLGQTRKK 138


>gi|239831431|ref|ZP_04679760.1| Transcriptional regulatory protein rosAr [Ochrobactrum intermedium
           LMG 3301]
 gi|239823698|gb|EEQ95266.1| Transcriptional regulatory protein rosAr [Ochrobactrum intermedium
           LMG 3301]
          Length = 142

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/139 (49%), Positives = 95/139 (68%), Gaps = 2/139 (1%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D   +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R   +  V  E+
Sbjct: 5   DTHDESAELLLSLTADVVAAYVGNNSIRAGELPLLIAEVHAAFKRHVERE--EAPVVVEK 62

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            KPAV  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV+  Y
Sbjct: 63  PKPAVNPKKSVHDDYIICLEDGKKFKSLKRHLMTHYNMTPEQYREKWDLDPNYPMVAPNY 122

Query: 124 ATTRSKLAKNMGLGRGRKK 142
           A  RS+LAK MGLGR  K+
Sbjct: 123 AAARSRLAKKMGLGRKPKE 141


>gi|254564137|ref|YP_003071232.1| RosR/MucR family transcriptional regulator [Methylobacterium
           extorquens DM4]
 gi|254271415|emb|CAX27428.1| transcriptional regulator (RosR/MucR family) [Methylobacterium
           extorquens DM4]
          Length = 175

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 90/129 (69%), Gaps = 3/129 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           + + VDIV+AYV N+ + + ++  LIT VH AL  + ++    +   P    PAV IR+S
Sbjct: 12  VALVVDIVSAYVGNNSLAVGELPGLITSVHGALAHLSNKPSEPEEPAP---TPAVSIRRS 68

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I+   L CLEDG +FKSLKRHL+T +N++PDEYR +WNL  DYPMV+  YA TRS+LA+ 
Sbjct: 69  IQQDFLICLEDGKKFKSLKRHLRTRYNLSPDEYRARWNLPDDYPMVAPSYAATRSELART 128

Query: 134 MGLGRGRKK 142
           MGLG+ R+K
Sbjct: 129 MGLGQQRRK 137


>gi|306845184|ref|ZP_07477760.1| Ros/MucR family transcriptional regulator [Brucella sp. BO1]
 gi|306274343|gb|EFM56150.1| Ros/MucR family transcriptional regulator [Brucella sp. BO1]
          Length = 142

 Score =  137 bits (345), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 93/134 (69%), Gaps = 2/134 (1%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R   +  V  E+ KPA
Sbjct: 9   ESTELLLSLTADVVAAYVGNNSIRTGELPVLIAEVHAAFKRHVERE--EAPVVVEKPKPA 66

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV+  YA  R
Sbjct: 67  VNPKKSVHDDYIVCLEDGKKFKSLKRHLMTHYNMTPEQYREKWDLDPNYPMVAPNYAAAR 126

Query: 128 SKLAKNMGLGRGRK 141
           S+LAK MGLGR  K
Sbjct: 127 SRLAKKMGLGRKPK 140


>gi|23501458|ref|NP_697585.1| Ros/MucR family transcriptional regulator [Brucella suis 1330]
 gi|161618545|ref|YP_001592432.1| transcriptional regulatory protein rosAr [Brucella canis ATCC
           23365]
 gi|163842848|ref|YP_001627252.1| transcriptional regulatory protein rosAr [Brucella suis ATCC 23445]
 gi|225627077|ref|ZP_03785115.1| Transcriptional regulatory protein rosAr [Brucella ceti str. Cudo]
 gi|254701365|ref|ZP_05163193.1| transcriptional regulatory protein rosAr [Brucella suis bv. 5 str.
           513]
 gi|254703910|ref|ZP_05165738.1| transcriptional regulatory protein rosAr [Brucella suis bv. 3 str.
           686]
 gi|254707714|ref|ZP_05169542.1| transcriptional regulatory protein rosAr [Brucella pinnipedialis
           M163/99/10]
 gi|254709704|ref|ZP_05171515.1| transcriptional regulatory protein rosAr [Brucella pinnipedialis
           B2/94]
 gi|254712874|ref|ZP_05174685.1| transcriptional regulatory protein rosAr [Brucella ceti M644/93/1]
 gi|254716772|ref|ZP_05178583.1| transcriptional regulatory protein rosAr [Brucella ceti M13/05/1]
 gi|254718721|ref|ZP_05180532.1| transcriptional regulatory protein rosAr [Brucella sp. 83/13]
 gi|256031195|ref|ZP_05444809.1| transcriptional regulatory protein rosAr [Brucella pinnipedialis
           M292/94/1]
 gi|256060702|ref|ZP_05450866.1| transcriptional regulatory protein rosAr [Brucella neotomae 5K33]
 gi|256159292|ref|ZP_05457087.1| transcriptional regulatory protein rosAr [Brucella ceti M490/95/1]
 gi|256254602|ref|ZP_05460138.1| transcriptional regulatory protein rosAr [Brucella ceti B1/94]
 gi|256369009|ref|YP_003106517.1| transcriptional regulator, Ros/MucR family [Brucella microti CCM
           4915]
 gi|260168330|ref|ZP_05755141.1| transcriptional regulator, Ros/MucR family protein [Brucella sp.
           F5/99]
 gi|260566841|ref|ZP_05837311.1| transcriptional regulatory protein MucR [Brucella suis bv. 4 str.
           40]
 gi|261218569|ref|ZP_05932850.1| transcriptional regulator [Brucella ceti M13/05/1]
 gi|261221777|ref|ZP_05936058.1| transcriptional regulator [Brucella ceti B1/94]
 gi|261315208|ref|ZP_05954405.1| transcriptional regulator [Brucella pinnipedialis M163/99/10]
 gi|261317235|ref|ZP_05956432.1| transcriptional regulator [Brucella pinnipedialis B2/94]
 gi|261320582|ref|ZP_05959779.1| transcriptional regulator [Brucella ceti M644/93/1]
 gi|261324693|ref|ZP_05963890.1| transcriptional regulator [Brucella neotomae 5K33]
 gi|261751903|ref|ZP_05995612.1| transcriptional regulator [Brucella suis bv. 5 str. 513]
 gi|261754561|ref|ZP_05998270.1| transcriptional regulator [Brucella suis bv. 3 str. 686]
 gi|261757791|ref|ZP_06001500.1| transcriptional regulatory protein MucR [Brucella sp. F5/99]
 gi|265983697|ref|ZP_06096432.1| transcriptional regulator [Brucella sp. 83/13]
 gi|265988274|ref|ZP_06100831.1| transcriptional regulator [Brucella pinnipedialis M292/94/1]
 gi|265997741|ref|ZP_06110298.1| transcriptional regulator [Brucella ceti M490/95/1]
 gi|306838698|ref|ZP_07471533.1| Ros/MucR family transcriptional regulator [Brucella sp. NF 2653]
 gi|23347361|gb|AAN29500.1| transcriptional regulator, Ros/MucR family [Brucella suis 1330]
 gi|161335356|gb|ABX61661.1| Transcriptional regulatory protein rosAr [Brucella canis ATCC
           23365]
 gi|163673571|gb|ABY37682.1| Transcriptional regulatory protein rosAr [Brucella suis ATCC 23445]
 gi|225617912|gb|EEH14956.1| Transcriptional regulatory protein rosAr [Brucella ceti str. Cudo]
 gi|255999169|gb|ACU47568.1| transcriptional regulator, Ros/MucR family [Brucella microti CCM
           4915]
 gi|260156359|gb|EEW91439.1| transcriptional regulatory protein MucR [Brucella suis bv. 4 str.
           40]
 gi|260920361|gb|EEX87014.1| transcriptional regulator [Brucella ceti B1/94]
 gi|260923658|gb|EEX90226.1| transcriptional regulator [Brucella ceti M13/05/1]
 gi|261293272|gb|EEX96768.1| transcriptional regulator [Brucella ceti M644/93/1]
 gi|261296458|gb|EEX99954.1| transcriptional regulator [Brucella pinnipedialis B2/94]
 gi|261300673|gb|EEY04170.1| transcriptional regulator [Brucella neotomae 5K33]
 gi|261304234|gb|EEY07731.1| transcriptional regulator [Brucella pinnipedialis M163/99/10]
 gi|261737775|gb|EEY25771.1| transcriptional regulatory protein MucR [Brucella sp. F5/99]
 gi|261741656|gb|EEY29582.1| transcriptional regulator [Brucella suis bv. 5 str. 513]
 gi|261744314|gb|EEY32240.1| transcriptional regulator [Brucella suis bv. 3 str. 686]
 gi|262552209|gb|EEZ08199.1| transcriptional regulator [Brucella ceti M490/95/1]
 gi|264660471|gb|EEZ30732.1| transcriptional regulator [Brucella pinnipedialis M292/94/1]
 gi|264662289|gb|EEZ32550.1| transcriptional regulator [Brucella sp. 83/13]
 gi|306406185|gb|EFM62429.1| Ros/MucR family transcriptional regulator [Brucella sp. NF 2653]
          Length = 142

 Score =  137 bits (345), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 93/134 (69%), Gaps = 2/134 (1%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R   +  V  E+ KPA
Sbjct: 9   ESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVHAAFKRHVERE--EAPVVVEKPKPA 66

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV+  YA  R
Sbjct: 67  VNPKKSVHDDYIVCLEDGKKFKSLKRHLMTHYNMTPEQYREKWDLDPNYPMVAPNYAAAR 126

Query: 128 SKLAKNMGLGRGRK 141
           S+LAK MGLGR  K
Sbjct: 127 SRLAKKMGLGRKPK 140


>gi|153010016|ref|YP_001371231.1| MucR family transcriptional regulator [Ochrobactrum anthropi ATCC
           49188]
 gi|151561904|gb|ABS15402.1| transcriptional regulator, MucR family [Ochrobactrum anthropi ATCC
           49188]
          Length = 142

 Score =  137 bits (344), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 94/138 (68%), Gaps = 2/138 (1%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D   +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R   +  V  E+
Sbjct: 5   DTHDESAELLLSLTADVVAAYVGNNSIRAGELPLLIAEVHAAFKRHVERE--EAPVVVEK 62

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            KPAV  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV+  Y
Sbjct: 63  PKPAVNPKKSVHDDYIICLEDGKKFKSLKRHLMTHYNMTPEQYREKWDLDPNYPMVAPNY 122

Query: 124 ATTRSKLAKNMGLGRGRK 141
           A  RS+LAK MGLGR  K
Sbjct: 123 AAARSRLAKKMGLGRKPK 140


>gi|163854169|ref|YP_001642212.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|163665774|gb|ABY33141.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
          Length = 175

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 90/129 (69%), Gaps = 3/129 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           + + VDIV+AYV N+ + + ++  LIT VH AL  + ++    +   P    PAV IR+S
Sbjct: 12  VALVVDIVSAYVRNNSLAVGELPGLITSVHGALAHLSNKPSEPEEPAP---TPAVSIRRS 68

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I+   L CLEDG +FKSLKRHL+T +N++PDEYR +WNL  DYPMV+  YA TRS+LA+ 
Sbjct: 69  IQQDFLICLEDGKKFKSLKRHLRTRYNLSPDEYRARWNLPDDYPMVAPSYAATRSELART 128

Query: 134 MGLGRGRKK 142
           MGLG+ R+K
Sbjct: 129 MGLGQQRRK 137


>gi|62289537|ref|YP_221330.1| transcriptional regulator [Brucella abortus bv. 1 str. 9-941]
 gi|82699466|ref|YP_414040.1| transcriptional regulatory protein MucR [Brucella melitensis biovar
           Abortus 2308]
 gi|189023794|ref|YP_001934562.1| MucR family transcriptional regulator [Brucella abortus S19]
 gi|225852099|ref|YP_002732332.1| transcriptional regulator RosAr [Brucella melitensis ATCC 23457]
 gi|237815034|ref|ZP_04594032.1| Transcriptional regulatory protein rosAr [Brucella abortus str.
           2308 A]
 gi|254688855|ref|ZP_05152109.1| transcriptional regulatory protein MUCR [Brucella abortus bv. 6
           str. 870]
 gi|254693337|ref|ZP_05155165.1| transcriptional regulatory protein MUCR [Brucella abortus bv. 3
           str. Tulya]
 gi|254696985|ref|ZP_05158813.1| transcriptional regulatory protein MUCR [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254729887|ref|ZP_05188465.1| transcriptional regulatory protein MUCR [Brucella abortus bv. 4
           str. 292]
 gi|256044279|ref|ZP_05447183.1| transcriptional regulatory protein MUCR [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256113112|ref|ZP_05453989.1| transcriptional regulatory protein MUCR [Brucella melitensis bv. 3
           str. Ether]
 gi|256257103|ref|ZP_05462639.1| transcriptional regulatory protein MUCR [Brucella abortus bv. 9
           str. C68]
 gi|256264391|ref|ZP_05466923.1| transcriptional regulatory protein MucR [Brucella melitensis bv. 2
           str. 63/9]
 gi|260545706|ref|ZP_05821447.1| transcriptional regulatory protein MucR [Brucella abortus NCTC
           8038]
 gi|260563633|ref|ZP_05834119.1| transcriptional regulatory protein MucR [Brucella melitensis bv. 1
           str. 16M]
 gi|260754339|ref|ZP_05866687.1| transcriptional regulator [Brucella abortus bv. 6 str. 870]
 gi|260757558|ref|ZP_05869906.1| transcriptional regulator [Brucella abortus bv. 4 str. 292]
 gi|260761383|ref|ZP_05873726.1| transcriptional regulator [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883364|ref|ZP_05894978.1| transcriptional regulator [Brucella abortus bv. 9 str. C68]
 gi|261213585|ref|ZP_05927866.1| transcriptional regulator [Brucella abortus bv. 3 str. Tulya]
 gi|265990690|ref|ZP_06103247.1| transcriptional regulator [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994522|ref|ZP_06107079.1| transcriptional regulator [Brucella melitensis bv. 3 str. Ether]
 gi|297247950|ref|ZP_06931668.1| transcriptional regulatory protein rosAr [Brucella abortus bv. 5
           str. B3196]
 gi|62195669|gb|AAX73969.1| transcriptional regulator [Brucella abortus bv. 1 str. 9-941]
 gi|82615567|emb|CAJ10550.1| transcriptional regulatory protein MucR [Brucella melitensis biovar
           Abortus 2308]
 gi|189019366|gb|ACD72088.1| transcriptional regulatory protein MucR [Brucella abortus S19]
 gi|225640464|gb|ACO00378.1| Transcriptional regulatory protein rosAr [Brucella melitensis ATCC
           23457]
 gi|237789871|gb|EEP64081.1| Transcriptional regulatory protein rosAr [Brucella abortus str.
           2308 A]
 gi|260097113|gb|EEW80988.1| transcriptional regulatory protein MucR [Brucella abortus NCTC
           8038]
 gi|260153649|gb|EEW88741.1| transcriptional regulatory protein MucR [Brucella melitensis bv. 1
           str. 16M]
 gi|260667876|gb|EEX54816.1| transcriptional regulator [Brucella abortus bv. 4 str. 292]
 gi|260671815|gb|EEX58636.1| transcriptional regulator [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674447|gb|EEX61268.1| transcriptional regulator [Brucella abortus bv. 6 str. 870]
 gi|260872892|gb|EEX79961.1| transcriptional regulator [Brucella abortus bv. 9 str. C68]
 gi|260915192|gb|EEX82053.1| transcriptional regulator [Brucella abortus bv. 3 str. Tulya]
 gi|262765635|gb|EEZ11424.1| transcriptional regulator [Brucella melitensis bv. 3 str. Ether]
 gi|263001474|gb|EEZ14049.1| transcriptional regulator [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094685|gb|EEZ18464.1| transcriptional regulatory protein MucR [Brucella melitensis bv. 2
           str. 63/9]
 gi|297175119|gb|EFH34466.1| transcriptional regulatory protein rosAr [Brucella abortus bv. 5
           str. B3196]
 gi|326408594|gb|ADZ65659.1| transcriptional regulatory protein MucR [Brucella melitensis M28]
 gi|326538314|gb|ADZ86529.1| transcriptional regulatory protein rosAr [Brucella melitensis
           M5-90]
          Length = 142

 Score =  137 bits (344), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 93/134 (69%), Gaps = 2/134 (1%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R   +  V  E+ KPA
Sbjct: 9   ESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVHAAFKRHVERE--EAPVVVEKPKPA 66

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV+  YA  R
Sbjct: 67  VNPKKSVHDDYIVCLEDGKKFKSLKRHLVTHYNMTPEQYREKWDLDPNYPMVAPNYAAAR 126

Query: 128 SKLAKNMGLGRGRK 141
           S+LAK MGLGR  K
Sbjct: 127 SRLAKKMGLGRKPK 140


>gi|158423605|ref|YP_001524897.1| putative transcriptional regulator [Azorhizobium caulinodans ORS
           571]
 gi|158330494|dbj|BAF87979.1| putative transcriptional regulator [Azorhizobium caulinodans ORS
           571]
          Length = 151

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 2/125 (1%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           LE+  DIV AYV N+ V  +D+  LI  VH+AL+ +       +    E LKPAVP++KS
Sbjct: 11  LELVADIVTAYVGNNTVAQSDLSDLIVKVHAALRGLSGN--TAEAAPVEELKPAVPVKKS 68

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    + CLEDG QFKSLKRHL++ + +TPD YR KWNL  DYPMV+  YA  RS+LA++
Sbjct: 69  VTPDYIICLEDGRQFKSLKRHLQSAYGLTPDAYRAKWNLPRDYPMVAPNYAAARSELARS 128

Query: 134 MGLGR 138
           +GLGR
Sbjct: 129 LGLGR 133


>gi|148559703|ref|YP_001258568.1| Ros/MucR family transcriptional regulator [Brucella ovis ATCC
           25840]
 gi|294851940|ref|ZP_06792613.1| ros/MucR family transcriptional regulator [Brucella sp. NVSL
           07-0026]
 gi|148370960|gb|ABQ60939.1| transcriptional regulator, Ros/MucR family [Brucella ovis ATCC
           25840]
 gi|294820529|gb|EFG37528.1| ros/MucR family transcriptional regulator [Brucella sp. NVSL
           07-0026]
          Length = 161

 Score =  136 bits (343), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 93/134 (69%), Gaps = 2/134 (1%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R   +  V  E+ KPA
Sbjct: 28  ESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVHAAFKRHVERE--EAPVVVEKPKPA 85

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV+  YA  R
Sbjct: 86  VNPKKSVHDDYIVCLEDGKKFKSLKRHLMTHYNMTPEQYREKWDLDPNYPMVAPNYAAAR 145

Query: 128 SKLAKNMGLGRGRK 141
           S+LAK MGLGR  K
Sbjct: 146 SRLAKKMGLGRKPK 159


>gi|17987647|ref|NP_540281.1| transcriptional regulatory protein MUCR [Brucella melitensis bv. 1
           str. 16M]
 gi|17983359|gb|AAL52545.1| transcriptional regulatory protein mucr [Brucella melitensis bv. 1
           str. 16M]
          Length = 161

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 93/134 (69%), Gaps = 2/134 (1%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R   +  V  E+ KPA
Sbjct: 28  ESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVHAAFKRHVERE--EAPVVVEKPKPA 85

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV+  YA  R
Sbjct: 86  VNPKKSVHDDYIVCLEDGKKFKSLKRHLVTHYNMTPEQYREKWDLDPNYPMVAPNYAAAR 145

Query: 128 SKLAKNMGLGRGRK 141
           S+LAK MGLGR  K
Sbjct: 146 SRLAKKMGLGRKPK 159


>gi|306842160|ref|ZP_07474829.1| Ros/MucR family transcriptional regulator [Brucella sp. BO2]
 gi|306287747|gb|EFM59178.1| Ros/MucR family transcriptional regulator [Brucella sp. BO2]
          Length = 142

 Score =  136 bits (342), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 92/134 (68%), Gaps = 2/134 (1%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R   +  V  E+ KPA
Sbjct: 9   ESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVHAAFKRHVERE--EAPVVVEKPKPA 66

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV+  YA  R
Sbjct: 67  VNPKKSVHDDYIVCLEDGKKFKSLKRHLMTHYNMTPEQYREKWDLDPNYPMVAPNYAAAR 126

Query: 128 SKLAKNMGLGRGRK 141
           S LAK MGLGR  K
Sbjct: 127 SHLAKKMGLGRKPK 140


>gi|296537251|ref|ZP_06899148.1| transcriptional regulator [Roseomonas cervicalis ATCC 49957]
 gi|296262420|gb|EFH09148.1| transcriptional regulator [Roseomonas cervicalis ATCC 49957]
          Length = 147

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 91/134 (67%), Gaps = 4/134 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            L +T  IVAA+VSN+ VP+ D+ SLI  VH  L  + S AP   +V  ER +PAVP++K
Sbjct: 10  LLGLTAQIVAAHVSNNSVPLTDVPSLIEQVHRTLSGLGS-APVAASVPAERPQPAVPVKK 68

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+ +  L CLEDG + K LKRHLKT ++MTP++YR +W L SDYPMV+  YA  RS LAK
Sbjct: 69  SVTDEYLVCLEDGKKLKMLKRHLKTAYDMTPEQYRERWGLPSDYPMVAPNYAKHRSSLAK 128

Query: 133 NMGLG---RGRKKR 143
            +GLG   RG + R
Sbjct: 129 RIGLGTKPRGGRPR 142


>gi|240138488|ref|YP_002962960.1| hypothetical protein MexAM1_META1p1841 [Methylobacterium extorquens
           AM1]
 gi|240008457|gb|ACS39683.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 170

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 95/144 (65%), Gaps = 4/144 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+  A+  S    +E+T ++++AYV+ + VP A +  LI  VH AL +++   P +   Q
Sbjct: 4   MNQTATLGSPN-LIELTAEVISAYVTQNSVPTAQLPELIAVVHGAL-KMLGEQPSEPASQ 61

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
              L+PAVPI+ SI    L CLEDG +FKSL+RHL + + MTPD+YR KW+L  DYPMV+
Sbjct: 62  --ELRPAVPIKTSITPDFLICLEDGRRFKSLRRHLSSKYGMTPDQYRAKWSLPKDYPMVA 119

Query: 121 REYATTRSKLAKNMGLGRGRKKRV 144
             YA  RS+LA+ MGLG+ R+K+ 
Sbjct: 120 PNYAAARSELARRMGLGQIRRKKA 143


>gi|56552308|ref|YP_163147.1| MucR family transcriptional regulator [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241761634|ref|ZP_04759721.1| transcriptional regulator, MucR family [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753999|ref|YP_003226892.1| MucR family transcriptional regulator [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|56543882|gb|AAV90036.1| transcriptional regulator, MucR family [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241373942|gb|EER63475.1| transcriptional regulator, MucR family [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258553362|gb|ACV76308.1| transcriptional regulator, MucR family [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 137

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 70/144 (48%), Positives = 95/144 (65%), Gaps = 8/144 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M DD +   SE  + +T DIV+A+VSN+ V +AD+  LI +VH AL      A  + N +
Sbjct: 1   MSDDNAL--SETLITLTADIVSAHVSNNSVSVADVPQLIQNVHHALS-----ALSEANAE 53

Query: 61  PE-RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           PE R +PAV +R S++   + CLEDG + K LKRHL TH+ +TP++YR KWNL +DYPMV
Sbjct: 54  PEARPEPAVSVRASVKPDYIICLEDGKKLKMLKRHLATHYQLTPEQYRAKWNLPADYPMV 113

Query: 120 SREYATTRSKLAKNMGLGRGRKKR 143
           +  YA  R  LAK +GLG  R+KR
Sbjct: 114 APNYADQRRSLAKKIGLGTQRRKR 137


>gi|148550705|ref|YP_001260144.1| transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148503124|gb|ABQ71377.1| transcriptional regulator [Sphingomonas wittichii RW1]
          Length = 159

 Score =  135 bits (340), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 85/126 (67%), Gaps = 3/126 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            + +TVDIVAA+VSN+ +P  D+ +LI  V+SAL + V+ AP     QPE L+PAV IR 
Sbjct: 6   LVTLTVDIVAAHVSNNALPATDLPALIEGVYSALNQAVAPAP---EPQPEELRPAVSIRH 62

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S++   L CLEDG + K LKRHL TH+ ++PD YR KW L  DYPMV+  Y   RS LAK
Sbjct: 63  SVKPDYLVCLEDGKKMKMLKRHLATHYGLSPDAYRAKWGLPKDYPMVAPSYRERRSTLAK 122

Query: 133 NMGLGR 138
             GLGR
Sbjct: 123 ENGLGR 128


>gi|83593164|ref|YP_426916.1| MucR family transcriptional regulator [Rhodospirillum rubrum ATCC
           11170]
 gi|83576078|gb|ABC22629.1| transcriptional regulator, MucR family [Rhodospirillum rubrum ATCC
           11170]
          Length = 139

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 89/138 (64%), Gaps = 3/138 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MDD     + +  L+MTV +V+AYVS + +P   I  LI    +  Q + +  P    ++
Sbjct: 1   MDDKQEALTRDDVLKMTVSVVSAYVSKNPMPATQIPDLI---QTTFQALSTLEPQAIEIK 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E  KPAVP++KSI    L CLEDG + K LKRHL+T++NMTP+EYR KWNLA+DYPMV+
Sbjct: 58  VEAAKPAVPVKKSIHAEYLVCLEDGKKLKMLKRHLRTNYNMTPEEYRAKWNLAADYPMVA 117

Query: 121 REYATTRSKLAKNMGLGR 138
             YA  RS  AK +GLGR
Sbjct: 118 PNYAQQRSDFAKKIGLGR 135


>gi|300022617|ref|YP_003755228.1| MucR family transcriptional regulator [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524438|gb|ADJ22907.1| transcriptional regulator, MucR family [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 133

 Score =  134 bits (337), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 66/133 (49%), Positives = 87/133 (65%), Gaps = 5/133 (3%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR-APCQDNVQPERLKPA 67
           S    + +T  IVAAYVSN+ +   D+  LI + H+AL R   R AP +     E  KP 
Sbjct: 5   SQPELVTITATIVAAYVSNNSISSTDLPGLIAETHAALSRAAGRSAPAER----EEAKPK 60

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           + ++KS+    L CLEDG +FKSLKRHL+TH+N++P+EYR KW+L  DYPMV+  YA  R
Sbjct: 61  IAVKKSVMPDYLICLEDGKKFKSLKRHLRTHYNLSPEEYREKWSLPPDYPMVAPNYANAR 120

Query: 128 SKLAKNMGLGRGR 140
           S+LAK MGLG  R
Sbjct: 121 SQLAKKMGLGTRR 133


>gi|315500368|ref|YP_004089171.1| transcriptional regulator, mucr family [Asticcacaulis excentricus
           CB 48]
 gi|315418380|gb|ADU15020.1| transcriptional regulator, MucR family [Asticcacaulis excentricus
           CB 48]
          Length = 141

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 65/136 (47%), Positives = 87/136 (63%), Gaps = 3/136 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            +   +  ++ VDIV AYV N+ VP +++ +LI  VH AL  +      +     E   P
Sbjct: 1   MEEQNKLTDLVVDIVTAYVGNNSVPASELPALIHSVHKALGGLTGEPEAKVE---EAKTP 57

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AV I+KSI +  + CLEDG +FKSLKRHL+T +NM+P+EYR KWNL  DYPMV+  YA  
Sbjct: 58  AVSIKKSISDDYIICLEDGRKFKSLKRHLRTKYNMSPEEYRAKWNLPKDYPMVAPNYAAA 117

Query: 127 RSKLAKNMGLGRGRKK 142
           RS LAK MGLG G ++
Sbjct: 118 RSNLAKQMGLGTGGRQ 133


>gi|323136748|ref|ZP_08071829.1| transcriptional regulator, MucR family [Methylocystis sp. ATCC
           49242]
 gi|322398065|gb|EFY00586.1| transcriptional regulator, MucR family [Methylocystis sp. ATCC
           49242]
          Length = 148

 Score =  134 bits (336), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 98/143 (68%), Gaps = 4/143 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS-RAPCQDNV 59
           M DD S + +   LE   +IV+AYVSN+ +P +++ +L+  VH++L R+ S +    D  
Sbjct: 1   MADDNSPEHAAS-LEYAAEIVSAYVSNNSLPASELPALLQSVHASLVRLASGQVTAVDTT 59

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
            P+  +PAVPI+KS+    + CLEDG +FKSLKRHL++ +++TPD+YR KW L SDYPMV
Sbjct: 60  TPK--EPAVPIKKSVTPDFIICLEDGKKFKSLKRHLRSAYSLTPDQYRAKWGLPSDYPMV 117

Query: 120 SREYATTRSKLAKNMGLGRGRKK 142
           +  YA TRS+LA  MGLG+   K
Sbjct: 118 APNYAKTRSELAVQMGLGQKSSK 140


>gi|170744615|ref|YP_001773270.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168198889|gb|ACA20836.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 133

 Score =  134 bits (336), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 89/128 (69%), Gaps = 5/128 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E   DIVAAYVSN+ VP+AD+ SLI+ VH++L R+ + AP +    PE+  P +PI+K
Sbjct: 10  LIEQATDIVAAYVSNNSVPVADLPSLISAVHTSLVRLRNPAPAE----PEKPVPLMPIKK 65

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           +I    L  LEDG Q+KSLKRHL T   +TP++YR KW L  DYPMV+  YA  RS+LAK
Sbjct: 66  TITPDFLISLEDGRQYKSLKRHLSTR-GLTPEQYRQKWGLPPDYPMVAANYAAQRSELAK 124

Query: 133 NMGLGRGR 140
           + GLGR R
Sbjct: 125 SSGLGRRR 132


>gi|154251327|ref|YP_001412151.1| MucR family transcriptional regulator [Parvibaculum lavamentivorans
           DS-1]
 gi|154155277|gb|ABS62494.1| transcriptional regulator, MucR family [Parvibaculum
           lavamentivorans DS-1]
          Length = 138

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 90/136 (66%), Gaps = 4/136 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            ++MT +IV+AYV ++ +   +I  LI  V +AL      AP       E+L+PAV IRK
Sbjct: 7   LIDMTAEIVSAYVGHNTLSPDEIPGLINKVFAALAGANGIAPAPA----EKLEPAVSIRK 62

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    L CLEDG +FKSLKRHL+TH+N+TP++YR KW L  DYPMV+  YA  RS+LAK
Sbjct: 63  SVTPDHLICLEDGKKFKSLKRHLRTHYNLTPEQYREKWGLPRDYPMVAPNYAQARSRLAK 122

Query: 133 NMGLGRGRKKRVLTSK 148
            MGLG+G   R  T+K
Sbjct: 123 KMGLGQGAGGRRRTAK 138


>gi|315500765|ref|YP_004089566.1| transcriptional regulator, MucR family [Asticcacaulis excentricus
           CB 48]
 gi|315418777|gb|ADU15415.1| transcriptional regulator, MucR family [Asticcacaulis excentricus
           CB 48]
          Length = 146

 Score =  133 bits (335), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 88/127 (69%), Gaps = 4/127 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +TV+IV+A+V N+ +P +++  LI  V+++L  + S  P    V+PE   PAV I+KS+ 
Sbjct: 10  LTVEIVSAFVGNNPLPASELPQLIQSVYTSLNSLSSAPP----VEPEARVPAVSIKKSVG 65

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              + CLEDG +FKSLKRHL + +N+TPDEYR KWNL  DYPMV+  YA  RS LAK +G
Sbjct: 66  ADYIICLEDGRKFKSLKRHLASKYNLTPDEYRAKWNLPKDYPMVAPAYAEARSHLAKQIG 125

Query: 136 LGRGRKK 142
           LG G +K
Sbjct: 126 LGTGGRK 132


>gi|319408238|emb|CBI81891.1| transcriptional regulator [Bartonella schoenbuchensis R1]
          Length = 145

 Score =  133 bits (334), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 89/134 (66%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   + +  DIVAAYVSN+ +   ++  LI DVH+A  +V + A  +  V+ +R  PAV 
Sbjct: 11  SNLVITLVADIVAAYVSNNSIRPTEVPGLIADVHAAFLKVGNAASAEAGVEKQR--PAVN 68

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            ++SI    L CLEDG +FKSLKRHL TH+ M+P+EYR KW L S YPMV+  YA  RS 
Sbjct: 69  PKRSIFPDYLICLEDGKKFKSLKRHLMTHYKMSPEEYREKWQLDSSYPMVAPNYAKARSN 128

Query: 130 LAKNMGLGRGRKKR 143
           LAK MGLGR R+K+
Sbjct: 129 LAKEMGLGRKRQKK 142


>gi|121602360|ref|YP_988741.1| Ros/MucR family transcriptional regulator [Bartonella bacilliformis
           KC583]
 gi|120614537|gb|ABM45138.1| transcriptional regulatory protein, ros/MucR family [Bartonella
           bacilliformis KC583]
          Length = 143

 Score =  132 bits (332), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 4/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   + +  D+VAAYVSN+ +  A++ SLI DVH+A  +  + A    +V+ E+ +PAV 
Sbjct: 11  SSLIITLVADVVAAYVSNNSIQPAEVPSLIADVHAAFLKAGNTA----SVEVEKQRPAVN 66

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            R+SI    L CLEDG +FKSLKRHL TH+ M+P+EYR KW L S YPMV+  Y   RS 
Sbjct: 67  PRRSIFPDYLICLEDGKKFKSLKRHLMTHYQMSPEEYREKWQLESSYPMVAPNYTKARSA 126

Query: 130 LAKNMGLGRGRKKR 143
           LAK MGLG  R+K+
Sbjct: 127 LAKEMGLGHNRQKK 140


>gi|329849902|ref|ZP_08264748.1| transcriptional regulatory protein ros [Asticcacaulis biprosthecum
           C19]
 gi|328841813|gb|EGF91383.1| transcriptional regulatory protein ros [Asticcacaulis biprosthecum
           C19]
          Length = 136

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 88/129 (68%), Gaps = 3/129 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           ++MT DIV+A+V N+ VP +++ SLI  V+ AL  + S    +     E   PAV ++KS
Sbjct: 1   MDMTADIVSAFVGNNSVPASELPSLIQSVYQALNSISSGEETKVEAPKE---PAVSVKKS 57

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I +  + CLEDG +FKSLKRHL+T + M+P++YR KWNL  DYPMV+  YA  RS LAK 
Sbjct: 58  ISSDYIICLEDGRKFKSLKRHLRTKYGMSPEDYRAKWNLPKDYPMVAPNYAKARSDLAKQ 117

Query: 134 MGLGRGRKK 142
           MGLG+G ++
Sbjct: 118 MGLGQGGRQ 126


>gi|115523885|ref|YP_780796.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           BisA53]
 gi|115517832|gb|ABJ05816.1| transcriptional regulator, MucR family [Rhodopseudomonas palustris
           BisA53]
          Length = 138

 Score =  132 bits (331), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 95/135 (70%), Gaps = 3/135 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + + F+++T  IVAAYV N+  P A++  LI+ +H+AL R+ +    +    PE  KPAV
Sbjct: 5   AGKTFIDLTATIVAAYVGNNPTPAAELPGLISQIHAALVRISA---GRAEPPPEPAKPAV 61

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            ++KS+ +  L CLEDG +FKSLKRHL+T +NMTP++YR KW L  DYPMV+  YA  RS
Sbjct: 62  SLKKSVTSDYLVCLEDGKRFKSLKRHLRTQYNMTPEQYREKWGLPPDYPMVAPNYAVARS 121

Query: 129 KLAKNMGLGRGRKKR 143
           +LAK MGLG+ RK+R
Sbjct: 122 QLAKKMGLGQQRKRR 136


>gi|222084376|ref|YP_002542905.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Agrobacterium radiobacter K84]
 gi|221721824|gb|ACM24980.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Agrobacterium radiobacter K84]
          Length = 172

 Score =  131 bits (330), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 86/126 (68%), Gaps = 4/126 (3%)

Query: 18  VDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENG 77
           V IV+AYVS++ VP+  +  LITDVH ALQ +    P  +  +P    PAV ++KS+ N 
Sbjct: 46  VKIVSAYVSHNTVPIGSLSKLITDVHEALQTLDGTTPSVERSKPV---PAVDLKKSVTND 102

Query: 78  CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLG 137
            + CLEDG +FK+LKRHL+ H+ MTP+EYR KW LA  YPMV++ YA  RS+LAK  GLG
Sbjct: 103 YIICLEDGKRFKTLKRHLRVHYGMTPEEYRQKWGLAPTYPMVAQNYANRRSELAKLSGLG 162

Query: 138 -RGRKK 142
             G KK
Sbjct: 163 ANGNKK 168


>gi|220924036|ref|YP_002499338.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948643|gb|ACL59035.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 141

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 86/124 (69%), Gaps = 3/124 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           ++E+  DIV+A+VS + VP+ ++  LI  VH  L R+  + P +   +P    PAVPIRK
Sbjct: 10  YIELAADIVSAFVSKNPVPVGELPGLIASVHETLGRL-GKDPVEQKSEPP--TPAVPIRK 66

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    L CLEDG +FKSLKRHL++ + ++P+EYR +WNL +DYPMV+  YA  RS+LAK
Sbjct: 67  SVMPDYLVCLEDGKKFKSLKRHLRSRYGLSPEEYRERWNLPTDYPMVAPNYAAARSELAK 126

Query: 133 NMGL 136
            MGL
Sbjct: 127 TMGL 130


>gi|114799831|ref|YP_759467.1| Ros/MucR family transcriptional regulator [Hyphomonas neptunium
           ATCC 15444]
 gi|114740005|gb|ABI78130.1| transcriptional regulator, Ros/MucR family [Hyphomonas neptunium
           ATCC 15444]
          Length = 137

 Score =  131 bits (329), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 67/137 (48%), Positives = 95/137 (69%), Gaps = 6/137 (4%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           +++AS  SS+ F+    +IVAAYV N+ V  +++  LI +VH +L  +    P     + 
Sbjct: 4   EENASVRSSD-FVVYATEIVAAYVRNNAVQTSELPDLIRNVHRSLLDLGGPVP-----EA 57

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           E+ KPAV ++KSI +  L CLEDG++FKSLKRHL++ ++M+PDEYR KW L +DYPMV+ 
Sbjct: 58  EKQKPAVTVKKSIHHDYLICLEDGLKFKSLKRHLRSKYDMSPDEYREKWGLPADYPMVAP 117

Query: 122 EYATTRSKLAKNMGLGR 138
            Y+  RSKLAK MGLGR
Sbjct: 118 GYSAQRSKLAKKMGLGR 134


>gi|90423282|ref|YP_531652.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           BisB18]
 gi|90105296|gb|ABD87333.1| transcriptional regulator, MucR family [Rhodopseudomonas palustris
           BisB18]
          Length = 138

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/135 (51%), Positives = 95/135 (70%), Gaps = 3/135 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + + F+++T  IV+AYVSN+  P AD+  LI  +H+AL RV +    +    PE  KPAV
Sbjct: 5   TGKSFIDLTATIVSAYVSNNPTPAADLPGLIGQIHAALVRVSA---GRVEPPPEPAKPAV 61

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            ++KS+    L CLEDG +FKSLKRHL+T +NMTP++YR KW LA DYPMV+  YA  RS
Sbjct: 62  SLKKSMTADYLVCLEDGKRFKSLKRHLRTQYNMTPEQYRDKWGLAPDYPMVAPNYAVARS 121

Query: 129 KLAKNMGLGRGRKKR 143
           +LAK MGLG+ R++R
Sbjct: 122 QLAKKMGLGQQRRRR 136


>gi|220926935|ref|YP_002502237.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219951542|gb|ACL61934.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 145

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 90/143 (62%), Gaps = 5/143 (3%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D D     +E  + +T DIV+AYVS + VP +++  L+T +H  LQ +VS  P      P
Sbjct: 4   DVDGRDADAEELVTLTADIVSAYVSKNSVPASELPGLLTSIHGTLQALVSPPPAA----P 59

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           E+  P +P++K++    +  LEDG  +KSLKRHL T   +TP++YR KW L  DYPMV+ 
Sbjct: 60  EKPVPPIPVKKTVTPDAIISLEDGKPYKSLKRHLTTR-GLTPEQYREKWGLPPDYPMVAA 118

Query: 122 EYATTRSKLAKNMGLGRGRKKRV 144
            YA  RS+LAK++GLG+ RK R 
Sbjct: 119 NYAAQRSELAKSIGLGQQRKNRA 141


>gi|288957848|ref|YP_003448189.1| transcriptional regulatory protein [Azospirillum sp. B510]
 gi|288910156|dbj|BAI71645.1| transcriptional regulatory protein [Azospirillum sp. B510]
          Length = 147

 Score =  130 bits (328), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 70/146 (47%), Positives = 91/146 (62%), Gaps = 6/146 (4%)

Query: 1   MDDDASFDSSER-FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M D    D  +   L MT DIV+AYVS +V+P   I  +I  V+S+L  +  +      V
Sbjct: 1   MSDQLRADGPDNALLRMTADIVSAYVSKNVLPAQQIPDVINTVYSSLTGLNGQP---REV 57

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E LKPAVPIRKS+    + CLEDG + K LKRHL++ +NM+PDEYR +W L  DYPMV
Sbjct: 58  AAEPLKPAVPIRKSVTPEYIVCLEDGKKLKMLKRHLRSTYNMSPDEYRARWGLPPDYPMV 117

Query: 120 SREYATTRSKLAKNMGLGR--GRKKR 143
           +  YA  RS+ AK +GLGR  GR+ R
Sbjct: 118 APNYAAQRSEFAKRIGLGRSSGRQTR 143


>gi|220924831|ref|YP_002500133.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219949438|gb|ACL59830.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 160

 Score =  130 bits (327), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 84/126 (66%), Gaps = 5/126 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            + ++ DIV+AYVS + VP+ D+  LI  VHS+L +VVS  P      PE+  P +PIRK
Sbjct: 12  LINLSADIVSAYVSKNSVPLGDLAGLIESVHSSLVKVVSPPPAA----PEKPVPPIPIRK 67

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           ++    +  LEDG  +KSLKRHL +   +TPDEYR KW L  DYPMV+  YA  RS+LAK
Sbjct: 68  TVTPDAIISLEDGKPYKSLKRHL-SGRGLTPDEYRQKWGLPPDYPMVAANYAAQRSELAK 126

Query: 133 NMGLGR 138
           ++GLG+
Sbjct: 127 SLGLGQ 132


>gi|307293139|ref|ZP_07572985.1| transcriptional regulator, MucR family [Sphingobium
           chlorophenolicum L-1]
 gi|306881205|gb|EFN12421.1| transcriptional regulator, MucR family [Sphingobium
           chlorophenolicum L-1]
          Length = 141

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 65/133 (48%), Positives = 91/133 (68%), Gaps = 4/133 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           SE  + +T DIVAA+VSN+ V ++D+ +LI +VH+AL  + + A   + V+PE   PAV 
Sbjct: 8   SELLITLTSDIVAAHVSNNSVAVSDVSTLIQNVHAALSGLTTPAAAPE-VKPE---PAVS 63

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +R SI+   + CLEDG + K LKRHL TH+ MTP++YR KW L +DYPMV+  YA  R  
Sbjct: 64  VRSSIKPDYIICLEDGKKLKMLKRHLMTHYQMTPEDYRAKWGLPADYPMVAPNYAEQRRS 123

Query: 130 LAKNMGLGRGRKK 142
           LAK +GLG  R++
Sbjct: 124 LAKKIGLGTKRRR 136


>gi|312114879|ref|YP_004012475.1| MucR family transcriptional regulator [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311220008|gb|ADP71376.1| transcriptional regulator, MucR family [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 163

 Score =  130 bits (326), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 63/132 (47%), Positives = 90/132 (68%), Gaps = 4/132 (3%)

Query: 8   DSSE-RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
           DS+E      T D+VAAYV+N+V+    +   I  V+ AL +  +++   +  +PE L P
Sbjct: 3   DSNEIELTSFTADVVAAYVANNVISADKLPDFIVSVYGALSKAATQS--VEPAKPE-LTP 59

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AVP++KS+    + CLEDG +FKSLKRHLKTH++++P++YR KW L  DYPMV+  YA  
Sbjct: 60  AVPVKKSVTQDFIICLEDGKKFKSLKRHLKTHYDLSPEDYREKWGLPHDYPMVAPAYAAA 119

Query: 127 RSKLAKNMGLGR 138
           RS LAK+MGLG+
Sbjct: 120 RSNLAKSMGLGQ 131


>gi|294012039|ref|YP_003545499.1| MucR-family transcriptional regulator [Sphingobium japonicum UT26S]
 gi|292675369|dbj|BAI96887.1| MucR-family transcriptional regulator [Sphingobium japonicum UT26S]
          Length = 141

 Score =  130 bits (326), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 65/133 (48%), Positives = 91/133 (68%), Gaps = 4/133 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           SE  + +T DIVAA+VSN+ V ++D+ +LI +VH+AL  + + A   + V+PE   PAV 
Sbjct: 8   SELLITLTSDIVAAHVSNNSVAVSDVSTLIQNVHAALSGLATPAAAPE-VKPE---PAVS 63

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +R SI+   + CLEDG + K LKRHL TH+ MTP++YR KW L +DYPMV+  YA  R  
Sbjct: 64  VRSSIKPDYIICLEDGKKLKMLKRHLMTHYQMTPEDYRAKWGLPADYPMVAPNYAEQRRS 123

Query: 130 LAKNMGLGRGRKK 142
           LAK +GLG  R++
Sbjct: 124 LAKKIGLGTKRRR 136


>gi|163796263|ref|ZP_02190224.1| Predicted transcriptional regulator [alpha proteobacterium BAL199]
 gi|159178405|gb|EDP62947.1| Predicted transcriptional regulator [alpha proteobacterium BAL199]
          Length = 141

 Score =  129 bits (324), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/141 (47%), Positives = 90/141 (63%), Gaps = 9/141 (6%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
            S   L MT ++VAAY+ N+ V  A I  +I  VH AL+ + S    + + +P  LKPAV
Sbjct: 2   GSSDLLRMTTEVVAAYLGNNSVSAAQISEVIGTVHDALKNL-STGGSEPDAEP--LKPAV 58

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI+KSI    + CLEDG Q K LKRHL+T +++TP+EYR KW L + YPMV+  YA  RS
Sbjct: 59  PIKKSITPDYIVCLEDGKQLKMLKRHLRTTYDLTPEEYRAKWGLPASYPMVAPNYAKQRS 118

Query: 129 KLAKNMGLGR------GRKKR 143
           + AK +GLGR      GR+K+
Sbjct: 119 EFAKKIGLGRVSAKPAGRRKK 139


>gi|94498007|ref|ZP_01304571.1| predicted transcriptional regulator [Sphingomonas sp. SKA58]
 gi|94422590|gb|EAT07627.1| predicted transcriptional regulator [Sphingomonas sp. SKA58]
          Length = 140

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/134 (50%), Positives = 90/134 (67%), Gaps = 6/134 (4%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE-RLKPAV 68
           +E  + +T DIVAA+VSN+ V ++D+ SLI +VH+AL      A  Q    PE R +PAV
Sbjct: 8   NELLITLTSDIVAAHVSNNSVAVSDVSSLIQNVHAALS-----ALNQPVEAPEVRPEPAV 62

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            IR SI+   + CLEDG + K LKRHL TH+ MTP++YR KWNL +DYPMV+  YA  R 
Sbjct: 63  SIRASIKPDYIVCLEDGKKLKMLKRHLMTHYQMTPEDYRAKWNLPADYPMVAPNYAEQRR 122

Query: 129 KLAKNMGLGRGRKK 142
            LAK +GLG  R++
Sbjct: 123 NLAKKIGLGTKRRR 136


>gi|114570088|ref|YP_756768.1| MucR family transcriptional regulator [Maricaulis maris MCS10]
 gi|114340550|gb|ABI65830.1| transcriptional regulator, MucR family [Maricaulis maris MCS10]
          Length = 140

 Score =  129 bits (323), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 91/132 (68%), Gaps = 6/132 (4%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE-RLKPAVP 69
           E  L MT D+VA+Y+S++ +P  ++  LI  VH+ ++ V      +   +PE + KPAV 
Sbjct: 12  EELLRMTTDVVASYLSHNSMPADNVPDLIRSVHATMKEV-----SESEAKPEPKTKPAVA 66

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           + KS+ +  + CLEDG + K LKR+L++ +NM+PD+YR KWNL SDYPMV+  Y+  RS+
Sbjct: 67  LSKSVADDYIVCLEDGKKLKMLKRYLRSQYNMSPDDYRRKWNLPSDYPMVAPAYSRKRSQ 126

Query: 130 LAKNMGLGRGRK 141
            AK++GLGRG+K
Sbjct: 127 FAKDIGLGRGKK 138


>gi|49474020|ref|YP_032062.1| Ros/MucR family transcriptional regulator [Bartonella quintana str.
           Toulouse]
 gi|49239523|emb|CAF25880.1| Transcriptional regulatory protein, ros/mucR family [Bartonella
           quintana str. Toulouse]
          Length = 145

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   + +  DIVAAYVSN+ +   ++ SLITDVH+A ++  +    +  V+ E+ +PAV 
Sbjct: 11  SNLVITLVADIVAAYVSNNSIRPTEVPSLITDVHAAFRKAGNVELTE--VEVEKQRPAVN 68

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            ++SI    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV+  YA  RS 
Sbjct: 69  PKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMVAPNYAKARSA 128

Query: 130 LAKNMGLGRGRKKR 143
           LAK MGLGR  K++
Sbjct: 129 LAKEMGLGRKSKRK 142


>gi|163867901|ref|YP_001609105.1| transcriptional regulator [Bartonella tribocorum CIP 105476]
 gi|161017552|emb|CAK01110.1| transcriptional regulator [Bartonella tribocorum CIP 105476]
          Length = 145

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 89/134 (66%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   + +  DIVAAYVSN+ +   ++ SLI DVH+A ++  +    +  V+ E+ +PAV 
Sbjct: 11  SNLVITLVADIVAAYVSNNSIRPTEVPSLIADVHAAFRKAGNLELTE--VEVEKQRPAVN 68

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            ++S+    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV+  YA TRS 
Sbjct: 69  PKRSVFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMVAPNYAKTRSA 128

Query: 130 LAKNMGLGRGRKKR 143
           LAK MGLGR  K++
Sbjct: 129 LAKEMGLGRKSKRK 142


>gi|158421862|ref|YP_001523154.1| putative transcriptional regulator [Azorhizobium caulinodans ORS
           571]
 gi|158328751|dbj|BAF86236.1| putative transcriptional regulator [Azorhizobium caulinodans ORS
           571]
          Length = 157

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 93/140 (66%), Gaps = 5/140 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MDD    DS++   E    IV+A+V+++ +  A++ +LI  VH+ L  +  + P +    
Sbjct: 1   MDDQ---DSNDFLAENAAQIVSAFVAHNSISAAELPNLIQTVHATLAALTGQKPVE--AA 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P++L PAV +++SI    + CLEDG++FKSLKRHL + + +TPDEYR KW+L  DYPMV+
Sbjct: 56  PKQLVPAVSVKRSITPDYIICLEDGLKFKSLKRHLMSKYGLTPDEYRKKWDLPYDYPMVA 115

Query: 121 REYATTRSKLAKNMGLGRGR 140
             YA TRS +AK +GLGR +
Sbjct: 116 PNYALTRSAMAKEIGLGRAK 135


>gi|220927140|ref|YP_002502442.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219951747|gb|ACL62139.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 133

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/139 (49%), Positives = 90/139 (64%), Gaps = 9/139 (6%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D D   D     +E   DIVAAYVSN+ VP+A++  LI+ VH++L R+  R P     +P
Sbjct: 3   DQDQEID----LIERATDIVAAYVSNNSVPVAELPGLISAVHTSLMRL--RTPAA--AEP 54

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           E+  P +PI+K+I    L  LEDG Q+KSLKRHL T   +TP++YR KW L  DYPMV+ 
Sbjct: 55  EKPVPLMPIKKTITPDYLISLEDGRQYKSLKRHLSTR-GLTPEQYRQKWGLPHDYPMVAA 113

Query: 122 EYATTRSKLAKNMGLGRGR 140
            YA  RS+LAK+ GLGR R
Sbjct: 114 NYAAQRSELAKSSGLGRRR 132


>gi|16519897|ref|NP_444017.1| conserved transcriptional regulator, MucR-family [Sinorhizobium
           fredii NGR234]
 gi|2497994|sp|P55613|Y4PD_RHISN RecName: Full=Putative mucR family transcriptional regulatory
           protein y4pD
 gi|2182573|gb|AAB91814.1| conserved transcriptional regulator, MucR-family [Sinorhizobium
           fredii NGR234]
          Length = 171

 Score =  128 bits (322), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 88/134 (65%), Gaps = 1/134 (0%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
             S +R LE+T  +V+AY+S ++VP AD+ SLI   + +L    S+A   +    E  +P
Sbjct: 6   LASGQRNLELTSRVVSAYLSRNIVPAADLASLIQQTYLSLCST-SQADKAEEAAVEEQRP 64

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AVPI+KS+    + CLEDG +FKSLKRHL   + +TP +YR KW L +DYPMV+  YA  
Sbjct: 65  AVPIKKSVTADFIICLEDGKKFKSLKRHLMAKYGLTPQQYREKWGLPADYPMVASSYAQK 124

Query: 127 RSKLAKNMGLGRGR 140
           RS+LA+ +GLG+ R
Sbjct: 125 RSELARALGLGKKR 138


>gi|240850108|ref|YP_002971501.1| transcriptional regulator, Ros/MucR family [Bartonella grahamii
           as4aup]
 gi|240267231|gb|ACS50819.1| transcriptional regulator, Ros/MucR family [Bartonella grahamii
           as4aup]
          Length = 145

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 89/134 (66%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   + +  DIVAAYVSN+ +   ++ SLI DVH+A ++  +    +  V+ E+ +PAV 
Sbjct: 11  SNLVITLVADIVAAYVSNNSIRPTEVPSLIADVHAAFRKAGNLELTE--VEVEKQRPAVN 68

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            ++S+    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV+  YA TRS 
Sbjct: 69  PKRSVFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMVAPNYAKTRSA 128

Query: 130 LAKNMGLGRGRKKR 143
           LAK MGLGR  K++
Sbjct: 129 LAKEMGLGRKSKRK 142


>gi|319403876|emb|CBI77462.1| transcriptional regulator [Bartonella rochalimae ATCC BAA-1498]
          Length = 145

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 87/134 (64%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   + +  DIVAAYVSN+ +   ++ SLI DVH+A  +  S    +  V+ E+ +PAV 
Sbjct: 11  SNLVITLVADIVAAYVSNNSIRPVEVPSLIADVHAAFLKAGSMTLAE--VEVEKQRPAVN 68

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            ++SI    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV+  YA  RS 
Sbjct: 69  PKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMVAPNYAKARSA 128

Query: 130 LAKNMGLGRGRKKR 143
           LAK MGLGR  +K+
Sbjct: 129 LAKEMGLGRKSEKK 142


>gi|288956890|ref|YP_003447231.1| transcriptional regulatory protein [Azospirillum sp. B510]
 gi|288909198|dbj|BAI70687.1| transcriptional regulatory protein [Azospirillum sp. B510]
          Length = 137

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 66/133 (49%), Positives = 88/133 (66%), Gaps = 5/133 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   L +T +IVAA+VSN+ V + D+ +LI  V+ +L  V      +  V  ER +PAVP
Sbjct: 7   SNALLSLTTEIVAAHVSNNTVALTDLPTLIEQVYKSLANVG----VEPVVAEERPQPAVP 62

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           I+KS+    + CLEDG + K LKRHLKT +NMTP+EYR +W L +DYPMV+  YA  RS 
Sbjct: 63  IKKSVTPDYIVCLEDGKKLKMLKRHLKTAYNMTPEEYRDRWGLPTDYPMVAPNYARQRSS 122

Query: 130 LAKNMGLG-RGRK 141
           LAK +GLG R R+
Sbjct: 123 LAKQIGLGTRARR 135


>gi|220926349|ref|YP_002501651.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219950956|gb|ACL61348.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 166

 Score =  127 bits (320), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 87/131 (66%), Gaps = 5/131 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E T DIV+AYVSN+ VP +++  LI  VH +L ++V  AP +   +PE+L P VPI+K
Sbjct: 12  LIEFTADIVSAYVSNNSVPASEVAGLIGSVHGSLMQLV--APAEP--EPEKLTPPVPIKK 67

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           ++    +  LEDG  +K+LKRHL     +TP++YR KW L  DYPMV+  YA  RS+LAK
Sbjct: 68  TVTPDHIISLEDGKPYKTLKRHL-AGRGLTPEQYRQKWGLPPDYPMVAANYAAQRSELAK 126

Query: 133 NMGLGRGRKKR 143
             GLG+ R+ R
Sbjct: 127 TSGLGQSRRMR 137


>gi|16263391|ref|NP_436184.1| MUCR family transcriptional regulatory protein IN SYRB 5'region
           [Sinorhizobium meliloti 1021]
 gi|307308344|ref|ZP_07588049.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
 gi|307320903|ref|ZP_07600312.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           AK83]
 gi|14524078|gb|AAK65596.1| Transcriptional regulator, MucR family [Sinorhizobium meliloti
           1021]
 gi|306893501|gb|EFN24278.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           AK83]
 gi|306901145|gb|EFN31752.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
          Length = 138

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 63/132 (47%), Positives = 87/132 (65%), Gaps = 2/132 (1%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+ R LE+T  IV+AY+S +V+   ++  LI   + +L    +  P +     E  +PAV
Sbjct: 6   SNGRRLELTSRIVSAYLSRNVIAPDELPYLIQQTYGSLNE--TSGPGETPPAVEEQRPAV 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI+KS+ +  + CLEDG +FKSLKRHL T + MTPD+YR KW L S+YPM +R YA  RS
Sbjct: 64  PIKKSVTDDFIVCLEDGKKFKSLKRHLTTKYGMTPDQYREKWKLPSEYPMTARNYALQRS 123

Query: 129 KLAKNMGLGRGR 140
           KLA+ MGLG+ R
Sbjct: 124 KLARAMGLGKSR 135


>gi|326386710|ref|ZP_08208331.1| MucR family transcriptional regulator [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208763|gb|EGD59559.1| MucR family transcriptional regulator [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 146

 Score =  127 bits (319), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 64/131 (48%), Positives = 90/131 (68%), Gaps = 4/131 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           D  E  + +T DIVAA+VSN+ V + D+  LI++V++AL  +    P +  V+P   +PA
Sbjct: 7   DLRETLITLTSDIVAAHVSNNSVSVGDLPLLISNVYTALAGL---KPAEAAVEPTP-EPA 62

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V IR S++N  + CLEDG + K LKRHL T +NMTP++YR +WNL +DYPMV+  YA  R
Sbjct: 63  VSIRASVKNDHIICLEDGKKLKMLKRHLATRYNMTPEQYRARWNLPADYPMVAPAYAEKR 122

Query: 128 SKLAKNMGLGR 138
            +LAK +GLGR
Sbjct: 123 RELAKKIGLGR 133


>gi|197105139|ref|YP_002130516.1| transcriptional regulator [Phenylobacterium zucineum HLK1]
 gi|196478559|gb|ACG78087.1| transcriptional regulator [Phenylobacterium zucineum HLK1]
          Length = 150

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 89/140 (63%), Gaps = 2/140 (1%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D+   S E  L +   IVAAYVS + V    +  +I  VH  L+++ +R P     + ER
Sbjct: 12  DSGAPSGEDILRLGAGIVAAYVSRNAVSAEQVPDIIRTVHQTLEQL-TRGPSAPTPE-ER 69

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            KPAVPI +S+++  + CLEDG + K LKR+L++ +NM+PDEYR +W L  DYPMV+  Y
Sbjct: 70  PKPAVPIGRSVQHDYIVCLEDGKKLKMLKRYLRSRYNMSPDEYRRRWGLPPDYPMVAPAY 129

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           A  RS  AK +GLGRG ++R
Sbjct: 130 AARRSDFAKKIGLGRGVRRR 149


>gi|7388546|sp|O33682|Y4338_RHIME RecName: Full=Putative mucR family transcriptional regulatory
           protein RA0938
 gi|2270982|gb|AAB63671.1| orf2 [Sinorhizobium meliloti]
          Length = 163

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 63/132 (47%), Positives = 87/132 (65%), Gaps = 2/132 (1%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+ R LE+T  IV+AY+S +V+   ++  LI   + +L    +  P +     E  +PAV
Sbjct: 31  SNGRRLELTSRIVSAYLSRNVIAPDELPYLIQQTYGSLNE--TSGPGETPPAVEEQRPAV 88

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI+KS+ +  + CLEDG +FKSLKRHL T + MTPD+YR KW L S+YPM +R YA  RS
Sbjct: 89  PIKKSVTDDFIVCLEDGKKFKSLKRHLTTKYGMTPDQYREKWKLPSEYPMTARNYALQRS 148

Query: 129 KLAKNMGLGRGR 140
           KLA+ MGLG+ R
Sbjct: 149 KLARAMGLGKSR 160


>gi|296116411|ref|ZP_06835025.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977004|gb|EFG83768.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 154

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 89/135 (65%), Gaps = 7/135 (5%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           DA  D S  FLE+T  IV+A+VSN+ V    +  LI  V+ AL  +      Q  V+PE+
Sbjct: 3   DAEQDFS--FLELTTQIVSAHVSNNAVGADTVPDLIKQVYQALTSL-----DQPQVEPEK 55

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           L+PAVPI++S+    + CLEDG + K LKRHL++ + MTP++YR +W L SDYPMV+  Y
Sbjct: 56  LQPAVPIKRSVFPDYIVCLEDGKKLKMLKRHLQSAYGMTPEQYRERWGLPSDYPMVAPNY 115

Query: 124 ATTRSKLAKNMGLGR 138
           A  RS LA+ +GLGR
Sbjct: 116 AERRSTLAREIGLGR 130


>gi|329888153|ref|ZP_08266751.1| transcriptional regulatory protein ros [Brevundimonas diminuta ATCC
           11568]
 gi|328846709|gb|EGF96271.1| transcriptional regulatory protein ros [Brevundimonas diminuta ATCC
           11568]
          Length = 142

 Score =  127 bits (318), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/136 (52%), Positives = 91/136 (66%), Gaps = 3/136 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            LEMT DIV+AYVSN+ V    +  LI  +H+AL  V   +      +PE  +PAVP+RK
Sbjct: 9   LLEMTADIVSAYVSNNTVSADAVPGLIAQIHAALSGV---SVAPVEPEPEPQEPAVPVRK 65

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L CLEDG +FKSLKRHL+T +NM+P+EYR KW L  DYPMV+  YA  RS+LAK
Sbjct: 66  SITPDFLICLEDGRKFKSLKRHLRTKYNMSPEEYRAKWGLPKDYPMVAPNYAKARSELAK 125

Query: 133 NMGLGRGRKKRVLTSK 148
            MGLG+G +K    S+
Sbjct: 126 QMGLGQGGRKPARASR 141


>gi|319898550|ref|YP_004158643.1| transcriptional regulator [Bartonella clarridgeiae 73]
 gi|319402514|emb|CBI76057.1| transcriptional regulator [Bartonella clarridgeiae 73]
          Length = 145

 Score =  127 bits (318), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 89/136 (65%), Gaps = 3/136 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   + +  DIVAAYVSN+ +  A++ +LI DVH+A  +  +    +  V+ E+ +PAV 
Sbjct: 11  SNLVITLVADIVAAYVSNNSIRPAEVPNLIADVHAAFLKAGNMTLAE--VEVEKQRPAVN 68

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            ++SI    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV+  YA  RS 
Sbjct: 69  PKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMVAPNYAKARSA 128

Query: 130 LAKNMGLGR-GRKKRV 144
           LAK MGLGR   KKR+
Sbjct: 129 LAKEMGLGRKSEKKRI 144


>gi|148555299|ref|YP_001262881.1| MucR family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148500489|gb|ABQ68743.1| transcriptional regulator, MucR family [Sphingomonas wittichii RW1]
          Length = 137

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 91/136 (66%), Gaps = 8/136 (5%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV-QPE-RLKPA 67
           +E  + +T DIV+A+VSN+ V ++D+  LI +VH+AL      A   D V +PE + +PA
Sbjct: 8   TETLIALTADIVSAHVSNNSVAVSDLPLLIQNVHNAL------ASLGDEVAEPEVKQEPA 61

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V IR SI+   + CLEDG + K LKRHL TH+ MTP++YR KWNL +DYPMV+  YA  R
Sbjct: 62  VSIRASIKPDYIVCLEDGKKLKMLKRHLMTHYQMTPEQYRAKWNLPADYPMVAPNYAEQR 121

Query: 128 SKLAKNMGLGRGRKKR 143
             LAK +GLG  R+ R
Sbjct: 122 RSLAKKIGLGTKRRTR 137


>gi|49475258|ref|YP_033299.1| Ros/MucR family transcriptional regulator [Bartonella henselae str.
           Houston-1]
 gi|49238063|emb|CAF27270.1| Transcriptional regulatory protein, ros/mucR family [Bartonella
           henselae str. Houston-1]
          Length = 145

 Score =  126 bits (317), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (65%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   + +  DIVAAYVSN+ +   ++ SLI DVH+A ++  +    +  V+ E+ +PAV 
Sbjct: 11  SNLVITLVADIVAAYVSNNSIRPTEVPSLIADVHAAFRKAGNADLTE--VEVEKQRPAVN 68

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            ++SI    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV+  YA  RS 
Sbjct: 69  PKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMVAPNYAKARSA 128

Query: 130 LAKNMGLGRGRKKR 143
           LAK MGLGR  K++
Sbjct: 129 LAKEMGLGRKSKRK 142


>gi|144899557|emb|CAM76421.1| transcriptional regulator, ROS/MUCR family [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 140

 Score =  126 bits (317), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 65/131 (49%), Positives = 88/131 (67%), Gaps = 5/131 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            L +T +IVAA+V+N+ V +AD+  LI +V+  L  V S AP      PER +PAV ++K
Sbjct: 10  LLSLTTEIVAAHVANNSVAVADLPQLINEVYRTLASVGS-APSA----PERPQPAVAVKK 64

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG + K LKRHLKT +NM+P+EYR +W L +DYPMV+  YA  RS LAK
Sbjct: 65  SVNPDYIICLEDGKKLKMLKRHLKTAYNMSPEEYRDRWGLPADYPMVAPNYAAHRSSLAK 124

Query: 133 NMGLGRGRKKR 143
            +GLG   +KR
Sbjct: 125 KIGLGTKPRKR 135


>gi|167645322|ref|YP_001682985.1| MucR family transcriptional regulator [Caulobacter sp. K31]
 gi|167347752|gb|ABZ70487.1| transcriptional regulator, MucR family [Caulobacter sp. K31]
          Length = 141

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 84/136 (61%), Gaps = 3/136 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            D     +E+T  +VAAYV  + +   DI  LI  VH +L  +  RA        E   P
Sbjct: 1   MDEQSDLIEVTASLVAAYVGGNTIAATDIPGLIRSVHKSLANLDGRAEASAEANRE---P 57

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AV +++SI    L CLEDG +FKSLKRHL+T ++++P++YR +W+L  DYPMV+  YA  
Sbjct: 58  AVSVKRSITPDYLICLEDGRKFKSLKRHLRTKYDLSPEQYRTRWDLPKDYPMVAPNYALA 117

Query: 127 RSKLAKNMGLGRGRKK 142
           RS LAK MGLG+G +K
Sbjct: 118 RSNLAKQMGLGQGGRK 133


>gi|148550645|ref|YP_001260084.1| MucR family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148503064|gb|ABQ71317.1| transcriptional regulator, MucR family [Sphingomonas wittichii RW1]
          Length = 183

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 92/142 (64%), Gaps = 8/142 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D +  DS+   + +T DIVAA+V+N+ V +AD+ SLI +VH AL  +      +    
Sbjct: 20  MSDVSENDST--LITLTADIVAAHVTNNSVAVADLPSLIQNVHGALSNL-----GKSETA 72

Query: 61  PE-RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           PE + +PAV +R S++   + CLEDG + K LKRHL TH+ MTP +YR KWNL +DYPMV
Sbjct: 73  PETKQEPAVSVRASVKPDYIVCLEDGKKLKMLKRHLMTHYQMTPADYRSKWNLPADYPMV 132

Query: 120 SREYATTRSKLAKNMGLGRGRK 141
           +  YA  R  LAK++GLGR  K
Sbjct: 133 APNYAEQRRTLAKSIGLGRKPK 154


>gi|319406886|emb|CBI80521.1| transcriptional regulator [Bartonella sp. 1-1C]
          Length = 145

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 85/134 (63%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   + +  DIVAAYVSN+ +   ++  LI DVH+A  +  S    +  V+ +R  PAV 
Sbjct: 11  SNLVITLVADIVAAYVSNNSIRPVEVPGLIADVHAAFLKAGSMTLAEIEVEKQR--PAVN 68

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            ++SI    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV+  YA  RS 
Sbjct: 69  PKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMVAPNYAKARSA 128

Query: 130 LAKNMGLGRGRKKR 143
           LAK MGLGR  +K+
Sbjct: 129 LAKEMGLGRKSEKK 142


>gi|209965886|ref|YP_002298801.1| transcriptional regulatory protein MucR [Rhodospirillum centenum
           SW]
 gi|209959352|gb|ACI99988.1| transcriptional regulatory protein MucR [Rhodospirillum centenum
           SW]
          Length = 139

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 67/138 (48%), Positives = 91/138 (65%), Gaps = 7/138 (5%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV-QPERL 64
           S   S   L +T +IVAA+VSN+ V ++D+ SLI  V+  L  V      Q+ V Q E+ 
Sbjct: 3   SASPSNELLSLTTEIVAAHVSNNTVAISDLPSLIEQVYRTLSTV-----GQEPVPQAEKP 57

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAV I+KS+    + CLEDG + K LKRHLKT +NM+P+EYR +W L +DYPMV+  YA
Sbjct: 58  QPAVAIKKSVTPDYIVCLEDGKKLKMLKRHLKTAYNMSPEEYRDRWGLPADYPMVAPNYA 117

Query: 125 TTRSKLAKNMGLG-RGRK 141
             RS+LAK +GLG R R+
Sbjct: 118 KQRSRLAKQIGLGTRARR 135


>gi|170743649|ref|YP_001772304.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197923|gb|ACA19870.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 143

 Score =  126 bits (316), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/134 (47%), Positives = 86/134 (64%), Gaps = 5/134 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +E+T  I+AAYVS +  P+ D+  LI  VH AL ++ S  P +   +P  L P +PI+K+
Sbjct: 14  VELTAAIIAAYVSKNATPVGDLPGLIASVHDALNQL-SAPPAE---EPAPLTPLMPIKKT 69

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    +  LEDG Q+KSLKRHL T   +TPDEYR KW L  DYPMV+  YA  RS+LAK 
Sbjct: 70  VTPDYIVSLEDGRQYKSLKRHLGTR-GLTPDEYRRKWGLPPDYPMVAANYAAKRSELAKA 128

Query: 134 MGLGRGRKKRVLTS 147
            GLG+GR  +  T+
Sbjct: 129 SGLGQGRGGKARTA 142


>gi|23014654|ref|ZP_00054459.1| hypothetical protein Magn03009102 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 151

 Score =  125 bits (315), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 63/137 (45%), Positives = 83/137 (60%), Gaps = 5/137 (3%)

Query: 4   DASFDSSER--FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D + D + R   L M VD+VAAYV  + VP   +  LI  V+ +L  +      Q   + 
Sbjct: 3   DINSDKTNRDDLLRMAVDVVAAYVGKNPVPAGQLPELINTVYGSLSSLEG---GQPEAKS 59

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           E  KPA+ ++KS+    + CLEDG + K LKRHL+T +NMTPDEYR+KW L  DYPMV+ 
Sbjct: 60  EAPKPAIAVKKSVTPDYIICLEDGKKLKMLKRHLRTTYNMTPDEYRVKWGLPPDYPMVAP 119

Query: 122 EYATTRSKLAKNMGLGR 138
            YA  RS  AK +GLGR
Sbjct: 120 NYAAQRSDFAKKIGLGR 136


>gi|162148931|ref|YP_001603392.1| transcriptional regulator protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209545313|ref|YP_002277542.1| MucR family transcriptional regulator [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787508|emb|CAP57104.1| putative transcriptional regulator protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532990|gb|ACI52927.1| transcriptional regulator, MucR family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 158

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 85/126 (67%), Gaps = 5/126 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           FLE+T  IV+A+VSN+ V    +  LI  V+ AL  +   AP     +PE+L+PAVPI++
Sbjct: 10  FLELTAQIVSAHVSNNTVVADSVPDLIRQVYQALASLGQVAP-----EPEKLQPAVPIKR 64

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG + K LKRHL++ + MTP++YR +W L SDYPMV+  YA  RS LA+
Sbjct: 65  SVFPDYIVCLEDGKKLKMLKRHLQSAYGMTPEQYRERWGLPSDYPMVAPNYAERRSTLAR 124

Query: 133 NMGLGR 138
            +GLGR
Sbjct: 125 EIGLGR 130


>gi|118593320|ref|ZP_01550704.1| transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118593403|ref|ZP_01550787.1| transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118433998|gb|EAV40655.1| transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118434081|gb|EAV40738.1| transcriptional regulator [Stappia aggregata IAM 12614]
          Length = 144

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 91/139 (65%), Gaps = 5/139 (3%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D+  ++S   + +T DIV AYVSN++V   ++  LI  VH AL    +     +  + ER
Sbjct: 3   DSPVETS--LINLTSDIVTAYVSNNMVTTTELTDLIGSVHQALHAAAA---VAEEPEEER 57

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           L PAVPI+KS++   + CLEDG +FKSLKRHL+  +N+TP+EYR KW L  DYPMV+  Y
Sbjct: 58  LIPAVPIKKSVQPDYIVCLEDGKRFKSLKRHLRAAYNLTPEEYRGKWGLKEDYPMVAPNY 117

Query: 124 ATTRSKLAKNMGLGRGRKK 142
           A  RS+LA  +GLGR  K+
Sbjct: 118 AAARSELAIELGLGRKYKR 136


>gi|149186792|ref|ZP_01865103.1| predicted transcriptional regulator [Erythrobacter sp. SD-21]
 gi|148829700|gb|EDL48140.1| predicted transcriptional regulator [Erythrobacter sp. SD-21]
          Length = 146

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 66/142 (46%), Positives = 93/142 (65%), Gaps = 10/142 (7%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           D +E  + +T DIVAA+VSN+ V + D+ +LI++V+SAL  +      +++    R  PA
Sbjct: 7   DMTETLITLTSDIVAAHVSNNSVAVDDVPTLISNVYSALSGLGGTGVAEES----RPDPA 62

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V +R S++   + CL+ G + K LKRHL T H+MTPD+YR +W L SDYPMV+ EYA TR
Sbjct: 63  VSVRASVKKDHIICLDCGKKMKMLKRHLSTEHDMTPDDYRQRWELPSDYPMVAPEYADTR 122

Query: 128 SKLAKNMGLG------RGRKKR 143
             LAK +GLG      RGRKK+
Sbjct: 123 RDLAKKIGLGRKPGQKRGRKKK 144


>gi|295690704|ref|YP_003594397.1| MucR family transcriptional regulator [Caulobacter segnis ATCC
           21756]
 gi|295432607|gb|ADG11779.1| transcriptional regulator, MucR family [Caulobacter segnis ATCC
           21756]
          Length = 139

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 70/130 (53%), Positives = 86/130 (66%), Gaps = 3/130 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +EMT  IV+AYV N+VV  AD+ +LI  VH AL  V S A        E    AVPI++
Sbjct: 7   LIEMTAGIVSAYVGNNVVATADLPALIKQVHQALATVGSPAAEPPAPPKEP---AVPIKR 63

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L CLEDG +FKSLKRHL+T ++MTP++YR KW L  DYPMV+  YA  RS LAK
Sbjct: 64  SITPDYLICLEDGRKFKSLKRHLRTKYDMTPEDYRAKWGLPKDYPMVAPNYAEARSNLAK 123

Query: 133 NMGLGRGRKK 142
            MGLG+G +K
Sbjct: 124 QMGLGQGGRK 133


>gi|154253347|ref|YP_001414171.1| MucR family transcriptional regulator [Parvibaculum lavamentivorans
           DS-1]
 gi|154157297|gb|ABS64514.1| transcriptional regulator, MucR family [Parvibaculum
           lavamentivorans DS-1]
          Length = 168

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/145 (44%), Positives = 90/145 (62%), Gaps = 12/145 (8%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S D++E  L +  +IVAAYVSN+ +   DI  +I  VHS L  +      ++      L 
Sbjct: 29  SGDTTE-ILRLATEIVAAYVSNNAIAANDIAGMIRAVHSTLSDLGQGVSAKE----ADLA 83

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVP++KS+ +  + CLEDG + K LKR+L++   +TP+EYR +WNL  DYPMV+  YA 
Sbjct: 84  PAVPVKKSVTSDYIVCLEDGKKLKMLKRYLRSQFGLTPEEYRARWNLPHDYPMVAPNYAA 143

Query: 126 TRSKLAKNMGLG-------RGRKKR 143
            RSKLAK +GLG       RGRKK+
Sbjct: 144 QRSKLAKQIGLGRVGTAPARGRKKK 168


>gi|323135887|ref|ZP_08070970.1| transcriptional regulator, MucR family [Methylocystis sp. ATCC
           49242]
 gi|322398978|gb|EFY01497.1| transcriptional regulator, MucR family [Methylocystis sp. ATCC
           49242]
          Length = 135

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 90/130 (69%), Gaps = 3/130 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +++  DIV+AYVSN+ VP AD+ +LI++V++AL RV S         P+    A+ ++KS
Sbjct: 7   IQLAADIVSAYVSNNSVPAADLPALISEVYNALLRVGSSVVAAPAEPPKP---AIAVKKS 63

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    + CLEDG +FKSLKRHL+T + ++P+EYR KW L  DYPMV+  YA  RS LAK 
Sbjct: 64  VTTDYIICLEDGKKFKSLKRHLRTQYGLSPEEYREKWGLPPDYPMVAPNYAKARSNLAKQ 123

Query: 134 MGLGRGRKKR 143
           MGLG+ R++R
Sbjct: 124 MGLGQQRRRR 133


>gi|323138397|ref|ZP_08073467.1| transcriptional regulator, MucR family [Methylocystis sp. ATCC
           49242]
 gi|322396344|gb|EFX98875.1| transcriptional regulator, MucR family [Methylocystis sp. ATCC
           49242]
          Length = 148

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 89/138 (64%), Gaps = 2/138 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M DD   + +   +E    IV+AYVSN+ VP +D+ +L+  VH+AL  + SR        
Sbjct: 1   MSDDKQPEHAAN-IEHVAGIVSAYVSNNSVPASDLPALLQSVHAALVGL-SRGASVVGEA 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
               +PAVPI+KS+    + CLEDG +FKSLKRHL++ ++MTP+EYR KW L  DYPMV+
Sbjct: 59  AVAKEPAVPIKKSVTPDFIICLEDGKKFKSLKRHLRSSYSMTPEEYRAKWGLPPDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGR 138
             YA  RS+LA  MGLG+
Sbjct: 119 PNYAQRRSELAMTMGLGK 136


>gi|209964646|ref|YP_002297561.1| transcriptional regulatory protein MucR [Rhodospirillum centenum
           SW]
 gi|209958112|gb|ACI98748.1| transcriptional regulatory protein MucR [Rhodospirillum centenum
           SW]
          Length = 147

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 60/126 (47%), Positives = 79/126 (62%), Gaps = 3/126 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            L MT +IV+AYV  + +P   I  +I  V+S+L  +          Q E  +PAVPI+K
Sbjct: 14  LLRMTAEIVSAYVGKNTLPTQQIPEVINTVYSSLNGLQG---AGRETQAEPPRPAVPIKK 70

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG + K LKRHL++ +NMTPDEYR+KW L  DYPMV+  YA  RS  AK
Sbjct: 71  SVTPEYIVCLEDGKKLKMLKRHLRSTYNMTPDEYRVKWGLPPDYPMVAPNYAAQRSDFAK 130

Query: 133 NMGLGR 138
            +GLGR
Sbjct: 131 KIGLGR 136


>gi|319405313|emb|CBI78927.1| transcriptional regulator [Bartonella sp. AR 15-3]
          Length = 145

 Score =  124 bits (312), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 65/134 (48%), Positives = 87/134 (64%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   + +  DIVAAYVSN+ +  A++ SLI DVH+A  +  +    +  V+ E+ +PAV 
Sbjct: 11  SNLVITLVADIVAAYVSNNSIRPAEVPSLIADVHAAFLKAGNMTLAE--VEVEKQRPAVN 68

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            ++SI    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV+  YA  RS 
Sbjct: 69  PKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMVAPNYAKARSA 128

Query: 130 LAKNMGLGRGRKKR 143
           LAK MGLG   +++
Sbjct: 129 LAKEMGLGHKSERK 142


>gi|150378298|ref|YP_001314892.1| MucR family transcriptional regulator [Sinorhizobium medicae
           WSM419]
 gi|150032845|gb|ABR64959.1| transcriptional regulator, MucR family [Sinorhizobium medicae
           WSM419]
          Length = 137

 Score =  124 bits (312), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 88/137 (64%), Gaps = 2/137 (1%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           ++   ++ER LE+T  IVAAY+S + VP  D+  LI   +S+L     R   +  V+ +R
Sbjct: 3   ESGLSNAERKLELTSRIVAAYLSRNAVPAGDLPDLIQQTYSSLSGTSPRHQAEPAVEEQR 62

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             PA+P++KS+    + CLEDG +FKSL+RHL   + +TP++YR KW L  DYPM++  Y
Sbjct: 63  --PAIPLKKSVTVDFIICLEDGEKFKSLRRHLMAKYGLTPEQYREKWGLPDDYPMIAPSY 120

Query: 124 ATTRSKLAKNMGLGRGR 140
           A  RS+LA+  GLG+ R
Sbjct: 121 ARQRSELARASGLGKKR 137


>gi|85374523|ref|YP_458585.1| transcriptional regulator [Erythrobacter litoralis HTCC2594]
 gi|84787606|gb|ABC63788.1| predicted transcriptional regulator [Erythrobacter litoralis
           HTCC2594]
          Length = 146

 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 92/142 (64%), Gaps = 10/142 (7%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           D SE  + +T DIVAA+VSN+ V + D+ +LIT V+ AL  +  +    + V+P+   PA
Sbjct: 7   DMSEALITLTSDIVAAHVSNNNVTVEDVPALITSVYGALSGL-GKDEAAEEVRPD---PA 62

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V IR S++   + CL+ G + K LKRHL T H MT DEY+ +WNL +DYPMV+ +YA TR
Sbjct: 63  VSIRASVKKDHIVCLDCGKKMKMLKRHLMTEHGMTIDEYKARWNLGADYPMVAPDYAETR 122

Query: 128 SKLAKNMGLG------RGRKKR 143
             LAK +GLG      RGRKK+
Sbjct: 123 RTLAKKIGLGRKPGQKRGRKKK 144


>gi|83311436|ref|YP_421700.1| transcriptional regulator [Magnetospirillum magneticum AMB-1]
 gi|82946277|dbj|BAE51141.1| Predicted transcriptional regulator [Magnetospirillum magneticum
           AMB-1]
          Length = 151

 Score =  124 bits (310), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 83/137 (60%), Gaps = 5/137 (3%)

Query: 4   DASFDSSER--FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D + D + R   L M VD+VAAYV  + VP   +  LI  V+ +L  +      Q   + 
Sbjct: 3   DINSDKTNRDDLLRMAVDVVAAYVGKNPVPAGQLPELINTVYGSLSSLEG---GQPEAKS 59

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           E  KPA+ +++S+    + CLEDG + K LKRHL+T +NMTPDEYR+KW L  DYPMV+ 
Sbjct: 60  EAPKPAIAVKRSVTPDYIICLEDGKKLKMLKRHLRTTYNMTPDEYRMKWGLPPDYPMVAP 119

Query: 122 EYATTRSKLAKNMGLGR 138
            YA  RS  AK +GLGR
Sbjct: 120 NYAAQRSDFAKKIGLGR 136


>gi|23015409|ref|ZP_00055186.1| hypothetical protein Magn03009849 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 139

 Score =  124 bits (310), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 66/135 (48%), Positives = 90/135 (66%), Gaps = 5/135 (3%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           +S   L +T +IVAA+V+N+ V +AD+  LI +V+  L  V S AP      PER +PAV
Sbjct: 6   NSGDLLGLTTEIVAAHVANNSVAVADLPHLIQEVYRTLASVGS-APAA----PERPQPAV 60

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            ++KS+    + CLEDG + K LKRHLKT +NM+P+EYR +W L +DYPMV+  YA  RS
Sbjct: 61  NVKKSVTPDYIICLEDGKKLKMLKRHLKTAYNMSPEEYRDRWGLPADYPMVAPNYAQHRS 120

Query: 129 KLAKNMGLGRGRKKR 143
            LAK +GLG   +KR
Sbjct: 121 SLAKKIGLGTKPRKR 135


>gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competitiveness
           determinant [Mesorhizobium loti MAFF303099]
 gi|14021882|dbj|BAB48493.1| transcriptional regulatory protein, nodulation competitiveness
           determinant [Mesorhizobium loti MAFF303099]
          Length = 151

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 82/129 (63%), Gaps = 4/129 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S    E+T DIV+AYVSN+ +P++ +  +I  VH++L  + +  P     Q     PAV 
Sbjct: 9   SAELAELTADIVSAYVSNNPLPVSGLPDVIASVHASLSGLGTPIPPVAEPQ----TPAVN 64

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +KS+    + CLEDG +FKSLKRHL T   +TPD YR KWNL  DYPM +  YA  RS+
Sbjct: 65  PKKSVTPDFIICLEDGKKFKSLKRHLSTDFGLTPDAYRAKWNLPHDYPMTAPNYAAQRSQ 124

Query: 130 LAKNMGLGR 138
           LAK++GLGR
Sbjct: 125 LAKSIGLGR 133


>gi|220921800|ref|YP_002497101.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219946406|gb|ACL56798.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 160

 Score =  123 bits (309), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 63/138 (45%), Positives = 92/138 (66%), Gaps = 6/138 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M  + + D+++ ++ +  DIV+AYV+ + VP + +  L+T VH+AL+ +   A      +
Sbjct: 1   MTAETNLDAAD-YIALASDIVSAYVTRNAVPASSLPELLTSVHAALRDLQKAA----APE 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+L P V IRKS+    +  LEDG Q+KSLKRHL T   +TP+EYR KWNL  DYPMV+
Sbjct: 56  PEKLVPPVSIRKSVTPDYIISLEDGRQYKSLKRHLATR-GLTPEEYRRKWNLPPDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGR 138
             YA  RS+LAK++GLG+
Sbjct: 115 ANYAAQRSELAKSIGLGQ 132


>gi|254293594|ref|YP_003059617.1| MucR family transcriptional regulator [Hirschia baltica ATCC 49814]
 gi|254042125|gb|ACT58920.1| transcriptional regulator, MucR family [Hirschia baltica ATCC
           49814]
          Length = 143

 Score =  123 bits (308), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/129 (45%), Positives = 85/129 (65%), Gaps = 3/129 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            + +  +IV+AYV N+ VP++D+  LI + ++ +  +  R   +        KPAV +RK
Sbjct: 18  LIGVVSEIVSAYVGNNPVPVSDLPGLIENTYNVVSELNGRIVKETKADQ---KPAVSVRK 74

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG +FKSLKRHL+T +NM+P+EYR KW L+ DYPMV+  YA  RS LAK
Sbjct: 75  SLSEDYVICLEDGKKFKSLKRHLRTRYNMSPEEYREKWGLSPDYPMVAPNYAKQRSDLAK 134

Query: 133 NMGLGRGRK 141
            MGLG+ +K
Sbjct: 135 RMGLGQAKK 143


>gi|220926311|ref|YP_002501613.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219950918|gb|ACL61310.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 144

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/125 (48%), Positives = 85/125 (68%), Gaps = 5/125 (4%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +E+  DIV+AYVSN+ VP+ ++  LI  VH A+ R+   AP     QPE+L P VPI+K+
Sbjct: 13  IELVSDIVSAYVSNNSVPVGELAGLIRSVHDAVARL--GAPAAP--QPEKLVPPVPIKKT 68

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    L  LEDG ++++LKRHL     +TP++YR KW L  DYPMV+  YA  RS+LAK+
Sbjct: 69  ITPDYLISLEDGRRYRTLKRHL-AGRGLTPEQYRAKWGLPPDYPMVAANYAAQRSELAKS 127

Query: 134 MGLGR 138
           +GLG+
Sbjct: 128 IGLGQ 132


>gi|170743992|ref|YP_001772647.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168198266|gb|ACA20213.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 145

 Score =  122 bits (307), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/137 (44%), Positives = 90/137 (65%), Gaps = 8/137 (5%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D+   F  S   +E+  DIV+AYVSN+ VP+ ++ +LI  VH A+ ++ + A      QP
Sbjct: 4   DNQTEFPQS---IELVSDIVSAYVSNNSVPVGELAALIRSVHEAVAQLGAPA----APQP 56

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           E+L P VPI+K++    L  LEDG ++++LKRHL     +TP++YR KW L  DYPMV+ 
Sbjct: 57  EKLVPPVPIKKTVTPDYLISLEDGRRYRTLKRHL-AGRGLTPEQYRAKWGLPPDYPMVAA 115

Query: 122 EYATTRSKLAKNMGLGR 138
            YA  RS+LAK++GLG+
Sbjct: 116 NYAAQRSELAKSIGLGQ 132


>gi|144897819|emb|CAM74683.1| Transcriptional regulatory protein [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 181

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/130 (46%), Positives = 84/130 (64%), Gaps = 3/130 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S +  L M VD+V+AYVSN+ +P   I  +I  V+++L   +  AP +   + E  KPA+
Sbjct: 35  SHDDILRMAVDVVSAYVSNNPLPAGQIPEIINTVYNSLA-ALDGAPVE--TKSEAPKPAI 91

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            ++KS+    + CLEDG + K LKRHL+T ++MTPDEYR KW L  DYPMV+  YA  RS
Sbjct: 92  SVKKSVHPDYIVCLEDGKKLKMLKRHLRTTYSMTPDEYRAKWGLPPDYPMVAPNYAAQRS 151

Query: 129 KLAKNMGLGR 138
             AK +GLGR
Sbjct: 152 DFAKKIGLGR 161


>gi|83313558|ref|YP_423822.1| transcriptional regulatory protein Ros [Magnetospirillum magneticum
           AMB-1]
 gi|82948399|dbj|BAE53263.1| Transcriptional regulatory protein ros [Magnetospirillum magneticum
           AMB-1]
          Length = 139

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 89/135 (65%), Gaps = 5/135 (3%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           +S   L +T +IVAA+V+N+ V +AD+  LI +V+  L  V S  P      PER +PAV
Sbjct: 6   NSGDLLGLTTEIVAAHVANNSVAVADLPHLIQEVYRTLASVGS-VPAA----PERPQPAV 60

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            ++KS+    + CLEDG + K LKRHLKT +NM+P+EYR +W L +DYPMV+  YA  RS
Sbjct: 61  NVKKSVTPDYIICLEDGKKLKMLKRHLKTAYNMSPEEYRDRWGLPADYPMVAPNYAQHRS 120

Query: 129 KLAKNMGLGRGRKKR 143
            LAK +GLG   +KR
Sbjct: 121 SLAKKIGLGTKPRKR 135


>gi|170744770|ref|YP_001773425.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168199044|gb|ACA20991.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 143

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 83/128 (64%), Gaps = 5/128 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +E+T  I AAYVS + +P+ D+  +I  VH AL ++ S+ P     +P  L P VPI+K+
Sbjct: 14  IELTAAITAAYVSKNAIPVGDLPGVIASVHDALIQL-SKPPA---AEPAPLVPPVPIKKT 69

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    L  LEDG Q+KSLKRHL T   +TP++YR KW L  DYPMV+  YA  RS+LAK 
Sbjct: 70  ITPDFLISLEDGRQYKSLKRHLSTR-GLTPEQYRQKWGLPPDYPMVAANYAAQRSELAKA 128

Query: 134 MGLGRGRK 141
            GLG+ R+
Sbjct: 129 SGLGQSRR 136


>gi|304393560|ref|ZP_07375488.1| transcriptional regulatory protein MucR [Ahrensia sp. R2A130]
 gi|303294567|gb|EFL88939.1| transcriptional regulatory protein MucR [Ahrensia sp. R2A130]
          Length = 137

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 64/126 (50%), Positives = 88/126 (69%), Gaps = 3/126 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            L +T ++V AYV N+ +  +D+  LI +VH AL  + + AP  +  +P     AV IRK
Sbjct: 12  MLGLTTEVVCAYVGNNPIAASDLAGLIKEVHGALHGLQAPAPEPEPEKPVP---AVSIRK 68

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+++  L CLEDG +FKSLKRHLKTH++++P++YR KW L SDYPMV+  YA  RS+LAK
Sbjct: 69  SLKDDYLICLEDGKKFKSLKRHLKTHYDLSPEQYREKWGLPSDYPMVAPNYAAERSRLAK 128

Query: 133 NMGLGR 138
            MGLGR
Sbjct: 129 KMGLGR 134


>gi|83595095|ref|YP_428847.1| MucR family transcriptional regulator [Rhodospirillum rubrum ATCC
           11170]
 gi|83578009|gb|ABC24560.1| transcriptional regulator, MucR family [Rhodospirillum rubrum ATCC
           11170]
          Length = 140

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/134 (45%), Positives = 94/134 (70%), Gaps = 5/134 (3%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + +  +E+T  IVAA+V+N+ VP++++  LI +V+ +L  + ++ P +   +P+   PAV
Sbjct: 6   TEKELVELTSTIVAAHVANNSVPVSELPDLIANVYKSLTDLGNK-PVEVEEKPQ---PAV 61

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           P++KS+    + CLEDG + K LKRHLKT ++MTP++YR KW LA+DYPMV+  YA  RS
Sbjct: 62  PVKKSVTPDYIICLEDGKKLKMLKRHLKTAYDMTPEDYREKWGLAADYPMVAPNYADHRS 121

Query: 129 KLAKNMGLG-RGRK 141
            LAK +GLG R R+
Sbjct: 122 SLAKKIGLGTRSRR 135


>gi|163793209|ref|ZP_02187185.1| Predicted transcriptional regulator [alpha proteobacterium BAL199]
 gi|159181855|gb|EDP66367.1| Predicted transcriptional regulator [alpha proteobacterium BAL199]
          Length = 132

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 80/131 (61%), Gaps = 7/131 (5%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS--RAPCQDNVQPERLKPAVPIRKS 73
           MT  +VAAY+ N+ V    I  +I  VH AL+ +    R P      PE L+PAV ++KS
Sbjct: 1   MTTTVVAAYLGNNSVASNQISEVINAVHGALKGLSGDDREPA-----PEPLRPAVSVKKS 55

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    + CLEDG Q K LKRHL+T + MTPDEYR KW L +DYPMV+  YA  RS+ AK 
Sbjct: 56  ITPDYIVCLEDGKQLKMLKRHLRTAYGMTPDEYRAKWGLPADYPMVAPNYAQQRSEFAKK 115

Query: 134 MGLGRGRKKRV 144
           +GLG    +R 
Sbjct: 116 IGLGSQTTRRT 126


>gi|220923592|ref|YP_002498894.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948199|gb|ACL58591.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 162

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 84/129 (65%), Gaps = 5/129 (3%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIR 71
           + + +  D+V+AYV+N+ VP A +  LI+ VH +L  +   A      +PE L P VPI+
Sbjct: 11  KLITLAADLVSAYVANNSVPAAGLPDLISVVHGSLAALGQPA----APKPEPLVPPVPIK 66

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           K++    L  LEDG Q+KSLKRHL T   +TP+EYR KW L  DYPMV+  YA  RS+LA
Sbjct: 67  KTVTPDYLISLEDGRQYKSLKRHLSTR-GLTPEEYRRKWGLPYDYPMVAANYAAQRSELA 125

Query: 132 KNMGLGRGR 140
           K++GLGR R
Sbjct: 126 KSIGLGRNR 134


>gi|103487548|ref|YP_617109.1| MucR family transcriptional regulator [Sphingopyxis alaskensis
           RB2256]
 gi|98977625|gb|ABF53776.1| transcriptional regulator, MucR family [Sphingopyxis alaskensis
           RB2256]
          Length = 144

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 87/129 (67%), Gaps = 5/129 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           D++E  + +T DIVAA+VSN+ V ++D+  LI +V++AL  +   AP    V  E+  PA
Sbjct: 6   DTNEMLVTLTADIVAAHVSNNSVAISDLSLLINNVYAALSGL-GGAP----VVEEKPVPA 60

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V +R S++   + CLEDG + K L+RHL TH+ MTPD+YR KW LA+DYPMV+  YA  R
Sbjct: 61  VSVRASVKPDYIVCLEDGKKLKMLRRHLMTHYGMTPDDYRAKWGLAADYPMVAPNYAEKR 120

Query: 128 SKLAKNMGL 136
             LAK +GL
Sbjct: 121 RALAKEIGL 129


>gi|114800329|ref|YP_760759.1| transcriptional regulator [Hyphomonas neptunium ATCC 15444]
 gi|114740503|gb|ABI78628.1| transcriptional regulator [Hyphomonas neptunium ATCC 15444]
          Length = 192

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 89/140 (63%), Gaps = 8/140 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D    D+    L+MTV+IV++YV+N+ +    + +LI  VH+ L  + +  P    V 
Sbjct: 61  MTDPEDLDA----LDMTVEIVSSYVANNAIQSDQLPALIKSVHATLSDLTNTVP----VP 112

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+L+PAV I KS+    L CLEDG + K LKR+L+T  +MTP++YR KW L +DYPMV+
Sbjct: 113 AEKLEPAVAINKSVTPEFLICLEDGAKLKMLKRYLRTRFDMTPEDYRAKWGLPADYPMVA 172

Query: 121 REYATTRSKLAKNMGLGRGR 140
             YA  RSK AK +GLG+ R
Sbjct: 173 PNYAKLRSKHAKQIGLGKKR 192


>gi|150378028|ref|YP_001314623.1| MucR family transcriptional regulator [Sinorhizobium medicae
           WSM419]
 gi|150032575|gb|ABR64690.1| transcriptional regulator, MucR family [Sinorhizobium medicae
           WSM419]
          Length = 148

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 88/134 (65%), Gaps = 2/134 (1%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+E  LE+T  IV+AY+S +V+  +++  LI   + +L +    A     V+ +R  PAV
Sbjct: 6   SNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGKTSEPAKTAATVEEQR--PAV 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI+KS+ +  + CLEDG  FKSLKRHL   + +TP++YR KW L +DYPMV+  YA  RS
Sbjct: 64  PIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYREKWKLPADYPMVAPNYARKRS 123

Query: 129 KLAKNMGLGRGRKK 142
           +LA+  GLGR R++
Sbjct: 124 ELARATGLGRNRRQ 137


>gi|270208579|ref|YP_003329350.1| MucR [Sinorhizobium meliloti]
 gi|76880853|gb|ABA56023.1| MucR [Sinorhizobium meliloti]
          Length = 141

 Score =  121 bits (303), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/131 (48%), Positives = 87/131 (66%), Gaps = 2/131 (1%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            + +T +IV+AYV  HV+   ++  +ITDVH+AL  V S     + V+  +    V  RK
Sbjct: 11  LVTLTAEIVSAYVKKHVIRGVEVTKIITDVHAALSAVGSDKVVPEPVEKPKPPVPV--RK 68

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI++G L CLE+G +FKSLKRHL   + MTP++YR KW+L  DYPMV+  YA  RS+LAK
Sbjct: 69  SIQDGYLICLENGKKFKSLKRHLMAKYQMTPEQYRTKWDLPDDYPMVAPAYAAKRSELAK 128

Query: 133 NMGLGRGRKKR 143
           + GLG  RKKR
Sbjct: 129 SAGLGYFRKKR 139


>gi|118588427|ref|ZP_01545836.1| transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118439133|gb|EAV45765.1| transcriptional regulator [Stappia aggregata IAM 12614]
          Length = 140

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 88/140 (62%), Gaps = 4/140 (2%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           ++ A++DS    + +T  IV+ YV+N+ VP  D+  LI DVH AL+   +  P    V  
Sbjct: 5   EEGATYDSP-NLMALTAGIVSNYVTNNPVPQQDLIELILDVHVALETATNNTPT---VFR 60

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
             L PAVPI++S+    + CLEDG +FK L RHLKT  N+TP EYR KW L++DYPMV+ 
Sbjct: 61  APLVPAVPIKQSVTPEFIVCLEDGKKFKFLTRHLKTKFNLTPAEYRRKWGLSADYPMVAP 120

Query: 122 EYATTRSKLAKNMGLGRGRK 141
            YA  R+++AK   LG  ++
Sbjct: 121 NYAQKRAEMAKAAKLGHRKR 140


>gi|170740146|ref|YP_001768801.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168194420|gb|ACA16367.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 143

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 83/128 (64%), Gaps = 5/128 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +E+T  I+AAYVS +  PM D+  +I  VH AL ++          +P  L P VPI+++
Sbjct: 14  IELTAAIIAAYVSKNATPMGDLPGVIASVHDALIQLSK----PSAAEPAPLVPPVPIKRT 69

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    +  LEDG Q+KSLKRHL+T   +TP++YR KW L  DYPMV+  YA  RS+LAK+
Sbjct: 70  VTPDFIISLEDGRQYKSLKRHLRTR-GLTPEQYRQKWGLPPDYPMVAANYAAQRSELAKS 128

Query: 134 MGLGRGRK 141
           +GLG+ R+
Sbjct: 129 IGLGQSRR 136


>gi|260469585|ref|ZP_05813750.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259028611|gb|EEW29922.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 150

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 85/125 (68%), Gaps = 4/125 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +E+T DIV+AYV N+ +P + +  LI  V ++++++   A     V+   L PAV  +KS
Sbjct: 10  IELTADIVSAYVGNNPLPASGLPDLIASVSASVRKLAGAA----VVESPSLVPAVNPKKS 65

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    + CLEDG +FKSLKRHL+T + ++PD+YR KW+L  DYPMV+  Y+ TRS LAK+
Sbjct: 66  VFPDYIVCLEDGKKFKSLKRHLRTDYGLSPDDYRAKWSLPPDYPMVAPNYSATRSALAKS 125

Query: 134 MGLGR 138
            GLGR
Sbjct: 126 TGLGR 130


>gi|220922078|ref|YP_002497379.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219946684|gb|ACL57076.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 162

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 84/136 (61%), Gaps = 5/136 (3%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D   + + S   + MT DIV+AYV+++ +P A++  L+  VH++L  + + A       P
Sbjct: 4   DTVTAANDSPDLISMTADIVSAYVAHNSIPAAELPGLVAGVHASLAGLTTPA----EATP 59

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           E L P VPIRK++    +  LEDG  +K+LKRHL     MTP++YR KW L  +YPMV+ 
Sbjct: 60  EPLVPPVPIRKTVTPDAIISLEDGRPYKTLKRHL-AGRGMTPEQYRAKWGLPPNYPMVAA 118

Query: 122 EYATTRSKLAKNMGLG 137
            YA  RS+LAKN GLG
Sbjct: 119 NYAAQRSELAKNTGLG 134


>gi|307314607|ref|ZP_07594208.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
 gi|306899024|gb|EFN29668.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
          Length = 148

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 87/134 (64%), Gaps = 2/134 (1%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+E  LE+T  IV+AY+S +V+  +++  LI   + +L +    A     V+ +R  PAV
Sbjct: 6   SNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGKTSEPAKTPATVEEQR--PAV 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI+KS+ +  + CLEDG  FKSLKRHL   + +TP++YR KW L  DYPMV+  YA  RS
Sbjct: 64  PIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYREKWKLPPDYPMVAPNYARKRS 123

Query: 129 KLAKNMGLGRGRKK 142
           +LA+  GLGR R++
Sbjct: 124 ELARATGLGRNRRQ 137


>gi|114328099|ref|YP_745256.1| transcriptional regulator [Granulibacter bethesdensis CGDNIH1]
 gi|114316273|gb|ABI62333.1| transcriptional regulator [Granulibacter bethesdensis CGDNIH1]
          Length = 200

 Score =  120 bits (301), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 83/127 (65%), Gaps = 5/127 (3%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIR 71
           R LE+T  IVAA++S++ V    I S I  +H  L  + +       V+PERL PAVP++
Sbjct: 56  RLLELTAQIVAAHISHNSVQAEAIPSFIQQIHHTLSTIGTPV-----VEPERLTPAVPVK 110

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           +S+    + CLEDG + K LKRHL++ ++MTP++YR +W+L  DYPMV+  YA  RS LA
Sbjct: 111 RSVFPDYIVCLEDGKKLKMLKRHLQSAYSMTPEQYRQRWSLPPDYPMVAPNYAERRSSLA 170

Query: 132 KNMGLGR 138
           K  GLGR
Sbjct: 171 KQNGLGR 177


>gi|148554719|ref|YP_001262301.1| MucR family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148499909|gb|ABQ68163.1| transcriptional regulator, MucR family [Sphingomonas wittichii RW1]
          Length = 148

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 87/134 (64%), Gaps = 6/134 (4%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP-ERLKPA 67
           + E  LE+T DIVA++++N+ V + D+  LI +VH+ L  +      Q   +P   LKPA
Sbjct: 2   ADEIMLELTADIVASHLTNNKVAVGDVAELIRNVHATLTSL-----GQPAAEPVAELKPA 56

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VPIR SI+   L  LE G + K LKR+L+T++ M+PD+YR KW LA+DYPMV+  YA TR
Sbjct: 57  VPIRSSIKPDYLVSLESGKKMKMLKRYLQTNYGMSPDDYRKKWGLAADYPMVAPNYAETR 116

Query: 128 SKLAKNMGLGRGRK 141
             LA   GLGR ++
Sbjct: 117 RNLAVKSGLGRKKE 130


>gi|254293738|ref|YP_003059761.1| MucR family transcriptional regulator [Hirschia baltica ATCC 49814]
 gi|254042269|gb|ACT59064.1| transcriptional regulator, MucR family [Hirschia baltica ATCC
           49814]
          Length = 142

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 86/134 (64%), Gaps = 3/134 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S    + MT  IV+++VSN+ VP  ++  +I  VH   + V + A  Q++   ER KPAV
Sbjct: 11  SQNEIMRMTSAIVSSFVSNNPVPTDNLPDVIRSVH---KTVTNLAQPQESKSDERPKPAV 67

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           P  KSI    + CLEDG + K LKR+L++ ++M+PDEYR +W L SDYPMV+  Y   RS
Sbjct: 68  PASKSITEEYIVCLEDGKKLKMLKRYLRSRYDMSPDEYRRRWGLPSDYPMVAPSYTARRS 127

Query: 129 KLAKNMGLGRGRKK 142
           + AK +GLG+G +K
Sbjct: 128 EFAKKIGLGKGGRK 141


>gi|114327053|ref|YP_744210.1| transcriptional regulator [Granulibacter bethesdensis CGDNIH1]
 gi|114315227|gb|ABI61287.1| transcriptional regulator [Granulibacter bethesdensis CGDNIH1]
          Length = 138

 Score =  120 bits (300), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 85/130 (65%), Gaps = 4/130 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           ++S   L +T  IV+A++SN+ +    +   I +V+    R +S    ++ V  E+ +PA
Sbjct: 6   EASADLLALTAQIVSAHISNNAIQTESLPGFIQEVY----RAISNLGHEEQVPVEKPQPA 61

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VP+RKS+    + CLEDG + K LKRHLK+ +NMTP++YR +W L  DYPMV+ EYAT R
Sbjct: 62  VPVRKSVFPNYIVCLEDGKKLKMLKRHLKSVYNMTPEQYRERWGLPPDYPMVAPEYATHR 121

Query: 128 SKLAKNMGLG 137
           S LAK +GLG
Sbjct: 122 SSLAKKIGLG 131


>gi|220927437|ref|YP_002502738.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952911|gb|ACL63299.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 162

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 89/142 (62%), Gaps = 7/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M++ A+  S      +T DIV+AYVS + VP+ ++ +++  VH AL R +   P     +
Sbjct: 1   MNETAT--SGSDLTALTADIVSAYVSKNPVPVGELANVLNTVHDAL-RSLGNPPA---AE 54

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+L P VPI+K+     L  LEDG  +KSLKRHL T   +TPD+YR KW L  DYPM++
Sbjct: 55  PEKLTPPVPIKKTAMPDYLISLEDGKPYKSLKRHLTTR-GLTPDQYRQKWGLPPDYPMMA 113

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK  GLG+ R++
Sbjct: 114 ANYAAQRSELAKTSGLGQRRQQ 135


>gi|170743052|ref|YP_001771707.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197326|gb|ACA19273.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 158

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 89/144 (61%), Gaps = 6/144 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M  D S D +   + +  DIV+AYV+N+ VP+ D+G LI  VH +L  +VS  P +    
Sbjct: 1   MTSDPSADQAG-LVNLAADIVSAYVANNSVPLGDLGGLIVSVHKSLATIVSPPPPEPAKP 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
                  +PIRK++    +  LEDG  +KSLKRHL +   +TP++YR KW L  DYPMV+
Sbjct: 60  VP----PIPIRKTVTPDAIISLEDGKPYKSLKRHL-SGRGLTPEQYREKWGLPPDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKKRV 144
             YA  RS+LAK++GLG+ R++R 
Sbjct: 115 ATYAAQRSELAKSLGLGQLRRERA 138


>gi|170744638|ref|YP_001773293.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168198912|gb|ACA20859.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 171

 Score =  119 bits (299), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 89/139 (64%), Gaps = 7/139 (5%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           DDA+  S    + +T DIV+AYVSN+ VP +++  LI+ +H +L ++V  AP +     E
Sbjct: 4   DDAA--SPLDLIGLTADIVSAYVSNNSVPASEVAGLISSIHHSLGQLV--APPEPEA--E 57

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
           +  P +PIRK++    +  LEDG  +K+LKRHL     +TPD+YR KW L  DYPMV+  
Sbjct: 58  KPVPPIPIRKTVTPDHIISLEDGKPYKTLKRHL-AGRGLTPDQYRQKWGLPPDYPMVAAN 116

Query: 123 YATTRSKLAKNMGLGRGRK 141
           YA  RS+LAK  GLG+ R+
Sbjct: 117 YAAQRSELAKTSGLGQSRR 135


>gi|170744343|ref|YP_001772998.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168198617|gb|ACA20564.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 142

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 86/134 (64%), Gaps = 5/134 (3%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E  + +T DIV+AY+S + VP AD+  L+T +H  LQ +V         +P +  P +PI
Sbjct: 9   EDLVALTADIVSAYISKNSVPAADLPGLLTSIHGTLQALV----LPPPPEPAKPVPPIPI 64

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           RK++    +  LEDG  +KSLKRHL T   +TP++YR KW L  DYPMV+  YA  RS+L
Sbjct: 65  RKTVTPDAIISLEDGKPYKSLKRHLTTR-GLTPEQYREKWGLPPDYPMVAANYAAQRSEL 123

Query: 131 AKNMGLGRGRKKRV 144
           AK++GLG+ RK RV
Sbjct: 124 AKSIGLGQQRKNRV 137


>gi|87199007|ref|YP_496264.1| MucR family transcriptional regulator [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134688|gb|ABD25430.1| transcriptional regulator, MucR family [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 145

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/131 (48%), Positives = 89/131 (67%), Gaps = 4/131 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           D  E  + +T DIVAA+VSN+ V ++D+ +LIT+V+SAL  +   AP ++         A
Sbjct: 7   DMRETLITLTSDIVAAHVSNNSVAVSDLPTLITNVYSALAGLDQPAPAEEPAPEP----A 62

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V IR S++N  + CLEDG + K LKRHL T +NMTP++YR +WNL +DYPMV+  YA  R
Sbjct: 63  VSIRSSVKNDHIVCLEDGKKLKMLKRHLATRYNMTPEQYRARWNLPADYPMVAPAYAEKR 122

Query: 128 SKLAKNMGLGR 138
            +LAK +GLGR
Sbjct: 123 RELAKKIGLGR 133


>gi|296282495|ref|ZP_06860493.1| transcriptional regulator [Citromicrobium bathyomarinum JL354]
          Length = 142

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 93/144 (64%), Gaps = 10/144 (6%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            + ++  +  T +IV AYVSN+   + ++  LI +V+SAL  +   A  ++    ER +P
Sbjct: 1   MEMTQTLIAFTSNIVEAYVSNNSAELDEVPVLINNVYSALSSLGGGATQEE----ERPEP 56

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AV +R S++   L CLEDG + K LKR+L+T+++M+P+EYR +WNL SDYPMV+  YA  
Sbjct: 57  AVSVRASVKPDYLVCLEDGKKLKMLKRYLRTNYDMSPEEYRERWNLPSDYPMVAPNYAEK 116

Query: 127 RSKLAKNMGLG------RGRKKRV 144
           R +LAK +GLG      RGR+K+ 
Sbjct: 117 RRELAKKIGLGRTPGQKRGRRKKT 140


>gi|288958413|ref|YP_003448754.1| transcriptional regulatory protein [Azospirillum sp. B510]
 gi|288910721|dbj|BAI72210.1| transcriptional regulatory protein [Azospirillum sp. B510]
          Length = 136

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 83/135 (61%), Gaps = 4/135 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           + D +E    +T  +VAAYV N+ VP+ D+ +LI  V  A + +    P     +   L 
Sbjct: 2   TIDQTE-LQSLTAKVVAAYVGNNSVPVQDLPTLINSVQVAFRSLGDDKPVPAKAE---LV 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAV I+KS+    + CLEDG + K LKRHLKT ++MTPD+YR KW L  +YPMV+  YA 
Sbjct: 58  PAVAIKKSVTPEYIVCLEDGKKLKMLKRHLKTVYDMTPDDYRAKWGLPPEYPMVAPNYAK 117

Query: 126 TRSKLAKNMGLGRGR 140
            RS++A  +GLGR R
Sbjct: 118 ARSEMATKLGLGRKR 132


>gi|295689066|ref|YP_003592759.1| MucR family transcriptional regulator [Caulobacter segnis ATCC
           21756]
 gi|295430969|gb|ADG10141.1| transcriptional regulator, MucR family [Caulobacter segnis ATCC
           21756]
          Length = 148

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 60/143 (41%), Positives = 89/143 (62%), Gaps = 10/143 (6%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP-- 61
           D +  +S   L ++ +IVAAYV  + V  A I  LI  VH AL  +       +  +P  
Sbjct: 10  DTASSNSLDILGLSAEIVAAYVGQNTVSQAAIPELIRTVHEALSTL------NNGGEPPR 63

Query: 62  --ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E+ KPAVP+ +S+++  + CLEDG + K LKR+L++H++M+P+EYR KW L  DYPMV
Sbjct: 64  PAEKAKPAVPVGRSVQHDYIVCLEDGKKLKMLKRYLRSHYDMSPEEYRRKWGLPPDYPMV 123

Query: 120 SREYATTRSKLAKNMGLGRGRKK 142
           +  YA  RS  AK +GLG+G ++
Sbjct: 124 APAYAARRSDFAKKIGLGKGVRR 146


>gi|16125605|ref|NP_420169.1| transcriptional regulator [Caulobacter crescentus CB15]
 gi|221234355|ref|YP_002516791.1| transcriptional regulator [Caulobacter crescentus NA1000]
 gi|13422707|gb|AAK23337.1| transcriptional regulator [Caulobacter crescentus CB15]
 gi|220963527|gb|ACL94883.1| transcriptional regulator [Caulobacter crescentus NA1000]
          Length = 171

 Score =  119 bits (297), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 91/146 (62%), Gaps = 10/146 (6%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           ++ D + ++    L ++ +IVAAYV  + V  A I  LI  VH AL      A   D V+
Sbjct: 30  VNTDTTIENDVDILGLSAEIVAAYVGQNTVAQAAIPDLIRTVHGAL------ATLNDGVE 83

Query: 61  P----ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116
                E+ KPAVP+ +S+++  + CLEDG + K LKR+L++H++M+P++YR KW L  +Y
Sbjct: 84  APRPAEKAKPAVPVSRSVQHDYIVCLEDGKRLKMLKRYLRSHYDMSPEDYRRKWGLPPEY 143

Query: 117 PMVSREYATTRSKLAKNMGLGRGRKK 142
           PMV+  YA  RS  AK +GLG+G ++
Sbjct: 144 PMVAPAYAARRSDFAKQIGLGKGVRR 169


>gi|170744916|ref|YP_001773571.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168199190|gb|ACA21137.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 164

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/133 (45%), Positives = 90/133 (67%), Gaps = 5/133 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S +++   +E+  DIV+A+VS++ VP+A++ +LI  V+ +L  +    P +   +P +L 
Sbjct: 2   SEEAANSHIELVSDIVSAFVSHNNVPVAELPNLIRGVYESLGSL--GKPVEP--EPVKLT 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           P VPI+KSI    +  LEDG  +KSLKRHL+T   +TPDEYR KW L  DYPMV+  YA 
Sbjct: 58  PPVPIKKSITPDAIISLEDGRSYKSLKRHLRTR-GLTPDEYRKKWGLPPDYPMVAPNYAA 116

Query: 126 TRSKLAKNMGLGR 138
            RS+LAK++GLG+
Sbjct: 117 QRSELAKSLGLGQ 129


>gi|13476567|ref|NP_108137.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14027329|dbj|BAB53598.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 150

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/125 (45%), Positives = 83/125 (66%), Gaps = 4/125 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +E+T DIV+AYV N+ +P + +  LI  V ++++++         V+   L PAV  +KS
Sbjct: 13  IELTADIVSAYVGNNPLPASGLPDLIASVSASVRKLAGAV----VVESPSLVPAVNPKKS 68

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    + CLEDG +FKSLKRHL+T + ++PD+YR KW L  DYPMV+  Y+ TRS LAK+
Sbjct: 69  VFPDYIICLEDGKKFKSLKRHLRTDYGLSPDDYRAKWGLPPDYPMVAPNYSATRSALAKS 128

Query: 134 MGLGR 138
            GLGR
Sbjct: 129 TGLGR 133


>gi|13473566|ref|NP_105134.1| MUCR family transcriptional regulatory protein [Mesorhizobium loti
           MAFF303099]
 gi|14024316|dbj|BAB50920.1| MucR family transcriptional regulatory protein [Mesorhizobium loti
           MAFF303099]
          Length = 152

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 85/138 (61%), Gaps = 5/138 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M DD S D+    LE+T  IV+AYV  + +P + +  LI  V +++  +    P      
Sbjct: 1   MTDD-SNDARIDLLELTAHIVSAYVEKNRLPASGLADLIASVATSIGGL--GKPAVPVAA 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P  L PAV  +KS+    + CLEDG +FKSLKRHL  H  +TPD YR KW L SDYPMV+
Sbjct: 58  P--LVPAVNPKKSVTPDFIICLEDGKKFKSLKRHLGVHFGLTPDAYRAKWGLPSDYPMVA 115

Query: 121 REYATTRSKLAKNMGLGR 138
             YA +RS+LAK++GLGR
Sbjct: 116 PNYAASRSQLAKSIGLGR 133


>gi|167647010|ref|YP_001684673.1| MucR family transcriptional regulator [Caulobacter sp. K31]
 gi|167349440|gb|ABZ72175.1| transcriptional regulator, MucR family [Caulobacter sp. K31]
          Length = 143

 Score =  118 bits (296), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 88/138 (63%), Gaps = 3/138 (2%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D+  + D+    L ++  IVAAYV+ + V    +  LI  VH AL  +   AP  D    
Sbjct: 4   DEPRTTDNEVDILGLSAGIVAAYVAQNTVSRTAVPDLIRSVHGALSAL--SAPEVDRPA- 60

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           ER KPAVP+ +S++   + CLEDG + K LKR+L+TH++M+P++YR KW+L  DYPMV+ 
Sbjct: 61  ERGKPAVPVSRSVQRDYIVCLEDGKRLKMLKRYLRTHYDMSPEDYRRKWSLPGDYPMVAP 120

Query: 122 EYATTRSKLAKNMGLGRG 139
            YA  RS  AK++GLG+G
Sbjct: 121 AYAERRSDFAKSIGLGKG 138


>gi|83858222|ref|ZP_00951744.1| transcriptional regulator [Oceanicaulis alexandrii HTCC2633]
 gi|83853045|gb|EAP90897.1| transcriptional regulator [Oceanicaulis alexandrii HTCC2633]
          Length = 140

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 91/135 (67%), Gaps = 6/135 (4%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE-RLKPAV 68
           +E  + MT DIVA++++++ VP   +  +I  V++ ++ +       +  +PE + KPAV
Sbjct: 11  NEELMRMTTDIVASFLTHNSVPAESVPDMIKSVYATMKEI-----SGEPAKPEPKAKPAV 65

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           P+ +S+ +  + CLEDG + K LKR+L++ ++M+P++YR KW L +DYPMV+  Y+  RS
Sbjct: 66  PVSRSVSDDYIVCLEDGKKLKMLKRYLRSQYDMSPEDYRRKWGLPADYPMVAPNYSKRRS 125

Query: 129 KLAKNMGLGRGRKKR 143
           + AK +GLGRG +K+
Sbjct: 126 EFAKEIGLGRGARKK 140


>gi|220927359|ref|YP_002502661.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219951966|gb|ACL62358.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 166

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 88/133 (66%), Gaps = 5/133 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S +++ R +E+  DIV+AYVSN+ VP A++ +LI  V+ +L  +   A      +P +L 
Sbjct: 2   SEEAASRHIELVSDIVSAYVSNNNVPPAELPALIQGVYQSLGSLGKPA----EPEPVKLT 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           P VPI+KS+    +  LEDG  +KSLKRHL +   +TP++YR KW L  DYPMV+  YA 
Sbjct: 58  PPVPIKKSVTPDHIISLEDGKPYKSLKRHL-SGRGLTPEQYREKWGLPRDYPMVAPNYAA 116

Query: 126 TRSKLAKNMGLGR 138
            RS+LAK++GLG+
Sbjct: 117 QRSELAKSLGLGQ 129


>gi|220919996|ref|YP_002495299.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952416|gb|ACL62807.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 143

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 90/137 (65%), Gaps = 5/137 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S +++   +E+  DIV+AYVS + VP +++ +LI  V+ +L  +   A      +P +L 
Sbjct: 2   SEETAAGHIELVSDIVSAYVSKNSVPPSELPALIQSVYQSLGALGRPA----EPEPVKLT 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           P VPI+K++    +  LEDG  +KSLKRHL T   +TP +YR+KW+L  DYPMV+  YA 
Sbjct: 58  PPVPIKKTVTPDHIISLEDGKPYKSLKRHLTTR-GLTPQQYRVKWSLPPDYPMVAANYAA 116

Query: 126 TRSKLAKNMGLGRGRKK 142
            RS+LAK++GLGR R++
Sbjct: 117 QRSELAKSIGLGRSRQQ 133


>gi|319784384|ref|YP_004143860.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170272|gb|ADV13810.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 149

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 59/129 (45%), Positives = 84/129 (65%), Gaps = 12/129 (9%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQR----VVSRAPCQDNVQPERLKPAVP 69
           +E+T DIV+AYV N+ +P + +  LI  V +++++    VV+  P         L PAV 
Sbjct: 10  IELTADIVSAYVGNNPLPASGLPELIASVSASVRKLAGAVVAETP--------NLVPAVN 61

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +KS+    + CLEDG +FKSLKRHL+T + ++PD+YR KW L  DYPMV+  Y+ TRS 
Sbjct: 62  PKKSVFPDYIICLEDGKKFKSLKRHLRTDYGLSPDDYRAKWGLPPDYPMVAPNYSATRSA 121

Query: 130 LAKNMGLGR 138
           LAK+ GLGR
Sbjct: 122 LAKSTGLGR 130


>gi|220922955|ref|YP_002498257.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219947562|gb|ACL57954.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 173

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 90/149 (60%), Gaps = 10/149 (6%)

Query: 1   MDDDASFDS-----SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPC 55
           M DD +  +     S   + +TV IV+A+++++ +P   + + IT VH++L R++  A  
Sbjct: 1   MPDDITITAANDTGSSDLIPVTVGIVSAFITHNQIPAGGLPAFITSVHASLTRLIKPA-- 58

Query: 56  QDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASD 115
                PE L P VPI+K+I+   +  LEDG  +K+L+RHL     +TP++YR KW L  D
Sbjct: 59  --EPTPEPLVPPVPIKKTIKPDAIISLEDGKPYKTLRRHL-AGRGLTPEQYRQKWGLPPD 115

Query: 116 YPMVSREYATTRSKLAKNMGLGRGRKKRV 144
           YPM +  YA  RS+LAK  GLG+ R++R 
Sbjct: 116 YPMTAANYAAQRSELAKASGLGQSRRQRA 144


>gi|150378006|ref|YP_001314601.1| MucR family transcriptional regulator [Sinorhizobium medicae
           WSM419]
 gi|150032553|gb|ABR64668.1| transcriptional regulator, MucR family [Sinorhizobium medicae
           WSM419]
          Length = 149

 Score =  117 bits (294), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 85/130 (65%), Gaps = 2/130 (1%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+E  LE+T  IV+AY+S +V+  +++  LI   + +L +    A     V+ +R  PAV
Sbjct: 6   SNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGKTSEPAKTAATVEEQR--PAV 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI+KS+ +  + CLEDG  FKSLKRHL   + +TP++YR KW L +DYPMV+  YA  RS
Sbjct: 64  PIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYREKWKLPADYPMVAPNYARKRS 123

Query: 129 KLAKNMGLGR 138
           +LA+  GLG+
Sbjct: 124 ELARATGLGK 133


>gi|150378046|ref|YP_001314641.1| MucR family transcriptional regulator [Sinorhizobium medicae
           WSM419]
 gi|150032593|gb|ABR64708.1| transcriptional regulator, MucR family [Sinorhizobium medicae
           WSM419]
          Length = 151

 Score =  117 bits (294), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 85/130 (65%), Gaps = 2/130 (1%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+E  LE+T  IV+AY+S +V+  +++  LI   + +L +    A     V+ +R  PAV
Sbjct: 6   SNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGKTSEPAKTAATVEEQR--PAV 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI+KS+ +  + CLEDG  FKSLKRHL   + +TP++YR KW L +DYPMV+  YA  RS
Sbjct: 64  PIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYREKWKLPADYPMVAPNYARKRS 123

Query: 129 KLAKNMGLGR 138
           +LA+  GLG+
Sbjct: 124 ELARATGLGK 133


>gi|113473838|ref|YP_718101.1| putative transcriptional regulator [Sphingomonas sp. KA1]
 gi|112821518|dbj|BAF03389.1| putative transcriptional regulator [Sphingomonas sp. KA1]
          Length = 171

 Score =  117 bits (293), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 84/131 (64%), Gaps = 8/131 (6%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP--ERLKPA 67
           +E  L+   DIV+A+VSN+ V  AD+  LI  V+++L   + RAP     +P  E LKPA
Sbjct: 3   NEALLDHAADIVSAHVSNNAVAAADLPGLIQAVYASLA-ALGRAP-----EPAVEELKPA 56

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V +R S++   + CLE G + K LKRHL T H MTP EYR +W+L +DYPMV+ +YA  R
Sbjct: 57  VSVRSSVKPDAVTCLECGEKMKMLKRHLGTEHGMTPAEYRTRWSLPADYPMVAPDYAAKR 116

Query: 128 SKLAKNMGLGR 138
             LA  +GLGR
Sbjct: 117 KDLAVRIGLGR 127


>gi|220921553|ref|YP_002496854.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219946159|gb|ACL56551.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 164

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 87/135 (64%), Gaps = 7/135 (5%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR-APCQDNVQPER 63
           A+ ++     E+T DIVAAYVSN+ V  A++ +++  V+  L  ++S  AP      PE+
Sbjct: 4   ATEETPTGLTELTSDIVAAYVSNNRVSSAELPAVLRTVYETLNALLSPPAPA-----PEK 58

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             P +PIRK++    +  LEDG  +KSLKRHL +   +TPDEYR KW L  DYPMV+  Y
Sbjct: 59  PVPPIPIRKTVTPDAIISLEDGKPYKSLKRHL-SGRGLTPDEYRQKWGLPPDYPMVAANY 117

Query: 124 ATTRSKLAKNMGLGR 138
           A  RS+LAK++GLG+
Sbjct: 118 AAQRSELAKSLGLGQ 132


>gi|220915063|ref|YP_002490371.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952814|gb|ACL63204.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 150

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 60/137 (43%), Positives = 83/137 (60%), Gaps = 5/137 (3%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D   S   ++  + +T  IV AYV++  VP A++  LI  VH AL  +   +  +  V  
Sbjct: 3   DTTTSPLPTQDLVSLTAGIVGAYVAHTAVPPAELPDLIASVHGALASLGQPSEPETPV-- 60

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
             L P+VPI++++    +  LEDG  +KSLKRHL+TH  +TP+ YR KW L  DYPMV+ 
Sbjct: 61  --LVPSVPIKRTVTPDAIISLEDGKPYKSLKRHLRTH-GLTPERYRAKWGLPLDYPMVAA 117

Query: 122 EYATTRSKLAKNMGLGR 138
            YA  RS+LAKN GLGR
Sbjct: 118 NYAAQRSELAKNSGLGR 134


>gi|307315968|ref|ZP_07595458.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
 gi|306898384|gb|EFN29081.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
          Length = 149

 Score =  117 bits (292), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 84/130 (64%), Gaps = 2/130 (1%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+E  LE+T  IV+AY+S +V+  +++  LI   + +L    + AP +     E+ +PAV
Sbjct: 6   SNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGN--TSAPAKTPATVEKQRPAV 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI+KS+ +  + CLEDG  FKSLKRHL     +TP++YR KW L  DYPMV+  YA  RS
Sbjct: 64  PIKKSVTDDFIVCLEDGKSFKSLKRHLMAKFALTPEQYREKWKLPPDYPMVAPNYARKRS 123

Query: 129 KLAKNMGLGR 138
           +LA+  GLG+
Sbjct: 124 ELARATGLGK 133


>gi|304320995|ref|YP_003854638.1| ROSMUCR transcriptional regulator [Parvularcula bermudensis
           HTCC2503]
 gi|303299897|gb|ADM09496.1| ROSMUCR transcriptional regulator [Parvularcula bermudensis
           HTCC2503]
          Length = 155

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 85/134 (63%), Gaps = 5/134 (3%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D S   SE  L +T +IV+A+VSN+ VP   +  L+    + L  +  +     + Q   
Sbjct: 8   DESLSKSET-LNLTTEIVSAFVSNNSVPADQLQELLQSTFNTLNNLGGQIELPQSSQ--- 63

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            KPAVP++KSI +  + CLEDG + K LKR+L+T ++M+P++YR KWNL +DYPMV+  Y
Sbjct: 64  -KPAVPVKKSITDDYIICLEDGKKLKMLKRYLRTQYDMSPEDYRRKWNLPADYPMVAPSY 122

Query: 124 ATTRSKLAKNMGLG 137
           A  RS+ AK +GLG
Sbjct: 123 AKRRSEFAKKIGLG 136


>gi|13473935|ref|NP_105503.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14024686|dbj|BAB51289.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 151

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 65/131 (49%), Positives = 84/131 (64%), Gaps = 5/131 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           D +   +E+T DIV+AYVSN+ VP+A +  LI  V+ +L +V   A  ++ V    L PA
Sbjct: 10  DENINLIELTADIVSAYVSNNPVPVASLPDLIHSVNLSLSKVGRPAEPENPV----LTPA 65

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V  +KS+    +  LEDG +FKS+KRHL     MTPDEYR KW+L  DYPMV+  YA TR
Sbjct: 66  VNPKKSVFPDYIVSLEDGRKFKSMKRHLGLL-GMTPDEYRTKWDLPRDYPMVAPNYAATR 124

Query: 128 SKLAKNMGLGR 138
           S LAK  GLGR
Sbjct: 125 SALAKASGLGR 135


>gi|13488144|ref|NP_085846.1| transcriptional regulatory protein [Mesorhizobium loti MAFF303099]
 gi|14028095|dbj|BAB54687.1| transcriptional regulatory protein [Mesorhizobium loti MAFF303099]
          Length = 156

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/124 (47%), Positives = 79/124 (63%), Gaps = 4/124 (3%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSI 74
           E+T +IV+AYVS + +P   +  LI  VH +L  + +  P    V+P+   PAV  +KS+
Sbjct: 14  ELTAEIVSAYVSKNPLPATGLPELIASVHMSLSGLGT--PTAPVVEPQ--TPAVNPKKSV 69

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
               + CLEDG +FKSLKRHL T   +TPD YR KW L  DYPM +  YA  RS+LAK++
Sbjct: 70  TPDFIICLEDGKKFKSLKRHLSTDFGLTPDAYREKWGLPRDYPMTAPNYAAQRSQLAKSI 129

Query: 135 GLGR 138
           GLGR
Sbjct: 130 GLGR 133


>gi|50593434|gb|AAT79465.1| C2H2-type putative transcriptional regulator [Agrobacterium luteum]
          Length = 138

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 81/123 (65%), Gaps = 5/123 (4%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +E  + +T DIVAA+VSN+ V ++D+  +I+ VH AL  +  +A  Q      R  PAVP
Sbjct: 9   NETLITLTSDIVAAHVSNNSVAVSDLPLIISSVHGALAGLSGKAAEQ-----ARPDPAVP 63

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           I+ SI+   + CLEDG + K LKRHL TH+ MTP++YR KW L +DYPMV+  YA  R +
Sbjct: 64  IKSSIKPDYVVCLEDGKKLKMLKRHLMTHYGMTPEDYRAKWGLPNDYPMVAPNYAEKRRQ 123

Query: 130 LAK 132
           LAK
Sbjct: 124 LAK 126


>gi|330994448|ref|ZP_08318373.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329758448|gb|EGG74967.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 156

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/133 (46%), Positives = 90/133 (67%), Gaps = 7/133 (5%)

Query: 8   DSSERF--LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           D+ + F  LE+T  IV+A+VSN+ V    +  LI  V+ AL  V SR P ++   PE+L+
Sbjct: 3   DTEQDFSCLELTTQIVSAHVSNNSVAADVLPDLIRQVYQALANV-SR-PVEE---PEKLQ 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVPI++S+    + CLEDG + K LKRHL++ + MTP++YR +W L ++YPMV+  YA 
Sbjct: 58  PAVPIKRSVFPDYIVCLEDGKKLKMLKRHLQSAYGMTPEQYRERWGLPAEYPMVAPNYAE 117

Query: 126 TRSKLAKNMGLGR 138
            RS LA+ +GLGR
Sbjct: 118 RRSSLAREIGLGR 130


>gi|193782601|ref|NP_435644.2| Transcriptional regulator, MucR family [Sinorhizobium meliloti
           1021]
 gi|193073057|gb|AAK65056.2| Transcriptional regulator, MucR family [Sinorhizobium meliloti
           1021]
          Length = 149

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 57/130 (43%), Positives = 85/130 (65%), Gaps = 2/130 (1%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+E  LE+T  IV+AY+S +V+  +++  LI   + +L +  +  P +     E  +PAV
Sbjct: 6   SNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGK--TSEPTKTPATVEEQRPAV 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI+KS+ +  + CLEDG  FKSLKRHL   + +TP++YR KW L +DYPMV+  YA  RS
Sbjct: 64  PIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYREKWKLPADYPMVAPNYARKRS 123

Query: 129 KLAKNMGLGR 138
           +LA+  GLG+
Sbjct: 124 ELARATGLGK 133


>gi|170738431|ref|YP_001767086.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168192705|gb|ACA14652.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 133

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 83/127 (65%), Gaps = 5/127 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           + M  DI+AAYVS++ VP+A++ +LI  V+  L R+  + P     +PER  P +PI+++
Sbjct: 12  ITMAADIIAAYVSHNSVPVAELPALIQAVYDQLGRL-GQPPAP---EPERPVPPIPIKRT 67

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    +  LEDG  +KSLKRHL T   +TP++YR KW L  DYPMV+  YA  RS+LAK 
Sbjct: 68  VTPDAIISLEDGRPYKSLKRHLSTR-GLTPEQYRDKWGLPPDYPMVAANYAAQRSELAKA 126

Query: 134 MGLGRGR 140
            GLGR R
Sbjct: 127 SGLGRRR 133


>gi|46205056|ref|ZP_00209683.1| hypothetical protein Magn03002427 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 127

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 51/79 (64%), Positives = 64/79 (81%)

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           L PAVPIR+SI+   L CLEDG +FKSLKRHL+T +N++PDEYR +WNL  DYPMV+  Y
Sbjct: 14  LTPAVPIRRSIQQDFLICLEDGKKFKSLKRHLRTRYNLSPDEYRARWNLPDDYPMVAPSY 73

Query: 124 ATTRSKLAKNMGLGRGRKK 142
           A TRS+LA+ MGLG+ R+K
Sbjct: 74  AATRSELARTMGLGQQRRK 92


>gi|319780796|ref|YP_004140272.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166684|gb|ADV10222.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 153

 Score =  115 bits (287), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 61/137 (44%), Positives = 81/137 (59%), Gaps = 4/137 (2%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           DD  S       LE+T  IV+AYV  + +P + +  LI  V +++  +    P      P
Sbjct: 3   DDSNSARKDIDLLELTAHIVSAYVEKNRLPASGLADLIASVSASISGL--GKPAVPVAAP 60

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
             L PAV  +KS+    + CLEDG +FKSLKRH+  H  +TPD YR KW L SDYPMV+ 
Sbjct: 61  --LVPAVNPKKSVTPDFIICLEDGKKFKSLKRHIGVHFGLTPDAYRAKWGLPSDYPMVAP 118

Query: 122 EYATTRSKLAKNMGLGR 138
            YA +RS LAK++GLGR
Sbjct: 119 NYAASRSLLAKSIGLGR 135


>gi|170742841|ref|YP_001771496.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197115|gb|ACA19062.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 145

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/136 (42%), Positives = 88/136 (64%), Gaps = 5/136 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           +   S   +E+T  +VAAYV+++ V  + + +L++ VH+AL  +  R P Q+  +P    
Sbjct: 8   ALAGSADLIEVTSGLVAAYVAHNSVAPSQVPTLLSQVHAALVGL-HRPPAQELAKPV--- 63

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           P VPI+K++    +  LEDG  +KSLKRHL +   +TPD+YR KW L  DYPMV+  YA 
Sbjct: 64  PPVPIKKTVTPDAIISLEDGRPYKSLKRHLSSR-GITPDQYRQKWGLPPDYPMVAANYAA 122

Query: 126 TRSKLAKNMGLGRGRK 141
            RS+LAK++GLG+ R+
Sbjct: 123 QRSELAKSIGLGQSRR 138


>gi|220924130|ref|YP_002499432.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948737|gb|ACL59129.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 147

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 82/139 (58%), Gaps = 5/139 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S     +   IV AYV+++ VP A++  LI   H+ALQ +  +AP      PE L P VP
Sbjct: 8   SPGLAGLAARIVGAYVAHNAVPAAELPGLIASTHAALQDL-GKAP---EPAPEPLVPPVP 63

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           IRK++    +  LE G  +K+LKRHL     +TP++YR KW L  DYPMV+  YA  RS+
Sbjct: 64  IRKTVTPDAIISLEVGKPYKTLKRHLAGR-GLTPEQYRTKWGLPPDYPMVAANYAAHRSE 122

Query: 130 LAKNMGLGRGRKKRVLTSK 148
           LAK+ GLGRG  +  L  +
Sbjct: 123 LAKSSGLGRGSAQAHLGGR 141


>gi|220922944|ref|YP_002498246.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219947551|gb|ACL57943.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 134

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 58/127 (45%), Positives = 81/127 (63%), Gaps = 5/127 (3%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIR 71
           + + +  DIV+AYVS++ VPM+++ +LI  V   L  +    P +   +P  L P VPI+
Sbjct: 10  KLITLVTDIVSAYVSHNSVPMSELPTLIQSVSDQLGSL--GQPAEPESEP--LVPPVPIK 65

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           K++    +  LEDG  +KSLKRHL T   +TP+EYR KW L  DYPMV+  YA  RS+LA
Sbjct: 66  KTVMPDAIISLEDGRPYKSLKRHLSTR-GLTPEEYRKKWGLPPDYPMVAANYAAQRSELA 124

Query: 132 KNMGLGR 138
           K +GLGR
Sbjct: 125 KRIGLGR 131


>gi|170742234|ref|YP_001770889.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168196508|gb|ACA18455.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 143

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 82/133 (61%), Gaps = 4/133 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            + +T   VAAYV+++ +  AD+  LI D H+AL  + + AP  +  +P    P VPIRK
Sbjct: 9   LVALTAQTVAAYVAHNPIRPADLPGLIRDTHAALVALTAPAPAPEAGRPV---PPVPIRK 65

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           ++    ++ LEDG  +KSLKRHL +   +TP+ YR KW L +DYPM    Y+  RS+LAK
Sbjct: 66  TVTPDAIFSLEDGKPYKSLKRHLNSR-GLTPEAYRAKWGLPADYPMTCASYSAARSELAK 124

Query: 133 NMGLGRGRKKRVL 145
            +GLGR    R++
Sbjct: 125 VLGLGRKAAPRLV 137


>gi|58038621|ref|YP_190585.1| transcriptional regulator [Gluconobacter oxydans 621H]
 gi|58001035|gb|AAW59929.1| Transcriptional regulator [Gluconobacter oxydans 621H]
          Length = 155

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 57/130 (43%), Positives = 82/130 (63%), Gaps = 3/130 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           SS   LE+T  IVAA  S   +    + +LI  V+ AL +       ++  Q ER +PAV
Sbjct: 6   SSTGLLELTAKIVAAQASRGTLEAEALPALIRQVYDALAKA---GVPEEEPQSERPQPAV 62

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI++S+    + CLEDG + K LKRHL++ ++MTP++YR +W L SDYP+V+  YA  RS
Sbjct: 63  PIKRSVFPDYIICLEDGKKLKMLKRHLQSAYDMTPEQYRERWGLPSDYPLVAPNYAQRRS 122

Query: 129 KLAKNMGLGR 138
            LA+ +GLGR
Sbjct: 123 ALAREIGLGR 132


>gi|260464245|ref|ZP_05812438.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259030048|gb|EEW31331.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 154

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 78/126 (61%), Gaps = 4/126 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            LE+T  IV+AYV  + +P + +  LI  V +++  +    P      P  L PAV  +K
Sbjct: 14  LLELTAHIVSAYVEKNRLPASGLADLIASVATSISSL--GKPAVPVAAP--LVPAVNPKK 69

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG +FKSLKRHL  H  ++PD YR KW L SDYPMV+  YA +RS LAK
Sbjct: 70  SVMPDFIICLEDGKKFKSLKRHLGVHFGLSPDAYRAKWGLPSDYPMVAPNYAASRSLLAK 129

Query: 133 NMGLGR 138
           ++GLGR
Sbjct: 130 SIGLGR 135


>gi|170743583|ref|YP_001772238.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197857|gb|ACA19804.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 158

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 81/124 (65%), Gaps = 5/124 (4%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           + +  DIV+AYV+ + VP   +  L++ VH+AL+ +      +    PE+L P V IRKS
Sbjct: 13  VALASDIVSAYVTRNAVPPTALPELLSSVHAALRGLRHGVAAE----PEKLVPPVSIRKS 68

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    +  LEDG Q+KSLKRHL T   +TP++YR KWNL  DYPMV+  YA  RS+LAK+
Sbjct: 69  VTPDYIISLEDGRQYKSLKRHLATR-GLTPEQYRRKWNLPPDYPMVAANYAAQRSELAKS 127

Query: 134 MGLG 137
           +GLG
Sbjct: 128 IGLG 131


>gi|170744767|ref|YP_001773422.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168199041|gb|ACA20988.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 164

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 89/143 (62%), Gaps = 13/143 (9%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + A+ D     +++  DIV+A+VS++ VP  ++ +LI  V+ +L  +   A      +
Sbjct: 1   MSEQAASD----HIQLVSDIVSAFVSHNNVPAVELPNLIRGVYESLGSLGKPA------E 50

Query: 61  PE--RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
           PE  +L PAVPIRKS+    +  LEDG  +KSLKRHL T   +TP +YR KW L  DYPM
Sbjct: 51  PELVKLTPAVPIRKSVTPDAIISLEDGKPYKSLKRHL-TGRGLTPQQYREKWGLPPDYPM 109

Query: 119 VSREYATTRSKLAKNMGLGRGRK 141
           V+  YA  RS+LAK +GLG+ R+
Sbjct: 110 VAANYAAARSELAKQIGLGQNRQ 132


>gi|258542768|ref|YP_003188201.1| MucR family transcriptional regulator [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633846|dbj|BAH99821.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636905|dbj|BAI02874.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639958|dbj|BAI05920.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643014|dbj|BAI08969.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646069|dbj|BAI12017.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649122|dbj|BAI15063.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652109|dbj|BAI18043.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655166|dbj|BAI21093.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-12]
          Length = 168

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/126 (42%), Positives = 83/126 (65%), Gaps = 5/126 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            L++  +IV+A+VSN+    A I  +I D++ AL+            +PE+L+PAVP+++
Sbjct: 24  LLDLVSEIVSAHVSNNQTDPALIPGMIRDIYQALKTAE-----HPQNEPEKLQPAVPVKR 78

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG + K LKRHL++ + MTP++YR +W L +DYPMV+  YA  RS LA+
Sbjct: 79  SVFPDYIICLEDGKKLKMLKRHLQSAYGMTPEQYRERWGLPADYPMVAPNYAERRSTLAR 138

Query: 133 NMGLGR 138
            +GLGR
Sbjct: 139 EIGLGR 144


>gi|329114633|ref|ZP_08243392.1| Putative mucR family transcriptional regulatory protein Y4pD
           [Acetobacter pomorum DM001]
 gi|326696113|gb|EGE47795.1| Putative mucR family transcriptional regulatory protein Y4pD
           [Acetobacter pomorum DM001]
          Length = 167

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/126 (42%), Positives = 83/126 (65%), Gaps = 5/126 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            L++  +IV+A+VSN+    A I  +I D++ AL+            +PE+L+PAVP+++
Sbjct: 24  LLDLVSEIVSAHVSNNQTDPALIPGMIRDIYQALKTAE-----HPQNEPEKLQPAVPVKR 78

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG + K LKRHL++ + MTP++YR +W L +DYPMV+  YA  RS LA+
Sbjct: 79  SVFPDYIICLEDGKKLKMLKRHLQSAYGMTPEQYRERWGLPADYPMVAPNYAERRSTLAR 138

Query: 133 NMGLGR 138
            +GLGR
Sbjct: 139 EIGLGR 144


>gi|220923967|ref|YP_002499269.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948574|gb|ACL58966.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 141

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 81/138 (58%), Gaps = 5/138 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D  +   ++    +T  IV AYV+++ VP A++  LI  VH AL   + R P +    
Sbjct: 1   MNDSTTTPPAQDLAGLTARIVGAYVAHNAVPTAELPVLIASVHGALA-ALGR-PAEHEAP 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
              L P VPIRK++    +  LEDG  +KSLKRHL T   +TP++YR KW L   YPMV+
Sbjct: 59  --ALVPPVPIRKTVTPDAIISLEDGRPYKSLKRHLATR-GLTPEQYREKWGLPPTYPMVA 115

Query: 121 REYATTRSKLAKNMGLGR 138
             YA  RS+LAK  GLGR
Sbjct: 116 ESYAERRSELAKQFGLGR 133


>gi|10956903|ref|NP_049123.1| regulator [Novosphingobium aromaticivorans]
 gi|146275574|ref|YP_001165735.1| MucR family transcriptional regulator [Novosphingobium
           aromaticivorans DSM 12444]
 gi|3378336|gb|AAD03919.1| regulator [Novosphingobium aromaticivorans]
 gi|145322265|gb|ABP64209.1| transcriptional regulator, MucR family [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 159

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/140 (43%), Positives = 88/140 (62%), Gaps = 10/140 (7%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP--ERLKP 66
           + +  L+   DIV+A+VSN+ V   D+  LI  V+++L   + +AP     +P  E+L P
Sbjct: 2   ADDTLLDHVADIVSAHVSNNSVSANDLPGLIQSVYTSLA-TLGQAP-----EPLEEKLTP 55

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AV +R S++   + CL+ G + K LKRHL T H MTP EYR +WNL +DYPMV+ EYA  
Sbjct: 56  AVSVRASVKPDAVTCLDCGAKMKMLKRHLGTDHGMTPAEYRTRWNLPADYPMVAPEYAAK 115

Query: 127 RSKLAKNMGLGR--GRKKRV 144
           R +LA  +GLGR  G+K + 
Sbjct: 116 RKELAVRIGLGRKPGQKPKA 135


>gi|220922584|ref|YP_002497886.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219947191|gb|ACL57583.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 140

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/140 (42%), Positives = 82/140 (58%), Gaps = 9/140 (6%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D  +   +     +T  IVA YV+++ VP A++ +LI  VH AL      A      +
Sbjct: 1   MNDTPTTPPALDLAGLTSRIVAGYVTHNAVPAAELPALIVSVHGAL------AALGKPSE 54

Query: 61  PER--LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
           PE   L P VPIRK++    +  LEDG  +KS+KRHL T   +TP++YR KW L  DYP+
Sbjct: 55  PEAPALVPPVPIRKTVTPDAIISLEDGRPYKSMKRHLSTR-GLTPEQYRAKWGLPIDYPI 113

Query: 119 VSREYATTRSKLAKNMGLGR 138
           V+  YA  RS+LAK  GLGR
Sbjct: 114 VAANYAAQRSELAKQFGLGR 133


>gi|58039238|ref|YP_191202.1| transcriptional regulator [Gluconobacter oxydans 621H]
 gi|58001652|gb|AAW60546.1| Transcriptional regulator [Gluconobacter oxydans 621H]
          Length = 135

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/129 (46%), Positives = 79/129 (61%), Gaps = 8/129 (6%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQ--RVVSRAPCQDNVQPERLKPAVPIRK 72
           ++T  IV AYVSN+ +P   + +LI  VH +L    V   AP +  V      PAV  RK
Sbjct: 12  QLTAQIVTAYVSNNDIPADALPALIRSVHDSLATVNVPEEAPVEKPV------PAVSPRK 65

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG + K L+RHLKT +NMTP EYR +W L  +YPMV+  YA  RS LA+
Sbjct: 66  SVFPDYIICLEDGKKLKLLRRHLKTAYNMTPQEYRERWGLPPEYPMVAPNYANHRSSLAR 125

Query: 133 NMGLGRGRK 141
            +GLGR R+
Sbjct: 126 KIGLGRRRE 134


>gi|296114159|ref|ZP_06832814.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295979235|gb|EFG85958.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 163

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 78/129 (60%), Gaps = 5/129 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +T DIVA+++S++ +P   I  LI  V++AL  V  +           L PAVPI+KS+ 
Sbjct: 15  LTTDIVASFLSSNSLPTEQIPELIHQVYNALTSVEDKQEVSS-----VLTPAVPIKKSVF 69

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              + CLEDG + K LKRHL T   MTP +YR KW L S+YPMV+  Y   RSKLAK +G
Sbjct: 70  PDYIICLEDGKKLKMLKRHLMTAFGMTPADYRTKWGLPSNYPMVAPAYGEQRSKLAKEIG 129

Query: 136 LGRGRKKRV 144
           LG+   + +
Sbjct: 130 LGKKEAEEI 138


>gi|220920031|ref|YP_002495333.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952861|gb|ACL63250.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 147

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 82/132 (62%), Gaps = 8/132 (6%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +  T DIV+A+++++ VP+ D+  L+T VH++L  +   A      +PE L P VPIRK
Sbjct: 18  LIATTADIVSAFLAHNPVPVTDLPPLLTAVHASLTGLTKPA----EPKPEPLVPPVPIRK 73

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           +I    +  LEDG  +K+L RHL     +TP++YR KW L ++YPM +  YA  RS+LAK
Sbjct: 74  TITPDAIISLEDGQPYKTLARHLG-RLGLTPEQYRAKWGLPTNYPMTAPNYAAQRSELAK 132

Query: 133 NMGLGR---GRK 141
             GLGR   GRK
Sbjct: 133 KHGLGRKVMGRK 144


>gi|162147192|ref|YP_001601653.1| ROS/MUCR transcriptional regulator protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209544245|ref|YP_002276474.1| MucR family transcriptional regulator [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785769|emb|CAP55340.1| ROS/MUCR transcriptional regulator protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531922|gb|ACI51859.1| transcriptional regulator, MucR family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 134

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/131 (46%), Positives = 81/131 (61%), Gaps = 11/131 (8%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVH---SALQRVVSRAPCQDNVQPERLKPAVPIR 71
           ++T  I AAYVS + V  A +  LI  ++     L RVV+        +PER  PAV  +
Sbjct: 12  DLTAQITAAYVSGNSVETAALPELIQKIYVTLDGLGRVVA--------EPERPVPAVSPK 63

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           KSI    + CLEDG + K LKRHLKT +N+TPDEYR +W L  DYPMV+  YA+ RS LA
Sbjct: 64  KSIFPDYIVCLEDGKKLKMLKRHLKTAYNLTPDEYRERWGLPHDYPMVAPNYASHRSSLA 123

Query: 132 KNMGLGRGRKK 142
           + +GLG  R++
Sbjct: 124 RKIGLGTKREE 134


>gi|296114428|ref|ZP_06833082.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295979189|gb|EFG85913.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 134

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 81/128 (63%), Gaps = 5/128 (3%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSI 74
           E+T +IV+AYV+ + +    +  LI  V+  +  +      +    PE+  PAVP++KS+
Sbjct: 12  ELTAEIVSAYVARNTLDAETLPDLIHQVYETISSL-----GKVEAAPEKPVPAVPLKKSV 66

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
               + CLEDG + K LKRHLKT +NMTP+EYR +W L  DYPMV+  YA+ RS LA+ +
Sbjct: 67  FPDYIVCLEDGKKLKMLKRHLKTAYNMTPEEYRERWGLPHDYPMVAPSYASHRSSLARKI 126

Query: 135 GLGRGRKK 142
           GLG  R++
Sbjct: 127 GLGTKREE 134


>gi|330992345|ref|ZP_08316293.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329760544|gb|EGG77040.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 193

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 54/126 (42%), Positives = 84/126 (66%), Gaps = 4/126 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            + MT +IVAA+ +++ V +  I  L+  V+++L+ + +    +  V+P  L+PAVPI+K
Sbjct: 37  LVSMTTEIVAAHANHNTVAIDQIPLLVETVYASLKGLGA----EKAVEPAPLQPAVPIKK 92

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG + K LKRHL+T + MTP++YR KW L ++YPM +  YA  RS LA+
Sbjct: 93  SVFPDYVICLEDGKKLKMLKRHLQTAYGMTPEQYREKWGLPANYPMTAPNYAAHRSSLAQ 152

Query: 133 NMGLGR 138
            +GLGR
Sbjct: 153 KIGLGR 158


>gi|330991166|ref|ZP_08315119.1| Putative mucR family transcriptional regulatory protein y4pD
           [Gluconacetobacter sp. SXCC-1]
 gi|329761752|gb|EGG78243.1| Putative mucR family transcriptional regulatory protein y4pD
           [Gluconacetobacter sp. SXCC-1]
          Length = 136

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 81/128 (63%), Gaps = 5/128 (3%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSI 74
           E+  +IV+AYVS + +    +  LI  V+ A+  +    P      PE+  PAVP++KS+
Sbjct: 13  ELAAEIVSAYVSRNELEAEMLPDLIHRVYDAVASLGRTEPV-----PEKPVPAVPLKKSV 67

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
               + CLEDG + K LKRHLKT +NMTPDEYR +W L  DYPMV+  YA+ RS LA+ +
Sbjct: 68  FPDYIVCLEDGKKLKMLKRHLKTAYNMTPDEYRERWGLPHDYPMVAPSYASHRSTLARKI 127

Query: 135 GLGRGRKK 142
           GLG  +++
Sbjct: 128 GLGTKQRE 135


>gi|220924920|ref|YP_002500222.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219949527|gb|ACL59919.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 139

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 61/131 (46%), Positives = 78/131 (59%), Gaps = 9/131 (6%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER--LKPA 67
           S     +T  IV AYV+++ VP A++  LI  VH AL  +   A      +PE   L P 
Sbjct: 8   SPDLAGLTGRIVGAYVAHNAVPTAELPGLIAAVHGALAALGRPA------EPEAPALVPP 61

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VPIRK++    +  LEDG  +KSLKRHL T   +TP++YR KW L  DYPMV+  YA  R
Sbjct: 62  VPIRKTVTPDAIISLEDGKPYKSLKRHLTTR-GLTPEQYRAKWGLPVDYPMVAANYAAHR 120

Query: 128 SKLAKNMGLGR 138
           S+LAK  GLGR
Sbjct: 121 SELAKAAGLGR 131


>gi|170739339|ref|YP_001767994.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193613|gb|ACA15560.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 146

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 84/140 (60%), Gaps = 4/140 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D + D  E  + +T D+++AYVSN+ V   ++  LI +VHSAL   V  A      +P +
Sbjct: 2   DGTSDKRESAITLTADVISAYVSNNHVQTGELVRLIREVHSAL---VGIAEGVRPAEPPQ 58

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
              A  IR+SI +  L   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM S  Y
Sbjct: 59  KATAAEIRRSINHDFLISFEDGKPYKTLRRHL-TMRGLTPESYRRKWGLPPDYPMTSASY 117

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           +  RS+LA+ +GLG+ R++R
Sbjct: 118 SEQRSQLARTLGLGQQRRRR 137


>gi|326385875|ref|ZP_08207502.1| regulator [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209664|gb|EGD60454.1| regulator [Novosphingobium nitrogenifigens DSM 19370]
          Length = 157

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 87/140 (62%), Gaps = 6/140 (4%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV-VSRAPCQDNVQPERLKPA 67
           + E  L +  DIV+A+VS++ V    +  LI  V+++L  +  + AP +     E+ +PA
Sbjct: 2   ADETLLTLAADIVSAHVSHNAVAADQLPLLIQSVYASLAGLGQTPAPVE-----EKREPA 56

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V +R S++   + CLE G + K LKRHL T H ++P EYR +WNLA+DYPMV+ +YA  R
Sbjct: 57  VSVRSSVKADAIACLECGAKMKMLKRHLSTDHGLSPAEYRARWNLAADYPMVAPDYAAKR 116

Query: 128 SKLAKNMGLGRGRKKRVLTS 147
            +LA  +GLGR  K  V T+
Sbjct: 117 KELAVKIGLGRKPKAVVETA 136


>gi|170741523|ref|YP_001770178.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168195797|gb|ACA17744.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 163

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/136 (41%), Positives = 84/136 (61%), Gaps = 5/136 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S +++   +E+  DIV+++VS++ V  AD+  LI  +H  L      A      +P +L 
Sbjct: 2   SEEAAPGHIELVSDIVSSFVSHNNVRPADLPDLIKSIHGTLSSFGKPA----EPEPVKLT 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           P +PI+K+I    +  LEDG  +KSLKRHL T   +TP +YR KW L  +YPMV+  YA 
Sbjct: 58  PLMPIKKTITPDAIISLEDGRPYKSLKRHL-TGRGLTPQQYREKWGLPPNYPMVAASYAA 116

Query: 126 TRSKLAKNMGLGRGRK 141
           +RS+LAK +GLG+ RK
Sbjct: 117 SRSELAKQIGLGQSRK 132


>gi|170750713|ref|YP_001756973.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657235|gb|ACB26290.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 179

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 61/131 (46%), Positives = 83/131 (63%), Gaps = 7/131 (5%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS--RAPCQDNVQPERLKPAVPI 70
           F+E TVD+VAAYVSN+ +P A++ +LI  +H AL  + +   AP  ++V  ER  PA  I
Sbjct: 12  FIERTVDVVAAYVSNNSLPSAELPALIASIHEALNTIGAGPAAPATESV--ERPTPAQ-I 68

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           RKSI    L    DG  +K+LKRHL T H + P  YR ++ L +DYP  S  Y+  RS L
Sbjct: 69  RKSIRPDGLVSFIDGKSYKTLKRHL-TKHGLDPQTYRERYGLPADYPTTSANYSAQRSAL 127

Query: 131 AKNMGLGR-GR 140
           AK++GLG+ GR
Sbjct: 128 AKSLGLGQPGR 138


>gi|296116951|ref|ZP_06835553.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976517|gb|EFG83293.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 164

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 79/129 (61%), Gaps = 4/129 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +   + +T DIV+AY+ N+ +P   +  LI +V +AL    +    Q+  +P  L+PAVP
Sbjct: 8   TPELMSLTTDIVSAYMINNSLPPERVPDLIRNVFAALG--ATGGDGQEKAEP--LQPAVP 63

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           I+KS+    + CLEDG + K LKRHL   + MTP++YR KW L S YPM +  YA  RS 
Sbjct: 64  IKKSVFPDYIICLEDGKKLKMLKRHLDRAYGMTPEQYREKWGLPSHYPMTAPNYAAKRSA 123

Query: 130 LAKNMGLGR 138
           LA+  GLGR
Sbjct: 124 LAQQSGLGR 132


>gi|220920589|ref|YP_002495890.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219945195|gb|ACL55587.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 147

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 83/135 (61%), Gaps = 5/135 (3%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           SS   + +T DIV+A+++++ +P A +  L+T VH++L R+   A       PE L P V
Sbjct: 14  SSLSTIAITADIVSAFLAHNQIPAASLPPLLTSVHASLARLTKPA----EPAPEPLVPPV 69

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI+K++    +  LEDG  +K+L RHL     +TP++YR KW L ++YPM +  Y++ RS
Sbjct: 70  PIKKTVTPDAIISLEDGKPYKTLARHL-AGRGLTPEQYRQKWGLPANYPMTAANYSSQRS 128

Query: 129 KLAKNMGLGRGRKKR 143
           +LAK  GLG+    R
Sbjct: 129 ELAKKSGLGQKAPSR 143


>gi|218532693|ref|YP_002423509.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218524996|gb|ACK85581.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 166

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/142 (43%), Positives = 85/142 (59%), Gaps = 6/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D+ S D     L MT DIVAA+VSN+ VP +++ +L+  VH A   + +        +
Sbjct: 1   MEDNTSPD----LLTMTADIVAAFVSNNSVPASELPNLLVQVHGAFASLSAAPWANAGNE 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+  PA  I+KSI    L    DG  +++LKRHL T H ++ DEYR ++ L SDYP VS
Sbjct: 57  IEKPTPAQ-IKKSITPDALISFVDGKPYRTLKRHL-TVHGLSVDEYRSRYGLPSDYPSVS 114

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+ TRS LAK +GLG  RKK
Sbjct: 115 ANYSATRSALAKQLGLGNQRKK 136


>gi|289609743|emb|CBI60393.1| unnamed protein product [Sordaria macrospora]
          Length = 137

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 84/140 (60%), Gaps = 4/140 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D   +  +  + +T DIVAA+V N+ V + DI  LI  VH AL  +              
Sbjct: 2   DIHAERDDTLIALTADIVAAHVGNNHVDVGDIAVLIRSVHDALNDL----GAPAEPVAPP 57

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            +PAVP+R S++   + CLEDG + K LKRHL TH+N+TP++YR KWNL +DYPMV+  Y
Sbjct: 58  AEPAVPVRASVKPDFIVCLEDGRKLKMLKRHLMTHYNLTPEQYRAKWNLPADYPMVAPNY 117

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           A  R  LAK +GLG  R+ R
Sbjct: 118 AEQRRTLAKKIGLGTQRRTR 137


>gi|166007397|pdb|2JSP|A Chain A, The Prokaryotic Cys2his2 Zinc Finger Adopts A Novel Fold
           As Revealed By The Nmr Structure Of A. Tumefaciens Ros
           Dna Binding Domain
          Length = 87

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (75%)

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
           V  E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+MTP+EYR KW+L  DYPM
Sbjct: 2   VNVEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYPM 61

Query: 119 VSREYATTRSKLAKNMGLGRGRK 141
           V+  YA  RS+LAK MGLG+ RK
Sbjct: 62  VAPAYAEARSRLAKEMGLGQRRK 84


>gi|170739316|ref|YP_001767971.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193590|gb|ACA15537.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 144

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 80/135 (59%), Gaps = 5/135 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
            S+ R +E+  D+VAA++S + VP   +  LI  VH A+  +   A     V P +  P 
Sbjct: 6   GSAARNVELVADLVAAFLSYNTVPAGQLPGLIRSVHEAVSGLGKLA----EVVPAKPVPP 61

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           +PIRK++    +  LEDG  +KSLKRHL T   +TP++YR KW L  +YPMV+  YA  R
Sbjct: 62  IPIRKTVTPDAIISLEDGKPYKSLKRHL-TGRGLTPEQYREKWGLPPNYPMVAPNYAAQR 120

Query: 128 SKLAKNMGLGRGRKK 142
           S+ AK +  G+ R+K
Sbjct: 121 SEFAKALSFGQHRRK 135


>gi|85709116|ref|ZP_01040182.1| predicted transcriptional regulator [Erythrobacter sp. NAP1]
 gi|85690650|gb|EAQ30653.1| predicted transcriptional regulator [Erythrobacter sp. NAP1]
          Length = 161

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 62/145 (42%), Positives = 89/145 (61%), Gaps = 10/145 (6%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D   +  E  + +T DIVAA++SN+ V +  +  LIT+V+ AL  +   +  ++      
Sbjct: 19  DLDMEMKETLITLTSDIVAAHLSNNNVEVDAVPGLITNVYGALSGLGDESEPEEERP--- 75

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            +PAV IR S++   + CLEDG + K LKR+L+T+ +MTP+EYR +W L SDYPMV+  Y
Sbjct: 76  -EPAVSIRASVKPDYIVCLEDGKKLKMLKRYLRTNFDMTPEEYRARWGLPSDYPMVAPNY 134

Query: 124 ATTRSKLAKNMGL------GRGRKK 142
           A  R  LAK +GL      GRGRKK
Sbjct: 135 AEKRRDLAKKIGLGRKPGAGRGRKK 159


>gi|170746525|ref|YP_001752785.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653047|gb|ACB22102.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 166

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 55/129 (42%), Positives = 83/129 (64%), Gaps = 3/129 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           + + VDIVAAYVSN+ VP++++  LI  +H+AL  + ++     N   E+L P+  IRKS
Sbjct: 13  IGLAVDIVAAYVSNNSVPVSELPGLIGGIHAALNGLTTQGRAA-NSAVEKLSPSQ-IRKS 70

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    +   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM +  Y+  RS+LA+ 
Sbjct: 71  VTTDHIVSFEDGKPYKTLRRHL-TLRGLTPEAYREKWGLPRDYPMTAASYSAQRSELARA 129

Query: 134 MGLGRGRKK 142
           +GLG+ R+K
Sbjct: 130 LGLGQQRRK 138


>gi|170743289|ref|YP_001771944.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197563|gb|ACA19510.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 185

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 78/123 (63%), Gaps = 3/123 (2%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +T DIV+AYVS + VP A++ +LI  ++ AL     +AP     +  +  PA  IRKSI 
Sbjct: 14  LTSDIVSAYVSRNSVPSAELPALIRSIYDALVST-GKAPAPSTQESAKATPAQ-IRKSIS 71

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              L    DG  +KSLKRHL T H +TP+EYR+K+ L  DYPMV+  YA  RS+LA+ +G
Sbjct: 72  YDHLVSFVDGKPYKSLKRHL-TKHGLTPEEYRVKYGLPRDYPMVAESYAKQRSELARTLG 130

Query: 136 LGR 138
           LG+
Sbjct: 131 LGQ 133


>gi|188584174|ref|YP_001927619.1| MucR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179347672|gb|ACB83084.1| transcriptional regulator, MucR family [Methylobacterium populi
           BJ001]
          Length = 177

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 89/145 (61%), Gaps = 8/145 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV-VSRAPCQDNV 59
           MD       + R + +T D+V+AYVSN+ V  A++  L+ +VH A++ V +S  P  +  
Sbjct: 1   MDTSEQDAETARLVTLTADVVSAYVSNNHVQSAELPKLLGEVHEAIRTVSLSGRPSAETG 60

Query: 60  QPERLKPAVP--IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
            P+    A P  IRKSI +  L   EDG  +K+L+RHL T   ++P++YR KW L +DYP
Sbjct: 61  PPK----ATPQEIRKSISHDFLISFEDGKPYKTLRRHL-TLRGLSPEQYRAKWGLPNDYP 115

Query: 118 MVSREYATTRSKLAKNMGLGRGRKK 142
           M S  Y+  RS+LA+ +GLG+ R++
Sbjct: 116 MTSASYSEQRSELARALGLGQQRRR 140


>gi|295690719|ref|YP_003594412.1| MucR family transcriptional regulator [Caulobacter segnis ATCC
           21756]
 gi|295432622|gb|ADG11794.1| transcriptional regulator, MucR family [Caulobacter segnis ATCC
           21756]
          Length = 142

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 85/144 (59%), Gaps = 13/144 (9%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D A+       +E+T +IVA YV+N+  P++++ +LI   H AL  +   AP    V 
Sbjct: 1   MEDKATL------IELTAEIVANYVANNSTPVSELPALIRATHDALAGI--GAPPAPTV- 51

Query: 61  PERLKPAVP--IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
            E +  A P  IRKSI    L   EDG  +K+LKRHL TH  MT  EY+ KW L +DYP 
Sbjct: 52  -ETVTKATPAQIRKSITPEALISFEDGKPYKTLKRHLTTH-GMTVAEYKAKWGLPNDYPT 109

Query: 119 VSREYATTRSKLAKNMGLGRGRKK 142
            +  Y+  RSK+AK +GLG+G +K
Sbjct: 110 TAPAYSEARSKMAKALGLGQGGRK 133


>gi|220922455|ref|YP_002497757.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219947062|gb|ACL57454.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 134

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 76/125 (60%), Gaps = 5/125 (4%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +T  IV+AYV+++ VP A++  LI  +H AL  +    P +  V    L P VPIRK++ 
Sbjct: 14  LTGRIVSAYVAHNAVPAAELPVLIASLHGALAGLGQ--PAEPEV--PALVPPVPIRKTVT 69

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              +  LEDG  +K+LKRHL     +TP++YR KW L  DYPM +  YA  RS+LAK  G
Sbjct: 70  PDAIISLEDGKPYKTLKRHL-AGRGLTPEQYRAKWGLPPDYPMTAANYAAQRSELAKKTG 128

Query: 136 LGRGR 140
           LGR R
Sbjct: 129 LGRLR 133


>gi|330990750|ref|ZP_08314706.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329762190|gb|EGG78678.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 161

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 83/131 (63%), Gaps = 7/131 (5%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +  +R L +TV+I+ AYVS + +   ++  LI  V+++L       P    V+ E++ PA
Sbjct: 3   EEQQRQLALTVEIITAYVSENKISPDELIRLIGTVYNSLS-----VPTASGVK-EQI-PA 55

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VPI++S+    + CLEDG + K LKRHL+  + MTP+EYR KW L S YPMV+  Y   R
Sbjct: 56  VPIKRSVFPDYIICLEDGKKLKMLKRHLQASYGMTPEEYRRKWGLPSHYPMVAPNYTVRR 115

Query: 128 SKLAKNMGLGR 138
           S+LA+ +GLGR
Sbjct: 116 SELAREIGLGR 126


>gi|83311179|ref|YP_421443.1| transcriptional regulatory protein Ros [Magnetospirillum magneticum
           AMB-1]
 gi|82946020|dbj|BAE50884.1| Transcriptional regulatory protein ros [Magnetospirillum magneticum
           AMB-1]
          Length = 137

 Score =  106 bits (265), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 78/128 (60%), Gaps = 4/128 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +T  IVAAY+  + V   ++ +LI  V+S L  V + AP       E+ +PAV ++KS+ 
Sbjct: 8   LTTKIVAAYLGGNTVEAKEVPNLIKSVYSTL--VGTDAPV--TALAEQQQPAVSVKKSVT 63

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
            G + CLE G   K LKRHL T H +T DEYR KW+L  DYP+V+ EYA  RS+LAK  G
Sbjct: 64  PGHIVCLECGDHQKMLKRHLLTGHGLTADEYRAKWSLPRDYPLVAPEYAARRSELAKAAG 123

Query: 136 LGRGRKKR 143
           LG  R  R
Sbjct: 124 LGYSRTNR 131


>gi|291037215|ref|ZP_06568179.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           xylinus NBRC 3288]
          Length = 161

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 83/131 (63%), Gaps = 7/131 (5%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +  +R L +TV+I+ AYVS + +   ++  LI  V+++L       P    V+ E++ PA
Sbjct: 3   EEQQRQLALTVEIITAYVSENKISPDELIRLIGTVYNSLS-----VPTASGVK-EQI-PA 55

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VPI++S+    + CLEDG + K LKRHL+  + MTP+EYR KW L S YPMV+  Y   R
Sbjct: 56  VPIKRSVFPDYIICLEDGKKLKMLKRHLQASYGMTPEEYRRKWGLPSHYPMVAPNYTVRR 115

Query: 128 SKLAKNMGLGR 138
           S+LA+ +GLGR
Sbjct: 116 SELAREIGLGR 126


>gi|220923470|ref|YP_002498772.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948077|gb|ACL58469.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 144

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 57/136 (41%), Positives = 79/136 (58%), Gaps = 5/136 (3%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
            D    + +    +T  IV AYV++  VP A++  LI  VH AL+  +SR P +      
Sbjct: 2   SDTPTTTPDHHAGLTARIVGAYVAHTAVPPAELPGLIASVHGALE-ALSR-PAEPEAP-- 57

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
            L P VPIRK++    +  LEDG  +++L+RHL     +TP++YR KW L  DYPMV+  
Sbjct: 58  ALVPPVPIRKTVTPDAIISLEDGKPYRTLERHLAGR-GLTPEQYRAKWGLPVDYPMVAAN 116

Query: 123 YATTRSKLAKNMGLGR 138
           YA  RS+LAK  GLGR
Sbjct: 117 YAAHRSELAKASGLGR 132


>gi|240141323|ref|YP_002965803.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens AM1]
 gi|240011300|gb|ACS42526.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens AM1]
          Length = 176

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 89/145 (61%), Gaps = 8/145 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV-VSRAPCQDNV 59
           MD       + R + +T D+V+AYVSN+ V  A++  L+ +VH A++ V +S  P  +  
Sbjct: 1   MDTSEQDAETARLVTLTADVVSAYVSNNHVQSAELPKLLGEVHEAIRSVSLSGRPTAETG 60

Query: 60  QPERLKPAVP--IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
            P+    A P  IRKSI +  L   EDG  +K+L+RHL T   ++P++YR KW L +DYP
Sbjct: 61  PPK----ATPQEIRKSISHDFLVSFEDGKPYKTLRRHL-TLRGLSPEQYRAKWGLPNDYP 115

Query: 118 MVSREYATTRSKLAKNMGLGRGRKK 142
           M S  Y+  RS+LA+ +GLG+ R++
Sbjct: 116 MTSASYSEQRSELARALGLGQQRRR 140


>gi|163853870|ref|YP_001641913.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|218532815|ref|YP_002423631.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|254563833|ref|YP_003070928.1| RosR/MucR family transcriptional regulator [Methylobacterium
           extorquens DM4]
 gi|163665475|gb|ABY32842.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|218525118|gb|ACK85703.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
 gi|254271111|emb|CAX27118.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens DM4]
          Length = 176

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 89/145 (61%), Gaps = 8/145 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV-VSRAPCQDNV 59
           MD       + R + +T D+V+AYVSN+ V  A++  L+ +VH A++ V +S  P  +  
Sbjct: 1   MDTSEQDAETARLVTLTADVVSAYVSNNHVQSAELPKLLGEVHEAIRSVSLSGRPTAETG 60

Query: 60  QPERLKPAVP--IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
            P+    A P  IRKSI +  L   EDG  +K+L+RHL T   ++P++YR KW L +DYP
Sbjct: 61  PPK----ATPQEIRKSISHDFLVSFEDGKPYKTLRRHL-TLRGLSPEQYRAKWGLPNDYP 115

Query: 118 MVSREYATTRSKLAKNMGLGRGRKK 142
           M S  Y+  RS+LA+ +GLG+ R++
Sbjct: 116 MTSASYSEQRSELARALGLGQQRRR 140


>gi|220922445|ref|YP_002497747.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219947052|gb|ACL57444.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 168

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 62/142 (43%), Positives = 87/142 (61%), Gaps = 7/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D  S +S    +E+  DIV+AY+SN+ VP +++ +LI  VH+AL  +   A       
Sbjct: 1   MTDSVSTNS----VELATDIVSAYISNNNVPASELPALIQSVHAALGALGKPAAPAVEEA 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P +  PA  IRKSI    +    DG  +KSLKRHL T H MTP++YR K+ L   YPMV+
Sbjct: 57  P-KATPAQ-IRKSITPDHMISFIDGKPYKSLKRHL-TKHGMTPEDYRAKFGLPVTYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK++GLG+ R++
Sbjct: 114 ESYAAQRSELAKSIGLGQKRQE 135


>gi|209542180|ref|YP_002278361.1| transcriptional regulator, MucR family [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533360|gb|ACI53296.1| transcriptional regulator, MucR family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 185

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 78/127 (61%), Gaps = 7/127 (5%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV--VSRAPCQDNVQPERLKPAVPI 70
            L +T  IV+AY + + +P  ++  LI  V+ AL  +  V+ +P      PE + PAVP 
Sbjct: 20  LLALTAAIVSAYAARNPLPAIELPGLIRTVYDALSSLGQVTTSPAA----PEPI-PAVPP 74

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           +KS+    + CLEDG  FK+LKRHL+  + MTP++YR KW L  DYPMV+  YA  RS  
Sbjct: 75  KKSVFPDHIICLEDGKPFKALKRHLRAAYGMTPEDYRAKWKLPPDYPMVAPNYAAYRSSQ 134

Query: 131 AKNMGLG 137
           A+ +GLG
Sbjct: 135 ARAIGLG 141


>gi|220922439|ref|YP_002497741.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219947046|gb|ACL57438.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 165

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/142 (43%), Positives = 85/142 (59%), Gaps = 7/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D  S +S    +E+  DI++AYVSN+ VP A +  LI  V+  L  + +  P     +
Sbjct: 1   MTDSVSTNS----VELASDIISAYVSNNPVPAASLPELIKAVYETLSNL-TNPPAPAVEE 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
             +  PA  IRKSI    L    DG  +KSLKRHL T H MTP++YR K+ L   YPMV+
Sbjct: 56  TPKASPAQ-IRKSITPDHLISFIDGKPYKSLKRHL-TKHGMTPEDYRTKFGLPVTYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YAT RS+LAK++GLG+ R++
Sbjct: 114 ETYATQRSELAKSIGLGQKRQE 135


>gi|254562856|ref|YP_003069951.1| Ros/MucR family transcriptional regulator [Methylobacterium
           extorquens DM4]
 gi|254270134|emb|CAX26126.1| transcriptional regulator, Ros/MucR family [Methylobacterium
           extorquens DM4]
          Length = 174

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 84/142 (59%), Gaps = 6/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D+   D     L MT DIVAA+VSN+ VP +++ SL+  VHSA   + S    +   +
Sbjct: 11  MEDNTLPD----LLMMTADIVAAFVSNNSVPASELPSLLVQVHSAFVSLPSTPVAEAGSE 66

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+  PA  I+KSI    L    DG  +++LKRHL  H  ++ DEYR ++ L  DYP V+
Sbjct: 67  IEKPTPAQ-IKKSITPDALISFVDGKPYRTLKRHLNVH-GLSVDEYRTRYGLPGDYPSVA 124

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+ +RS LAK +GLG  RKK
Sbjct: 125 ANYSASRSALAKQLGLGNQRKK 146


>gi|170744213|ref|YP_001772868.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168198487|gb|ACA20434.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 174

 Score =  105 bits (263), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 77/128 (60%), Gaps = 3/128 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E   DIV+AYVS++ V   ++ SLI  +H+ALQ +   A       P+    A  IRK
Sbjct: 15  LIEQVADIVSAYVSSNRVSAGELPSLIASLHTALQGLGKPATPPAEETPKAT--AAQIRK 72

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L  L DG  +K+LKRHL T   +TPDEYR K+ L SDYPMV+  YA  RS+LAK
Sbjct: 73  SITPDALISLIDGKPYKTLKRHLTTQ-GLTPDEYRKKFGLPSDYPMVASNYAAHRSELAK 131

Query: 133 NMGLGRGR 140
             GLG+ R
Sbjct: 132 TSGLGQRR 139


>gi|329846734|ref|ZP_08262007.1| transcriptional regulatory protein ros [Asticcacaulis biprosthecum
           C19]
 gi|328844241|gb|EGF93809.1| transcriptional regulatory protein ros [Asticcacaulis biprosthecum
           C19]
          Length = 116

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 73/117 (62%), Gaps = 7/117 (5%)

Query: 30  VPMADIGSLITDVHSALQRV-VSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQF 88
           +P AD+  LI  VH++L    V  AP       E   P+V ++KSI    L CLEDG QF
Sbjct: 1   MPGADLPGLIKSVHASLNHTSVPDAPAA-----EVKAPSVSVKKSITPNYLICLEDGRQF 55

Query: 89  KSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLG-RGRKKRV 144
           KSLKRHL++ + +TPD YR KW L  DYPMV+  Y+  RS +AK+M LG +GR+ R 
Sbjct: 56  KSLKRHLQSKYGLTPDAYRAKWGLPKDYPMVAPAYSAARSAMAKSMQLGVKGRQTRA 112


>gi|170745595|ref|YP_001776817.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170752152|ref|YP_001783298.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659249|gb|ACB28301.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659279|gb|ACB28330.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 172

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 89/151 (58%), Gaps = 9/151 (5%)

Query: 1   MDDDASFDSSER--FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           MDD+     +E   + E+T D+VAAYVSN+ +P A++ +LI  VH+A+  + +  P    
Sbjct: 1   MDDNTGTIEAEAIDYTEVTADLVAAYVSNNPLPAAELATLIASVHAAVTGLGT--PGVPA 58

Query: 59  VQPERLKP-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
           V P   KP A  IRKSI    L   EDG  +K+L+RHL T   +    YR KW L  DYP
Sbjct: 59  V-PRPEKPTAAQIRKSIRPDALISFEDGKPYKTLRRHL-TGLGLDAATYREKWGLPRDYP 116

Query: 118 MVSREYATTRSKLAKNMGLG--RGRKKRVLT 146
           MV+  Y+  RS +AK++GLG  RG+ KR  T
Sbjct: 117 MVAASYSEARSAMAKSIGLGQMRGKAKRQPT 147


>gi|330990607|ref|ZP_08314564.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329762309|gb|EGG78796.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 146

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 78/127 (61%), Gaps = 7/127 (5%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIR 71
           R + +T ++VAAYVS + +    +  LIT V  +L      +P  + V  E   PAVPI+
Sbjct: 7   RRISVTAEMVAAYVSKNTIDPEKLPYLITSVFQSL------SPKAEPVS-ELPIPAVPIK 59

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           +S+    + CLEDG + K LKRHL   + MTP++YR KW L  +YPMV+  YA  RS+LA
Sbjct: 60  RSVFPDYIICLEDGKKLKMLKRHLNVAYGMTPEQYRAKWGLPVEYPMVAPNYANRRSELA 119

Query: 132 KNMGLGR 138
           + MGLGR
Sbjct: 120 REMGLGR 126


>gi|220923746|ref|YP_002499048.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948353|gb|ACL58745.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 135

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 57/125 (45%), Positives = 75/125 (60%), Gaps = 9/125 (7%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER--LKPAVPIRKS 73
           +T  IV+AYV+   VP +++ +LI  VH AL      A      +PE   L P VPIRK+
Sbjct: 14  LTGRIVSAYVAYTAVPASELPALIAAVHGAL------AALGRPAEPEAPALVPPVPIRKT 67

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    +  LEDG  +++LKRHL     +TP++YR KW L  DYPMV+  YA  RS+LAK 
Sbjct: 68  ITPDAIISLEDGKPYRTLKRHL-AGRGLTPEQYRAKWGLPLDYPMVAANYAAQRSELAKQ 126

Query: 134 MGLGR 138
            GLGR
Sbjct: 127 YGLGR 131


>gi|170748335|ref|YP_001754595.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654857|gb|ACB23912.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 155

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 80/130 (61%), Gaps = 5/130 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS---RAPCQDNVQPERLKP-AV 68
           F+E+  DIVAAYVSN+ VP A++ +LI  VH A+  +V+    A      Q E  KP A 
Sbjct: 12  FIELAGDIVAAYVSNNPVPAAELPALIARVHGAISGLVTGTLTAEIGAAPQAEVEKPSAA 71

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            IRKS+ +  +    DG  +K+LKRHL T H + P  YR ++ L +DYPMV+  YA  RS
Sbjct: 72  QIRKSVRHDGIVSFIDGKTYKTLKRHL-TSHGLDPRSYRDRYGLPADYPMVAPSYAEQRS 130

Query: 129 KLAKNMGLGR 138
            LAK +GLG+
Sbjct: 131 ALAKAIGLGQ 140


>gi|221233919|ref|YP_002516355.1| transcriptional regulator [Caulobacter crescentus NA1000]
 gi|220963091|gb|ACL94447.1| transcriptional regulator [Caulobacter crescentus NA1000]
          Length = 142

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/143 (41%), Positives = 86/143 (60%), Gaps = 11/143 (7%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR-APCQDNV 59
           M+D A+       +E+T +IVA YV+N+  P++++ +LI   H AL  + S  AP  + V
Sbjct: 1   MEDKATL------IELTAEIVANYVANNSTPVSELPALIRATHDALAGIGSPPAPTVEVV 54

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
              +  PA  IRKSI    L   EDG  +K+LKRHL TH  MT  EY+ KW L +DYP  
Sbjct: 55  T--KATPAQ-IRKSITPEALISFEDGKPYKTLKRHLTTH-GMTVAEYKAKWGLPNDYPTT 110

Query: 120 SREYATTRSKLAKNMGLGRGRKK 142
           +  Y+  RS++AK +GLG+G +K
Sbjct: 111 APAYSEARSQMAKALGLGQGGRK 133


>gi|326387354|ref|ZP_08208964.1| regulator [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208535|gb|EGD59342.1| regulator [Novosphingobium nitrogenifigens DSM 19370]
          Length = 153

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 83/136 (61%), Gaps = 4/136 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + E  L +  DIV+A+VS++ V    +  LI  V+++L  +  +AP       E+ +PAV
Sbjct: 2   ADETLLTLAADIVSAHVSHNAVAADQLPVLIQSVYASLAGL-GQAPAPVE---EKREPAV 57

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +R S++   + CLE G + K LKRHL T H ++P EYR +W+L +DYPMV+ +YA  R 
Sbjct: 58  SVRSSVKADAIACLECGAKMKMLKRHLSTDHGISPAEYRTRWSLPADYPMVAPDYAAKRK 117

Query: 129 KLAKNMGLGRGRKKRV 144
           +LA  +GLGR  K  V
Sbjct: 118 ELAVKIGLGRKPKAVV 133


>gi|170747935|ref|YP_001754195.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654457|gb|ACB23512.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 160

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/136 (42%), Positives = 83/136 (61%), Gaps = 7/136 (5%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPC-QDNVQPERL 64
           S   S RF+ +  +IV+AYVS++ V  AD+  L+ +VH+A+     R  C     QP   
Sbjct: 4   SNGGSLRFVTLASEIVSAYVSHNHVQSADLPGLLNEVHAAI-----RGICDAGQSQPIAK 58

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
             A  IR+SI    L   EDG  +K+L+RHL T   +TP+ YR KW LASDYPM ++ Y+
Sbjct: 59  ATAQEIRRSINPDFLISFEDGKPYKTLRRHL-TLRGLTPEAYRAKWGLASDYPMTAQSYS 117

Query: 125 TTRSKLAKNMGLGRGR 140
             RS+LA+++GLG+ R
Sbjct: 118 EQRSQLARSLGLGQPR 133


>gi|220919995|ref|YP_002495298.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952415|gb|ACL62806.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 175

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 61/130 (46%), Positives = 84/130 (64%), Gaps = 5/130 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP-AVPIRKSI 74
           +T +IV+AYVSN+VVP A++  LI  V  AL  +    P    V+ E LKP A  IRKSI
Sbjct: 19  LTANIVSAYVSNNVVPAAELPELIAIVDRALDELSK--PATPVVE-EVLKPTAAQIRKSI 75

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
               L    DG  +KS+KRHL T + +TP EYR ++ L ++YPMV+  YA  RS+LAK++
Sbjct: 76  TPDHLISFIDGKPYKSMKRHL-TKNGLTPAEYRQQYGLPANYPMVAPNYAAQRSELAKSL 134

Query: 135 GLGRGRKKRV 144
           GLG+ R++R 
Sbjct: 135 GLGQMRRQRA 144


>gi|220922087|ref|YP_002497388.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219946693|gb|ACL57085.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 166

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 86/141 (60%), Gaps = 9/141 (6%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           ++ ++FD     + M  DIV+AYVS++ VP  ++ +LI  V+  L ++   A  +     
Sbjct: 4   EERSAFDG----IAMAADIVSAYVSHNNVPPGELTALIRSVYDQLGKLGRPAEPEPERPV 59

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
             +     IRKS+  G +  LEDG  +KSLKRHL+T   +TP +YR KW+L  DYPMV+ 
Sbjct: 60  PPVP----IRKSVTPGAIISLEDGKPYKSLKRHLRTR-GLTPQQYRQKWDLPPDYPMVAA 114

Query: 122 EYATTRSKLAKNMGLGRGRKK 142
           +YA  RS+LAK  GLGR R++
Sbjct: 115 DYAARRSELAKANGLGRSRQR 135


>gi|163853189|ref|YP_001641232.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|163664794|gb|ABY32161.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
          Length = 140

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 81/130 (62%), Gaps = 2/130 (1%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           ++E++  +V+AYVSN+ V  AD+  LI  VHS L  + S A      Q E+  PA  I+K
Sbjct: 12  YVEISAGLVSAYVSNNSVRAADLPELIRTVHSTLAALKSGAGQGGENQIEKPTPAQ-IKK 70

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L   EDG  +K+LKRHL  +  +TP  YR K+ LA+DYPM +  Y+  RS+LA+
Sbjct: 71  SITPDALISFEDGKPYKTLKRHL-ANRGLTPGAYREKYGLAADYPMTAPGYSARRSELAR 129

Query: 133 NMGLGRGRKK 142
            +GLG+ RKK
Sbjct: 130 ALGLGQLRKK 139


>gi|170738948|ref|YP_001767603.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193222|gb|ACA15169.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 166

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 87/142 (61%), Gaps = 5/142 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +SS    E+  DIVAAYVSN+ +  A++ +++  V+  L  +++  P           P 
Sbjct: 7   ESSINLTELASDIVAAYVSNNRISGAELPAVLRSVYETLHALIAPPPAAPEKP----VPP 62

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           +PI+K++    +  LEDG  +KSLKRHL +   +TP++YR KW L  DYPMV+  YA  R
Sbjct: 63  IPIKKTVTPDAIISLEDGKPYKSLKRHL-SGRGLTPEQYREKWGLPPDYPMVAATYAAQR 121

Query: 128 SKLAKNMGLGRGRKKRVLTSKV 149
           S+LAK++GLG+ R++R +  + 
Sbjct: 122 SELAKSLGLGQLRRERAMQKRA 143


>gi|220919620|ref|YP_002494923.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952040|gb|ACL62431.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 143

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 74/124 (59%), Gaps = 4/124 (3%)

Query: 17  TVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIEN 76
           T  IV AYVSN+ +  A++  LI  VH+A+ R   RAP     Q  R  PA  IR+SI +
Sbjct: 16  TATIVMAYVSNNSLRPAELPDLIASVHAAIGR--GRAPEPAEPQTPRATPAQ-IRRSISH 72

Query: 77  GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGL 136
             L   ED   +KSL+RHL T   +TP++YR KW L  DYPMV+  Y+  RS LA+  GL
Sbjct: 73  EALISFEDSKPYKSLRRHLTTR-GLTPEQYRAKWGLPPDYPMVAAAYSEERSALARAAGL 131

Query: 137 GRGR 140
           GR R
Sbjct: 132 GRKR 135


>gi|291037449|ref|ZP_06568413.1| transcriptional regulator Ros/MucR [Gluconacetobacter xylinus NBRC
           3288]
          Length = 222

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 80/137 (58%), Gaps = 4/137 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYV--SNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D S D S   +    DIVAA++  +N  +P   + + I DV++A++        + N   
Sbjct: 2   DQSDDLSPAIVIAMSDIVAAHLGNTNTSLPTEHVPAFIRDVYAAIRETTPV--TEKNSSI 59

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
               PAVP+ +S+    + CLEDG + K LKRHL+T + MTP +YR KW L  DYPMV+ 
Sbjct: 60  PAQHPAVPVAQSVFPDYIVCLEDGKKLKMLKRHLQTRYGMTPTQYREKWQLPMDYPMVAP 119

Query: 122 EYATTRSKLAKNMGLGR 138
           EYA  R+ LA++ GLGR
Sbjct: 120 EYAKMRAALARDAGLGR 136


>gi|254563822|ref|YP_003070917.1| RosR/MucR family transcriptional regulator [Methylobacterium
           extorquens DM4]
 gi|254271100|emb|CAX27107.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens DM4]
          Length = 177

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 57/130 (43%), Positives = 83/130 (63%), Gaps = 5/130 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS-RAPCQDNVQPERLKPAVPIRK 72
           +E+  D+V+AYVSN+ +P  ++  LI  VH+AL  + + +AP ++ V  ER  PA  I+K
Sbjct: 13  IELAADLVSAYVSNNSLPSPELAGLIVQVHAALVALSAPQAPKEEEV--ERATPAQ-IKK 69

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L    DG  +K+LKRHL TH  +  D YR ++ L +DYP VS  Y+  RS LAK
Sbjct: 70  SITPDALISFIDGKPYKTLKRHLTTH-GLDIDGYRRRYGLPADYPTVSSNYSAARSALAK 128

Query: 133 NMGLGRGRKK 142
           ++GLG+ R+K
Sbjct: 129 DLGLGQQRRK 138


>gi|83310092|ref|YP_420356.1| transcriptional regulatory protein [Magnetospirillum magneticum
           AMB-1]
 gi|82944933|dbj|BAE49797.1| Transcriptional regulatory protein [Magnetospirillum magneticum
           AMB-1]
          Length = 137

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 77/128 (60%), Gaps = 4/128 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +T  IVAAY+S+  +   +I +LI  V+S L    + A    +   E+ +PAV +++S+ 
Sbjct: 8   LTTKIVAAYLSSSTLAATEIPTLIKSVYSTLAATDNPA----SAPAEQQQPAVSVKRSVT 63

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              + CLE G + K LKRHL T H +T DEYR KW L  DYP+V+ EYA  RS+ AK +G
Sbjct: 64  PDYIVCLECGDRQKMLKRHLTTGHGLTADEYRAKWALPRDYPLVAPEYAARRSEFAKAVG 123

Query: 136 LGRGRKKR 143
           LG  R  R
Sbjct: 124 LGYSRTNR 131


>gi|163853859|ref|YP_001641902.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|163665464|gb|ABY32831.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
          Length = 177

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 57/130 (43%), Positives = 83/130 (63%), Gaps = 5/130 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS-RAPCQDNVQPERLKPAVPIRK 72
           +E+  D+V+AYVSN+ +P  ++  LI  VH+AL  + + +AP ++ V  ER  PA  I+K
Sbjct: 13  IELAADLVSAYVSNNSLPSPELAGLIVQVHAALVALSAPQAPKEEEV--ERATPAQ-IKK 69

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L    DG  +K+LKRHL TH  +  D YR ++ L +DYP VS  Y+  RS LAK
Sbjct: 70  SITPDALISFIDGKPYKTLKRHLTTH-GLDIDGYRRRYGLPADYPTVSSNYSAARSALAK 128

Query: 133 NMGLGRGRKK 142
           ++GLG+ R+K
Sbjct: 129 DLGLGQQRRK 138


>gi|218532804|ref|YP_002423620.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|240141313|ref|YP_002965793.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens AM1]
 gi|218525107|gb|ACK85692.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
 gi|240011290|gb|ACS42516.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens AM1]
          Length = 177

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 57/130 (43%), Positives = 83/130 (63%), Gaps = 5/130 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS-RAPCQDNVQPERLKPAVPIRK 72
           +E+  D+V+AYVSN+ +P  ++  LI  VH+AL  + + +AP ++ V  ER  PA  I+K
Sbjct: 13  IELAADLVSAYVSNNSLPSPELAGLIVQVHAALVALSAPQAPKEEEV--ERATPAQ-IKK 69

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L    DG  +K+LKRHL TH  +  D YR ++ L +DYP VS  Y+  RS LAK
Sbjct: 70  SITPDALISFIDGKPYKTLKRHLTTH-GLDIDGYRRRYGLPADYPTVSSNYSAARSALAK 128

Query: 133 NMGLGRGRKK 142
           ++GLG+ R+K
Sbjct: 129 DLGLGQQRRK 138


>gi|220926132|ref|YP_002501434.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219950739|gb|ACL61131.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 189

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 60/129 (46%), Positives = 82/129 (63%), Gaps = 5/129 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRA-PCQDNVQPERLKPAVPIRKSI 74
           +T DIV+AYVS + VP A++ +LI  V+ AL+ +   A P  D     +  PA  IRKSI
Sbjct: 14  LTSDIVSAYVSKNNVPSAELPTLIRSVYDALRTIGKPATPAADETP--KATPAQ-IRKSI 70

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
               L    DG  +KSLKRHL T H +TP+ YR K+ L  DYPMV+  YA  RS+LA+++
Sbjct: 71  TVDHLVSFIDGKPYKSLKRHL-TKHGLTPEAYRAKFGLPRDYPMVAESYARQRSELARSL 129

Query: 135 GLGRGRKKR 143
           GLG+ R++R
Sbjct: 130 GLGQIRRER 138


>gi|83312282|ref|YP_422546.1| transcriptional regulator [Magnetospirillum magneticum AMB-1]
 gi|82947123|dbj|BAE51987.1| Predicted transcriptional regulator [Magnetospirillum magneticum
           AMB-1]
          Length = 160

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 77/131 (58%), Gaps = 4/131 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +     IVAAY+ NH V + D+  +I+  ++AL    +  P    V  +R  PAVPI+KS
Sbjct: 6   VSFAARIVAAYLRNHEVAIGDLSGIISATYAALAGTDAPPP----VGADRPTPAVPIKKS 61

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    + CLE G + K L+RHL T H ++ D YR KW+L +DYPM +  Y+  RS++A  
Sbjct: 62  ITPNFVACLECGKRQKMLRRHLSTSHGLSVDAYRSKWSLPADYPMAAPNYSQKRSEMAIQ 121

Query: 134 MGLGRGRKKRV 144
           +GLGR  K  V
Sbjct: 122 IGLGRKPKTTV 132


>gi|220923803|ref|YP_002499105.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948410|gb|ACL58802.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 172

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/146 (43%), Positives = 84/146 (57%), Gaps = 8/146 (5%)

Query: 1   MDDDASFDSSER---FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQD 57
           M D+A   +S      +E+  DIV+AYVSN+VV  AD+  LI  V   L  +    P   
Sbjct: 1   MSDEAGAPTSHSEAGTIELVADIVSAYVSNNVVRPADLPDLIAAVSRTLGELGK--PSTP 58

Query: 58  NVQPERLKP-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116
             + E  KP A  IRKSI    +    DG  +K+LKRHL T H M+PDEYR ++ L   Y
Sbjct: 59  AAE-ETPKPTAAQIRKSITPDHIVSFIDGKPYKTLKRHL-TRHGMSPDEYRSRYGLPPTY 116

Query: 117 PMVSREYATTRSKLAKNMGLGRGRKK 142
           PMV+  YA+ RS+LAK  GLG+ R+K
Sbjct: 117 PMVAESYASQRSELAKASGLGQNRRK 142


>gi|188582197|ref|YP_001925642.1| MucR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179345695|gb|ACB81107.1| transcriptional regulator, MucR family [Methylobacterium populi
           BJ001]
          Length = 160

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/131 (42%), Positives = 83/131 (63%), Gaps = 10/131 (7%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS----RAPCQDNVQPERLKPAV 68
           F+E+  DIV++YVSN+ VP +++  LI +VH+AL  + S     AP ++ ++    KP+ 
Sbjct: 12  FVELASDIVSSYVSNNSVPASELPGLIINVHAALTGLSSPETAAAPAEEVIE----KPSS 67

Query: 69  -PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
             IRKS+    +    DG  +K+LKRHL TH  + P  YR ++ L +DYPMV+  YA  R
Sbjct: 68  GQIRKSVTPDAIISFIDGKPYKTLKRHLGTH-GLDPYSYRQRYGLPNDYPMVAPNYAAQR 126

Query: 128 SKLAKNMGLGR 138
           S LAK++GLGR
Sbjct: 127 SALAKSIGLGR 137


>gi|170742252|ref|YP_001770907.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168196526|gb|ACA18473.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 140

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 77/128 (60%), Gaps = 5/128 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +E+T  IVAAYVS +  P+AD+  LI  V+ AL ++ +    +           VPI+K+
Sbjct: 11  VELTAAIVAAYVSKNATPVADLPGLIASVNGALNQLSAPPAAEPAPLVP----PVPIKKT 66

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    +  LEDG  +KSLKRHL     +TPDEYR KW L   YPMV+  YA  RS+LAK+
Sbjct: 67  VTPDYIISLEDGKPYKSLKRHLGIR-GLTPDEYRKKWGLPHGYPMVAANYAAKRSELAKS 125

Query: 134 MGLGRGRK 141
           + LG+ R+
Sbjct: 126 LALGQSRR 133


>gi|148260765|ref|YP_001234892.1| MucR family transcriptional regulator [Acidiphilium cryptum JF-5]
 gi|326403964|ref|YP_004284046.1| MucR family transcriptional regulator [Acidiphilium multivorum
           AIU301]
 gi|146402446|gb|ABQ30973.1| transcriptional regulator [Acidiphilium cryptum JF-5]
 gi|325050826|dbj|BAJ81164.1| MucR family transcriptional regulator [Acidiphilium multivorum
           AIU301]
          Length = 149

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 79/128 (61%), Gaps = 4/128 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +++ L++T  IV+A+VS++ V    + +LI DV+ +L                 + P   
Sbjct: 7   NQQLLQLTAQIVSAHVSHNSVSAEMLPALIRDVYQSLSGTEQPVEEPPPPLEPAVNP--- 63

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +KS+ N  + CLEDG + K L+RHLK+ +N+TP++YR +W LA+DYPMV+  YA  RS 
Sbjct: 64  -KKSVFNDYIICLEDGKKLKMLRRHLKSAYNLTPEQYRERWGLANDYPMVAPAYAKQRSN 122

Query: 130 LAKNMGLG 137
           LAK +GLG
Sbjct: 123 LAKKIGLG 130


>gi|83310305|ref|YP_420569.1| transcriptional regulatory protein mucR [Magnetospirillum
           magneticum AMB-1]
 gi|82945146|dbj|BAE50010.1| Transcriptional regulatory protein mucR [Magnetospirillum
           magneticum AMB-1]
          Length = 153

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 56/137 (40%), Positives = 84/137 (61%), Gaps = 3/137 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            + +T  IV+A+V  + V + D+  LI   ++AL  V +  P Q  +  ++ +PAVPI+K
Sbjct: 1   MIGVTARIVSAFVRGNAVAVEDLSDLIRTTYAAL--VTTAMPMQVPLT-DQPRPAVPIKK 57

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S++   + CLE G   K LKRHL T H ++  +YR KW+L +DYP+V+  YA  RS +A 
Sbjct: 58  SVQPDAVICLECGKPQKMLKRHLATSHGLSVTDYRTKWSLPADYPVVAPSYAEHRSAMAI 117

Query: 133 NMGLGRGRKKRVLTSKV 149
            +GLGR RKK V   +V
Sbjct: 118 KIGLGRKRKKTVEPEEV 134


>gi|220914951|ref|YP_002490259.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952702|gb|ACL63092.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 173

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 80/139 (57%), Gaps = 3/139 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           +A+ D+    +E+  DI++AYV+++ VP+A +  LI  V   L  +   A       P +
Sbjct: 6   EATADAGGPAIELVADIISAYVAHNPVPVAQLPDLIATVSQTLDSLGKPAASAAEETP-K 64

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             PA  IRKSI    L    DG  +K+LKRHL T H M+PDEYR K+ L   YPMV+  Y
Sbjct: 65  ATPAQ-IRKSITPDALISFIDGKPYKTLKRHL-TRHGMSPDEYRSKFGLPPTYPMVAESY 122

Query: 124 ATTRSKLAKNMGLGRGRKK 142
           A  RS+LAK  GLG+  ++
Sbjct: 123 AVQRSELAKASGLGQSHRR 141


>gi|220922341|ref|YP_002497643.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219946948|gb|ACL57340.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 176

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 91/152 (59%), Gaps = 8/152 (5%)

Query: 1   MDDDA---SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQD 57
           M D+A   +  S    +++   IV+AYVSNHVV  AD+  LI  V   L  +    P + 
Sbjct: 1   MSDEAGTVTLQSEMNTIDLVAAIVSAYVSNHVVRPADLPDLIAAVSQTLGGLGK--PSEP 58

Query: 58  NVQ-PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116
            V+   +L PA  IRKSI    +    DG  +KS+KRHL T + +TP EYR+K+ L +DY
Sbjct: 59  AVEETPKLTPAQ-IRKSITPDHIVSFIDGKLYKSMKRHL-TKNGLTPAEYRMKFGLPTDY 116

Query: 117 PMVSREYATTRSKLAKNMGLGRGRKKRVLTSK 148
           PMV+  YA  RS+LAK +GLG+ R++R + ++
Sbjct: 117 PMVAPSYAAQRSELAKKLGLGQLRRERAVQNR 148


>gi|170739310|ref|YP_001767965.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193584|gb|ACA15531.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 170

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 77/129 (59%), Gaps = 3/129 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   LE+T DIV+AYV+N+ V M D+ +L+T V+ AL  V++  P        +  PA  
Sbjct: 6   SSSSLELTSDIVSAYVANNSVRMTDLPALLTRVYEALGNVLNPPPPAVEEA-PKATPAQ- 63

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           I+KSI    L    DG  +KSLKRHL T H MTP EYR K+ L   YPMV   YA  RS 
Sbjct: 64  IKKSITPDALISFIDGKPYKSLKRHL-TGHGMTPAEYREKFGLPPTYPMVPENYAKARSA 122

Query: 130 LAKNMGLGR 138
           LAK +GLG+
Sbjct: 123 LAKALGLGQ 131


>gi|16125185|ref|NP_419749.1| transcriptional regulator [Caulobacter crescentus CB15]
 gi|13422205|gb|AAK22917.1| transcriptional regulator [Caulobacter crescentus CB15]
          Length = 191

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/131 (43%), Positives = 81/131 (61%), Gaps = 5/131 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR-APCQDNVQPERLKPAVPIR 71
            +E+T +IVA YV+N+  P++++ +LI   H AL  + S  AP  + V   +  PA  IR
Sbjct: 56  LIELTAEIVANYVANNSTPVSELPALIRATHDALAGIGSPPAPTVEVVT--KATPAQ-IR 112

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           KSI    L   EDG  +K+LKRHL TH  MT  EY+ KW L +DYP  +  Y+  RS++A
Sbjct: 113 KSITPEALISFEDGKPYKTLKRHLTTH-GMTVAEYKAKWGLPNDYPTTAPAYSEARSQMA 171

Query: 132 KNMGLGRGRKK 142
           K +GLG+G +K
Sbjct: 172 KALGLGQGGRK 182


>gi|163852252|ref|YP_001640295.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|218531010|ref|YP_002421826.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|240139585|ref|YP_002964061.1| putative transcriptional regulator, MucR family [Methylobacterium
           extorquens AM1]
 gi|254561999|ref|YP_003069094.1| MucR family transcriptional regulator [Methylobacterium extorquens
           DM4]
 gi|163663857|gb|ABY31224.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|218523313|gb|ACK83898.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
 gi|240009558|gb|ACS40784.1| putative transcriptional regulator, MucR family [Methylobacterium
           extorquens AM1]
 gi|254269277|emb|CAX25243.1| putative transcriptional regulator, MucR family [Methylobacterium
           extorquens DM4]
          Length = 162

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 82/131 (62%), Gaps = 10/131 (7%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS----RAPCQDNVQPERLKPAV 68
           F+E+  DIV++YVSN+ VP +++  LI  VH+AL  + S     AP ++ ++    KP+ 
Sbjct: 12  FVELASDIVSSYVSNNSVPASELPGLIISVHTALTTLSSPEAVAAPAEEVIE----KPSS 67

Query: 69  -PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
             +RKS+    +    DG  +K+LKRHL TH  + P  YR ++ L +DYPMV+  YA  R
Sbjct: 68  GQVRKSVTPDAIISFIDGKPYKTLKRHLGTH-GLDPYSYRQRYGLPNDYPMVAPNYAAQR 126

Query: 128 SKLAKNMGLGR 138
           S LAK++GLGR
Sbjct: 127 SALAKSIGLGR 137


>gi|254418228|ref|ZP_05031952.1| ROS/MUCR transcriptional regulator protein [Brevundimonas sp. BAL3]
 gi|196184405|gb|EDX79381.1| ROS/MUCR transcriptional regulator protein [Brevundimonas sp. BAL3]
          Length = 848

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 58/75 (77%)

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVPIRKSI+   L CLEDG +FKSLKRHL+T +N++P+EY ++W L SDYPM +  YA 
Sbjct: 773 PAVPIRKSIQPDYLVCLEDGRRFKSLKRHLRTRYNLSPEEYIVRWGLPSDYPMQAPNYAR 832

Query: 126 TRSKLAKNMGLGRGR 140
            R++LA  MGLG G+
Sbjct: 833 ARAELAAQMGLGGGQ 847


>gi|170751058|ref|YP_001757318.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657580|gb|ACB26635.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 169

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 90/142 (63%), Gaps = 4/142 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MDD+A+ +  + F+E   DIV+AYVSN+ VP++++  L+  VH+AL ++ + A       
Sbjct: 1   MDDNAT-EQQQTFIEQASDIVSAYVSNNSVPISELPGLLAGVHAALTKLSAPAAAVTETA 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            ++  PA  IRKS+    L    DG  +K+LKRHL + + +T ++YR ++ L  DYP  +
Sbjct: 60  -DKPTPAQ-IRKSVTPDALISFIDGKPYKTLKRHL-SRNGLTIEQYRERFGLPRDYPSTA 116

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+  RS+LA+++GLG+ R+K
Sbjct: 117 ASYSAQRSELARSLGLGQQRRK 138


>gi|188584163|ref|YP_001927608.1| MucR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179347661|gb|ACB83073.1| transcriptional regulator, MucR family [Methylobacterium populi
           BJ001]
          Length = 178

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 83/130 (63%), Gaps = 5/130 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS-RAPCQDNVQPERLKPAVPIRK 72
           +E+  D+V+AYVSN+ +P  ++  LI  VH+AL  + + +AP ++ V  ER  PA  ++K
Sbjct: 13  IELAADLVSAYVSNNSLPSPELAGLIVQVHAALVALSAPQAPKEEEV--ERATPAQ-VKK 69

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L    DG  +K+LKRHL TH  +  + YR ++ L +DYP VS  Y+  RS LAK
Sbjct: 70  SITPDALISFIDGKPYKTLKRHLTTH-GLDIEGYRRRYGLPADYPTVSSNYSAARSALAK 128

Query: 133 NMGLGRGRKK 142
           ++GLG+ R+K
Sbjct: 129 DLGLGQQRRK 138


>gi|220923417|ref|YP_002498719.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948024|gb|ACL58416.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 174

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 63/147 (42%), Positives = 89/147 (60%), Gaps = 10/147 (6%)

Query: 1   MDDDASFDSSER---FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS-RAPCQ 56
           M+D+A   +S+     +E+  DIVAAYVSN+VV  AD+  LI  V   L  +    AP  
Sbjct: 1   MNDEAGAPTSQSEAGTIELVADIVAAYVSNNVVRPADLPDLIAAVSRTLGELGKPSAPAA 60

Query: 57  DNVQPERLKP-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASD 115
           +    E  KP A  IRKS+    +    DG  +KS+KRHL T + +TP EYR ++ L ++
Sbjct: 61  E----ETPKPTAAQIRKSVTPDHIVSFIDGKPYKSMKRHL-TKNGLTPAEYRQQYGLPAN 115

Query: 116 YPMVSREYATTRSKLAKNMGLGRGRKK 142
           YPMV+  YA  RS+LAK++GLG+ R+K
Sbjct: 116 YPMVAPNYAAQRSELAKSLGLGQLRRK 142


>gi|220920173|ref|YP_002495474.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219944779|gb|ACL55171.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 137

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 76/123 (61%), Gaps = 5/123 (4%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +T DIV+ Y+ N+ +   D+ +LI  VHSAL+ +  R    +  QP  L+P VPI +++ 
Sbjct: 8   ITADIVSLYIMNNSIGADDLPNLIRSVHSALEDI-DRV---EKPQPATLEPPVPIEQTVT 63

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              +  LEDG  +K+L RHL T   +TPD+YR KW L  DYPM++  YA  R++LAK   
Sbjct: 64  PDYIVSLEDGKPYKTLGRHLHTK-GLTPDQYRRKWGLPPDYPMIAPSYAAHRAELAKRGS 122

Query: 136 LGR 138
           LGR
Sbjct: 123 LGR 125


>gi|254563099|ref|YP_003070194.1| RosR/MucR family transcriptional regulator [Methylobacterium
           extorquens DM4]
 gi|254270377|emb|CAX26373.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens DM4]
          Length = 140

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 80/130 (61%), Gaps = 2/130 (1%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           ++E++  +V+AY SN+ V  AD+  LI  VHS L  + S A      Q E+  PA  I+K
Sbjct: 12  YVEISAGLVSAYASNNSVRAADLPELIRTVHSTLAALKSGAGQGGENQIEKPTPAQ-IKK 70

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L   EDG  +K+LKRHL  +  +TP+ YR K+ L +DYPM +  Y+  RS+LA+
Sbjct: 71  SITPDALISFEDGKPYKTLKRHL-ANRGLTPEAYREKYVLPADYPMTASGYSARRSELAR 129

Query: 133 NMGLGRGRKK 142
            +GLG+ RKK
Sbjct: 130 ALGLGQLRKK 139


>gi|58038297|ref|YP_190266.1| transcriptional regulator protein [Gluconobacter oxydans 621H]
 gi|58000711|gb|AAW59610.1| Transcriptional regulator protein [Gluconobacter oxydans 621H]
          Length = 165

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 77/122 (63%), Gaps = 4/122 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +T +IVAAY+S + V    +  LI  VHSAL   V  AP +  V+ +   P V  +KS+ 
Sbjct: 18  LTAEIVAAYLSRNDVAPDVLPGLIRSVHSAL--TVPTAP-EAAVE-DAPVPVVNPKKSVF 73

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              + CLEDG + K L+RHLKT +NMTPDEYR +W L  +YPMV+  Y+  R+ LA+ +G
Sbjct: 74  PDYIICLEDGKKLKMLRRHLKTAYNMTPDEYRARWGLPPEYPMVAPGYSAQRAALAREIG 133

Query: 136 LG 137
           LG
Sbjct: 134 LG 135


>gi|167645306|ref|YP_001682969.1| MucR family transcriptional regulator [Caulobacter sp. K31]
 gi|167347736|gb|ABZ70471.1| transcriptional regulator, MucR family [Caulobacter sp. K31]
          Length = 142

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 59/146 (40%), Positives = 83/146 (56%), Gaps = 17/146 (11%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS--RAPCQDN 58
           M+D A+       +E+T +IVA YV+N+   ++D+ +LI   H AL  + S   AP    
Sbjct: 1   MEDKATL------IELTAEIVANYVANNSTSVSDLPALIRATHDALAGIGSPEAAPV--- 51

Query: 59  VQPERLKPAVP--IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116
              E +  A P  IR+SI    L   EDG  +K+LKRHL TH  MT  EY+ KW L +DY
Sbjct: 52  ---ETVTKATPAQIRRSITPDALISFEDGKPYKTLKRHLTTH-GMTVAEYKAKWGLPNDY 107

Query: 117 PMVSREYATTRSKLAKNMGLGRGRKK 142
           P  +  Y+  RS +AK +GLG+G +K
Sbjct: 108 PTTAPAYSEARSAMAKALGLGQGGRK 133


>gi|170751279|ref|YP_001757539.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657801|gb|ACB26856.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 180

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 81/131 (61%), Gaps = 7/131 (5%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP--I 70
           F+E+T DIV+AYV+N+ VP+ D+ SL++ VH+AL  +        + +PE  K A P  I
Sbjct: 15  FVELTADIVSAYVANNSVPVPDLPSLLSGVHAALAGLGH---TTGSSEPE-FKKATPAQI 70

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           +KSI    L    DG  +K+LKRHL T + MT ++YR ++ L  DYP  +  Y+  R++ 
Sbjct: 71  KKSITPDALISFIDGKPYKTLKRHL-TGNGMTIEQYRQRYGLPPDYPTTASNYSAMRAEF 129

Query: 131 AKNMGLGRGRK 141
           A+N GLG  R+
Sbjct: 130 ARNAGLGHKRR 140


>gi|188580605|ref|YP_001924050.1| MucR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179344103|gb|ACB79515.1| transcriptional regulator, MucR family [Methylobacterium populi
           BJ001]
          Length = 166

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 83/142 (58%), Gaps = 6/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D+ S D     L +T DIVAAYVS + +  +++ SL+  VH A   +++    +   +
Sbjct: 1   MEDNTSPD----LLTITADIVAAYVSKNSIRASELPSLLVQVHGAFASLLAGPSAETGSE 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+  PA  I+KSI    L    DG  +++LKRHL  H  +T + YR ++ L +DYP V+
Sbjct: 57  IEKPTPAQ-IKKSITPDALISFVDGKPYRTLKRHLSVH-GLTIEAYRARYGLPNDYPSVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+ +RS LAK +GLG  RKK
Sbjct: 115 ANYSASRSALAKQLGLGNPRKK 136


>gi|170738927|ref|YP_001767582.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193201|gb|ACA15148.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 157

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 82/140 (58%), Gaps = 4/140 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           +++   S     +T  IV AYV+ + +  +D+  L+  V+S L  +    P +  V  E 
Sbjct: 11  ESTAPDSGALAGLTAGIVTAYVTGNALRASDMPHLVRSVYSTLATL--GGPAKPAVA-EA 67

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             P +PI+K++    +  LEDG  +KSLKRHL T   ++P+EYR KWNL  DYPMV+  Y
Sbjct: 68  PVPPIPIKKTVTRDAIISLEDGKPYKSLKRHL-TARGLSPEEYRRKWNLPPDYPMVAEVY 126

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           A  RS LA+ +GLG+ R ++
Sbjct: 127 AQRRSDLARVLGLGQIRSRK 146


>gi|222081607|ref|YP_002540971.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Agrobacterium radiobacter K84]
 gi|221726286|gb|ACM29375.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Agrobacterium radiobacter K84]
          Length = 154

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 76/131 (58%), Gaps = 5/131 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRA-PCQDNVQPERLKPAVPIR 71
            L+  V IV+A++S + V    +  LI DV++ L  + S     + N Q     PA  + 
Sbjct: 18  LLDGCVAIVSAFLSRNSVYANTVPRLIEDVYTTLFSLSSNTVALRQNGQ----SPAADLG 73

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
            S+    + CLEDG + K LKR+L+TH  +TPDEYR KW LASDYPMV+  YA  RS+LA
Sbjct: 74  ASLTGDYIVCLEDGKKVKLLKRYLRTHFGLTPDEYRAKWGLASDYPMVAPNYANRRSELA 133

Query: 132 KNMGLGRGRKK 142
           K  G G   ++
Sbjct: 134 KLSGFGENTRQ 144


>gi|83312396|ref|YP_422660.1| transcriptional regulatory protein Ros [Magnetospirillum magneticum
           AMB-1]
 gi|82947237|dbj|BAE52101.1| Transcriptional regulatory protein ros [Magnetospirillum magneticum
           AMB-1]
          Length = 159

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 76/128 (59%), Gaps = 4/128 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           + +   I AAY+ NH +P+ D+  LI   ++AL    + AP   +V  +R  PAVPI+KS
Sbjct: 6   MSLAARIAAAYLRNHEIPITDLPELIKATYAAL--AGTDAP--PSVDADRPIPAVPIKKS 61

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    + CLE G +   L+RHL T H ++ D YR KW L +DYPM +  Y+  RS++A  
Sbjct: 62  ITPDAVTCLECGKKQMMLRRHLLTSHGLSVDAYRSKWALPADYPMAAPNYSQKRSEMAIQ 121

Query: 134 MGLGRGRK 141
           +GLGR  K
Sbjct: 122 IGLGRKPK 129


>gi|220925469|ref|YP_002500771.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219950076|gb|ACL60468.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 174

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 88/147 (59%), Gaps = 10/147 (6%)

Query: 1   MDDDASFDSSER---FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRA-PCQ 56
           M+D+A   +S+     +E+  DIV+AYVSN+VV  AD+  LI  V   L  +   + P  
Sbjct: 1   MNDEAGAPTSQSEAGTIELVADIVSAYVSNNVVRPADLPDLIAAVSRTLGELGKPSVPAA 60

Query: 57  DNVQPERLKP-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASD 115
           +    E  KP A  IRKSI    +    DG  +KS+KRHL T + +TP EYR ++ L + 
Sbjct: 61  E----ETPKPTAAQIRKSITPDHIVSFIDGKPYKSMKRHL-TKNGLTPAEYRQQYGLPAS 115

Query: 116 YPMVSREYATTRSKLAKNMGLGRGRKK 142
           YPMV+  YA  RS+LAK++GLG+ R+K
Sbjct: 116 YPMVAPNYAAQRSELAKSLGLGQLRRK 142


>gi|330990810|ref|ZP_08314766.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329762250|gb|EGG78738.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 204

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 69/113 (61%), Gaps = 2/113 (1%)

Query: 26  SNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDG 85
           +N  +P   + + I DV++A++        + N      +PAVP+ +S+    + CLEDG
Sbjct: 8   TNTSLPTEHVPAFIRDVYAAIRETTPA--TEKNSSIPAQQPAVPVGQSVFPDHIVCLEDG 65

Query: 86  MQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGR 138
            + K LKRHL+T + MTP +YR KW L  DYPMV+ EYA  R+ LA++ GLGR
Sbjct: 66  KKLKMLKRHLQTRYGMTPTQYREKWQLPMDYPMVAPEYAKMRATLARDAGLGR 118


>gi|170739458|ref|YP_001768113.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193732|gb|ACA15679.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 174

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 76/136 (55%), Gaps = 4/136 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E   DIV+AYVSN+ V   ++  LI  +H+ALQ +   A       P+    A  IR+
Sbjct: 15  LIEQAADIVSAYVSNNRVTAGELPGLIASLHAALQDLGKPATPPAEETPKAT--AAQIRR 72

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L    DG  +K LKRHL TH  +TP EYR K+ L  DYPMV+  +   RS++AK
Sbjct: 73  SITPDALISFVDGKPYKVLKRHLTTH-GLTPAEYRQKFGLPGDYPMVAPSFTARRSEIAK 131

Query: 133 NMGLGRGRKKRVLTSK 148
           + GLG+ R+ R    K
Sbjct: 132 SSGLGQ-RRPRAAAEK 146


>gi|118592702|ref|ZP_01550092.1| Transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118434753|gb|EAV41404.1| Transcriptional regulator [Stappia aggregata IAM 12614]
          Length = 91

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 60/82 (73%)

Query: 57  DNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116
           +  + ERL P VPI+KS++   + CLED  +FKSLKRHL+  +N+T +EYR +W L +DY
Sbjct: 3   EEPEAERLIPTVPIKKSVQPDYIVCLEDDKRFKSLKRHLRAAYNLTSEEYRARWGLEADY 62

Query: 117 PMVSREYATTRSKLAKNMGLGR 138
           PMV+  YA  RS++A+ +GLGR
Sbjct: 63  PMVAPNYAAARSEIAEELGLGR 84


>gi|218528150|ref|YP_002418966.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218520453|gb|ACK81038.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 197

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 78/133 (58%), Gaps = 9/133 (6%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP---ERLKPA 67
           +R + +  +IV AYV+ + V  A++  L+  VH+ L  + S      +V+P    R   A
Sbjct: 9   DRLVTLATEIVTAYVTRNHVQAAELPGLLRSVHAGLLTLSS-----GSVEPAEERRTLTA 63

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
             IR+SI+   L   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM +  Y+  R
Sbjct: 64  TEIRRSIQPEGLISFEDGKAYKTLRRHL-TKRGLTPEAYRAKWGLPVDYPMTASAYSAQR 122

Query: 128 SKLAKNMGLGRGR 140
           S+LA+++GLGR R
Sbjct: 123 SQLARDLGLGRSR 135


>gi|163849624|ref|YP_001637667.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|163661229|gb|ABY28596.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
          Length = 186

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 75/130 (57%), Gaps = 3/130 (2%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           +R + +  +IV AYV+ + V  A++  L+  VHS L R+ S    +   +P  L  A  I
Sbjct: 9   DRLVTLATEIVTAYVTRNQVQAAELPGLLRSVHSGLLRL-SSGSGEPTEEPRTLT-ATEI 66

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           R+SI    L   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM +  Y+  RS+L
Sbjct: 67  RRSIRPEGLISFEDGKAYKTLRRHL-TKRGLTPEAYRAKWGLPVDYPMTASAYSAQRSQL 125

Query: 131 AKNMGLGRGR 140
           A + GLGR R
Sbjct: 126 ALDRGLGRPR 135


>gi|170751235|ref|YP_001757495.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657757|gb|ACB26812.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 146

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 82/138 (59%), Gaps = 5/138 (3%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQ---DNVQ 60
           D++  S +  +E+T  +VAAYVSN+ V   D+ +LI   H A+  + +R        ++ 
Sbjct: 3   DSTLVSPQTNIELTAGLVAAYVSNNRVSAGDLPALIAQCHDAITALANRGEASIAAADLD 62

Query: 61  PERLKP-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             R +P A  IR SI    +    DG ++K+LKRHL T H + P  YR ++ L +DYPMV
Sbjct: 63  ALRDRPSAAQIRNSIRPDAIVSFIDGRRYKTLKRHL-TAHGLHPQSYRERYGLPADYPMV 121

Query: 120 SREYATTRSKLAKNMGLG 137
           ++EYA  RS LA+++GLG
Sbjct: 122 AQEYAERRSALARSIGLG 139


>gi|170743650|ref|YP_001772305.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197924|gb|ACA19871.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 156

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 82/144 (56%), Gaps = 9/144 (6%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           ++D  +  S    +++  DIVAAYVSN++V   D+ SLI  V + L  +   A       
Sbjct: 11  VNDGNAVSSDAVSIKLVADIVAAYVSNNMVRPDDLPSLIAAVGATLGDLGKSA-----AP 65

Query: 61  PERLKP-AVP--IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
           P   KP A P  IRKSI    L    D   +KS+KRHL T + +TPDEYR  + L  DYP
Sbjct: 66  PAEEKPKATPTQIRKSITPDALISFIDAKPYKSMKRHL-TKNGLTPDEYRQMYGLPRDYP 124

Query: 118 MVSREYATTRSKLAKNMGLGRGRK 141
           MV+  YA  RS+LAK+MGLG  R+
Sbjct: 125 MVAPNYAAQRSELAKSMGLGALRR 148


>gi|170750632|ref|YP_001756892.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657154|gb|ACB26209.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 151

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/137 (42%), Positives = 81/137 (59%), Gaps = 5/137 (3%)

Query: 6   SFD-SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVV--SRAPCQDNVQPE 62
           +FD +S     MT ++VAAYVSN+ VP A++ +LI  VH A+  +V  +        Q E
Sbjct: 4   TFDETSNTLAAMTAELVAAYVSNNPVPAAELPALIVRVHGAISGLVAGTPTAAGAAPQVE 63

Query: 63  RLKP-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
             KP A  IRKS+ +  +    DG  +K+LKRHL + H + P  YR  + L +DYPMV+ 
Sbjct: 64  VEKPSATQIRKSVRHDGIVSFIDGKLYKTLKRHLAS-HGLDPRSYRDSYGLPTDYPMVAP 122

Query: 122 EYATTRSKLAKNMGLGR 138
            YA  RS LAK +GLG+
Sbjct: 123 GYAEQRSALAKAIGLGQ 139


>gi|220923416|ref|YP_002498718.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948023|gb|ACL58415.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 131

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/131 (39%), Positives = 79/131 (60%), Gaps = 5/131 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +S    +++   IV+AYVSN+ +P +++  LI  +H+A+ R+   A          +   
Sbjct: 4   ESRTNHIDLASAIVSAYVSNNSMPASELPGLIQSIHTAVNRLAQPAVPDPEKPVPPVP-- 61

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
             ++K+I    +  LEDG  +KSLKRHL T   +TP++YR KW L  DYPMV+  YA  R
Sbjct: 62  --VKKTITPDAIISLEDGKPYKSLKRHLTTR-GLTPEQYRQKWGLPPDYPMVAANYAVQR 118

Query: 128 SKLAKNMGLGR 138
           S+LAK++GLGR
Sbjct: 119 SELAKSIGLGR 129


>gi|220920120|ref|YP_002495421.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219944726|gb|ACL55118.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 174

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/142 (41%), Positives = 83/142 (58%), Gaps = 8/142 (5%)

Query: 1   MDDDASF---DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVV-SRAPCQ 56
           MD++A           +E+   IV+AYVSN+VVP A++  LI  V   L  +  S AP  
Sbjct: 1   MDEEAGTVTPGPGAETIELVAGIVSAYVSNNVVPPAELPDLIAMVSRTLGELGKSSAPAA 60

Query: 57  DNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116
           + +   +L  A  IRKSI    +    DG  +KS+KRHL T + ++PD YR K+ L  DY
Sbjct: 61  EEIP--KLT-AAQIRKSITPDHIVSFIDGKPYKSMKRHL-TKNGLSPDAYRQKYGLPHDY 116

Query: 117 PMVSREYATTRSKLAKNMGLGR 138
           PMV+  YA  RS+LAK++GLG+
Sbjct: 117 PMVAPNYAAQRSELAKSLGLGQ 138


>gi|220914715|ref|YP_002490023.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952466|gb|ACL62856.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 174

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 85/146 (58%), Gaps = 8/146 (5%)

Query: 1   MDDDASFDSSER---FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVV-SRAPCQ 56
           M+D A   +S+     +E+   I++AYVSN++VP AD+ +LI      L  +    AP  
Sbjct: 1   MNDKADVSTSQPGADTIELVAAIISAYVSNNIVPPADLPALIATAGQTLGELGKPSAPAA 60

Query: 57  DNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116
           +     +L  A  IRKS+    +    DG  +K++KRHL T + +TP EYR  + L  DY
Sbjct: 61  EET--PKLT-AAQIRKSVTPDHIISFIDGKPYKAMKRHL-TKNGLTPAEYRQTYGLPGDY 116

Query: 117 PMVSREYATTRSKLAKNMGLGRGRKK 142
           P+V+  YA  RS+LAK++GLG+ R+K
Sbjct: 117 PIVAPNYAAQRSELAKSLGLGQLRRK 142


>gi|58038420|ref|YP_190388.1| MucR family transcriptional regulator [Gluconobacter oxydans 621H]
 gi|58000834|gb|AAW59732.1| transcriptional regulator, MucR family [Gluconobacter oxydans 621H]
          Length = 165

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 70/122 (57%), Gaps = 4/122 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +T  IVAAY+S + V    +  LI  VH+AL          +      + P    +KS+ 
Sbjct: 18  LTAKIVAAYLSRNDVAPDVLPGLIRSVHTALTVPAVSEAAAEEAPVPVVNP----KKSVF 73

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              + CLEDG + K L+RHLKT +NMTPDEYR +W L  +YPMV+  Y+  RS LA+ +G
Sbjct: 74  PDYIICLEDGKKLKMLRRHLKTAYNMTPDEYRARWGLPPEYPMVAPGYSAQRSALAREIG 133

Query: 136 LG 137
           LG
Sbjct: 134 LG 135


>gi|170750764|ref|YP_001757024.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657286|gb|ACB26341.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 150

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 77/131 (58%), Gaps = 3/131 (2%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP-ERLKP 66
           ++S R + +  +IVAAYVSN+ VP   +  L+  VH+AL  +  + P        ER  P
Sbjct: 7   ENSLRLVTLVGEIVAAYVSNNSVPPTALPELMASVHAALAALDGQPPAAAAEPAVERPTP 66

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           A  IRKS++   +    DG  +K+LKRHL T H +TP+ YR ++ L  DYPM +  YA  
Sbjct: 67  AQ-IRKSVQEDGIVSFIDGRTYKTLKRHL-TAHGLTPERYRERYGLPDDYPMTAPGYAAQ 124

Query: 127 RSKLAKNMGLG 137
           RS LAK +GLG
Sbjct: 125 RSALAKAIGLG 135


>gi|220921285|ref|YP_002496586.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219945891|gb|ACL56283.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 148

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 73/130 (56%), Gaps = 4/130 (3%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           DA     E  + +T D+++AYVSN+ V   D+  LIT+VH+A+   + R   Q    P R
Sbjct: 2   DAKNQKPESAVALTADVISAYVSNNHVQADDLVRLITEVHAAIT-AIGRG--QKAPDPAR 58

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
                 IR+SI    L   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM S  Y
Sbjct: 59  KPTPAEIRRSIGRDVLISFEDGKPYKTLRRHL-TMRGLTPESYRRKWGLPLDYPMTSASY 117

Query: 124 ATTRSKLAKN 133
           +  RS+LA+ 
Sbjct: 118 SEQRSQLART 127


>gi|163851861|ref|YP_001639904.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|163663466|gb|ABY30833.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
          Length = 143

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 84/143 (58%), Gaps = 5/143 (3%)

Query: 1   MDDDASFDSSERF-LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV--VSRAPCQD 57
           M ++AS D  +   +++ V+I++AY+ N+V+P  ++ +LI  VH+AL  +     AP  +
Sbjct: 1   MANNASEDPPDNGSIKLAVEIISAYLGNNVLPSKELPALIAGVHAALSGIGKAPAAPDAE 60

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
            ++ E+  PA  IRKS+    L    DG  +K+LKRHL  H  +TP  Y  ++ L +DYP
Sbjct: 61  KIEIEKPTPAQ-IRKSVTPDALISFIDGKPYKTLKRHLAVH-GLTPHAYCERYGLPADYP 118

Query: 118 MVSREYATTRSKLAKNMGLGRGR 140
             +  Y+  RS +AK  GLG+ R
Sbjct: 119 TTAPNYSAQRSAMAKGFGLGQRR 141


>gi|170751556|ref|YP_001757816.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170658078|gb|ACB27133.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 190

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 79/133 (59%), Gaps = 11/133 (8%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV----VSRAPCQDNVQPERLKPAV 68
            +++T +IVAAYVSN+ V  AD+ +L+++VH+A+  +     + AP  +   P +     
Sbjct: 15  VIDLTANIVAAYVSNNSVRPADLPALLSEVHAAITGLNGTSATAAPAVEKATPSQ----- 69

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            IRKSI    L    DG  +K+LKRH+ T   MT +EYR ++ L  DYP  +  Y+  RS
Sbjct: 70  -IRKSITPDALISFIDGKPYKTLKRHI-TGAGMTIEEYRERFGLPRDYPSTAANYSAQRS 127

Query: 129 KLAKNMGLGRGRK 141
            LAK++GLG  R+
Sbjct: 128 ALAKSLGLGNQRR 140


>gi|220924528|ref|YP_002499830.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219949135|gb|ACL59527.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 139

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 69/123 (56%), Gaps = 5/123 (4%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           MT DI+A Y+ N+     ++  LI  VHSAL+ +  R      VQ     P VPI  ++ 
Sbjct: 8   MTADIIALYLINNACSTQELPELIRSVHSALEDI-ERTSKPVEVQ---EAPPVPIETTVT 63

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              +  LEDG  +K+L RHL T   +TP++YR KW L  DYPM++  YA  R+ LAK  G
Sbjct: 64  PDYIISLEDGKPYKTLGRHLHTR-GLTPEQYRRKWGLPPDYPMIAPTYAAERAALAKRGG 122

Query: 136 LGR 138
            GR
Sbjct: 123 FGR 125


>gi|220925468|ref|YP_002500770.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219950075|gb|ACL60467.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 133

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 73/123 (59%), Gaps = 5/123 (4%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           M  +IV+AYVS++ +P  ++ +LI  V+  L ++   A  +       +     I+K+I 
Sbjct: 14  MVAEIVSAYVSHNNLPAGELPTLIRSVYDQLGKLARPAEPEPEKPVPPVP----IKKTIT 69

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              +  LEDG  +KSLKRHL T   +TP++YR KW L  DYPMV+  YA  RS+LAK  G
Sbjct: 70  PDAIISLEDGKPYKSLKRHLSTR-GLTPEQYRQKWGLPQDYPMVAANYAAQRSELAKATG 128

Query: 136 LGR 138
           LGR
Sbjct: 129 LGR 131


>gi|330990194|ref|ZP_08314172.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329762740|gb|EGG79206.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 230

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 73/127 (57%), Gaps = 6/127 (4%)

Query: 20  IVAAYVSNH--VVPMADIGSLITDVHSALQRVVSRA----PCQDNVQPERLKPAVPIRKS 73
           IV+AY+ N    +P   I  LI  V +A++  ++      P        +  PAVP+ ++
Sbjct: 18  IVSAYLGNPQTALPPDAIPLLIRSVTAAVREDIASGTEAVPSPALPAGTKPVPAVPLSET 77

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    + CLEDG +FK +KRHLK  + MTP++YR KW L  DYPM +  YA  R+ LA+ 
Sbjct: 78  IFPDHIVCLEDGKKFKMMKRHLKRVYQMTPEQYRQKWGLPPDYPMTAPAYAEQRATLARK 137

Query: 134 MGLGRGR 140
           +GLGR R
Sbjct: 138 IGLGRPR 144


>gi|170738626|ref|YP_001767281.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168192900|gb|ACA14847.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 151

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 74/133 (55%), Gaps = 6/133 (4%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S  ++ +   +T DI  AY+S + +   ++  LI ++H AL+      P Q+       K
Sbjct: 4   SNTNAAKLAALTADIATAYLSRNHLQTGEVPRLIAEIHGALRVASHGTPVQEGPP----K 59

Query: 66  P-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           P A  IR+S+    L   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM S EY+
Sbjct: 60  PTASEIRRSVTPEALISFEDGKPYKTLRRHL-TRLGLTPETYRQKWGLPPDYPMTSAEYS 118

Query: 125 TTRSKLAKNMGLG 137
             RS+LA+ + LG
Sbjct: 119 KRRSELARALTLG 131


>gi|330990398|ref|ZP_08314361.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329762525|gb|EGG79006.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 131

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 65/118 (55%), Gaps = 5/118 (4%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D +     ++   E+T  IVAAYVS++ VP   +  LI  V  AL       P Q     
Sbjct: 3   DHETRSSEADTLRELTTRIVAAYVSSNTVPADTLPGLIASVFQALG-----GPGQATTGT 57

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             + PAVP++KS+    + CLEDG + K LKRHL+T + MTP++YR KW L   YPM 
Sbjct: 58  PDMVPAVPVKKSVFPDYIVCLEDGKKMKMLKRHLRTVYGMTPEQYREKWGLPESYPMT 115


>gi|170744771|ref|YP_001773426.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168199045|gb|ACA20992.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 156

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 73/126 (57%), Gaps = 3/126 (2%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           + VDIVAAYVSN+ V   D+ +LI  V + L  +   A       P +  PA  IRKSI 
Sbjct: 26  LVVDIVAAYVSNNSVRPDDLPNLIASVGATLGDLGKPAAPPAEETP-KATPAQ-IRKSIT 83

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              L    D   +KS+KRHL T + +TPDEYR ++ L  DYP V+  YA  RS+LAK +G
Sbjct: 84  PDALISFIDAKPYKSMKRHL-TKNGLTPDEYRQRYGLPRDYPTVAPNYAAQRSELAKQLG 142

Query: 136 LGRGRK 141
           LG  R+
Sbjct: 143 LGANRR 148


>gi|218533382|ref|YP_002424197.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218525685|gb|ACK86269.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 170

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 87/146 (59%), Gaps = 4/146 (2%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           +  + +E  L  +VDIV AYV+N+ +  A++  LI  VH+ALQ++ + AP     +P+  
Sbjct: 6   SGVEQNETILNRSVDIVLAYVNNNHIQSAELPGLIRVVHTALQQIAN-APAGP-TEPQFG 63

Query: 65  KPA-VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           KP+   IR+SI    L    DG  +++LKRHL T + +  + YR ++ L  DYP  S  Y
Sbjct: 64  KPSPSAIRRSITPEGLISFIDGKSYQTLKRHL-TKNGLDINGYRARYGLPIDYPSTSSNY 122

Query: 124 ATTRSKLAKNMGLGRGRKKRVLTSKV 149
           + TR++LA++MGLGR   + + T  V
Sbjct: 123 SATRAELARSMGLGRKVNRSLKTDAV 148


>gi|118592655|ref|ZP_01550045.1| transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118434706|gb|EAV41357.1| transcriptional regulator [Stappia aggregata IAM 12614]
          Length = 109

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 49/109 (44%), Positives = 74/109 (67%), Gaps = 5/109 (4%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           +D+S ++S   +++T DIV AYVSN++V   ++  LI  VH   Q + + A   +  + E
Sbjct: 2   NDSSVETS--LIDLTSDIVTAYVSNNMVTTTELTDLIGSVH---QALHAAAAVAEEPEAE 56

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWN 111
           RL PAV I+KS++   + CLEDG +FKSLKRHL++ +N+TP+EYR KW 
Sbjct: 57  RLIPAVAIKKSVQPDYIVCLEDGKRFKSLKRHLRSTYNLTPEEYRGKWG 105


>gi|170740145|ref|YP_001768800.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168194419|gb|ACA16366.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 156

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP-AVP--I 70
           + +   IVAAYVSN+ V   D+ SLI  V + L  +   A       P   KP A P  I
Sbjct: 24  ISLVAGIVAAYVSNNSVRPDDLPSLIAAVGATLGDLGKPA-----APPVEEKPKATPTQI 78

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           RKSI    L    D   +KS+KRHL T + +TPDEYR  + L  DYPMV+  YA  RS+L
Sbjct: 79  RKSITPDALISFIDAKPYKSMKRHL-TKNGLTPDEYRQMYGLPRDYPMVAPNYAAQRSEL 137

Query: 131 AKNMGLGRGRK 141
           AK+MGLG  R+
Sbjct: 138 AKSMGLGAIRR 148


>gi|162148657|ref|YP_001603118.1| ROS/MUCR transcriptional regulator protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787234|emb|CAP56827.1| putative ROS/MUCR transcriptional regulator protein
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 149

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 53/73 (72%)

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVPI++S+    + CLEDG + K LKRHL + + MTP +YR +W L +DYPMV+  YAT
Sbjct: 29  PAVPIKRSVFPDYIVCLEDGKKLKMLKRHLSSAYGMTPGQYRERWGLPADYPMVAPNYAT 88

Query: 126 TRSKLAKNMGLGR 138
            RS+LA+  GLG+
Sbjct: 89  RRSELARASGLGQ 101


>gi|255624718|ref|XP_002540518.1| Transcriptional regulatory protein ros, putative [Ricinus communis]
 gi|223495226|gb|EEF21865.1| Transcriptional regulatory protein ros, putative [Ricinus communis]
          Length = 152

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 69/121 (57%), Gaps = 2/121 (1%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIR 71
           + +E+T +IVA YV+N+  P+ D+ SLI   H AL  + S A  +      ++ PA  IR
Sbjct: 7   KLIELTAEIVANYVANNSTPVNDLPSLIKATHDALAGIESGASAEPEEAVAKVTPAQ-IR 65

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           KSI    L    DG  +K+LKRHL TH   T  EY+ K+ L +DYP  +  Y+  RS +A
Sbjct: 66  KSITPDALISFIDGKPYKTLKRHLTTH-GTTIAEYKAKYGLPNDYPTTAPNYSAARSAMA 124

Query: 132 K 132
           K
Sbjct: 125 K 125


>gi|218459461|ref|ZP_03499552.1| putative nodulation competitiveness transcriptional regulator
           [Rhizobium etli Kim 5]
          Length = 67

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 50/62 (80%)

Query: 81  CLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGR 140
           CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+  YA  RS+LAK MGLG+ R
Sbjct: 3   CLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVAPAYAEARSRLAKEMGLGQRR 62

Query: 141 KK 142
           K+
Sbjct: 63  KR 64


>gi|240142007|ref|YP_002966517.1| putative transcriptional regulator, MucR family [Methylobacterium
           extorquens AM1]
 gi|240011951|gb|ACS43176.1| putative transcriptional regulator, MucR family [Methylobacterium
           extorquens AM1]
          Length = 198

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 75/129 (58%), Gaps = 4/129 (3%)

Query: 16  MTVDIVAAYV-SNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA-VPIRKS 73
           +  DI++AYV  NHV P AD+  L+  VH++++ + + +      + E  KP    IRKS
Sbjct: 17  LASDIISAYVVRNHVAP-ADLPGLLRSVHASIESLGNGSAQSAAAEEEVEKPTPAQIRKS 75

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    L    DG  +K+LKRHL T+  + P  YR ++ L  DYPMV   YA  RS+LAK 
Sbjct: 76  ITPDGLISFIDGKAYKTLKRHLSTN-GLDPYSYRARYGLPHDYPMVDANYAAQRSQLAKA 134

Query: 134 MGLGRGRKK 142
           +GLGR  +K
Sbjct: 135 LGLGRTGEK 143


>gi|218529586|ref|YP_002420402.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218521889|gb|ACK82474.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 145

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 79/141 (56%), Gaps = 7/141 (4%)

Query: 2   DDD--ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV--VSRAPCQD 57
           DDD   +  ++   +  T  I AAYV+ + +   D   LIT VH+AL  +   S  P  +
Sbjct: 3   DDDFKGAATNNADIIYQTAAITAAYVTKNTISATDFPGLITRVHAALAGLGGASATPVAE 62

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
             + E+  PA  IRKSI    +    DG  +K+LKRHL  +  + P  YR ++ L +DYP
Sbjct: 63  -AEIEKATPA-QIRKSITPDAIVSFIDGKAYKTLKRHLGAN-GLDPHSYRHRYGLPNDYP 119

Query: 118 MVSREYATTRSKLAKNMGLGR 138
           MV+  YA  RS+LAK++G+GR
Sbjct: 120 MVAPNYAARRSELAKSLGVGR 140


>gi|83310023|ref|YP_420287.1| transcriptional regulator [Magnetospirillum magneticum AMB-1]
 gi|82944864|dbj|BAE49728.1| Predicted transcriptional regulator [Magnetospirillum magneticum
           AMB-1]
          Length = 137

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (60%), Gaps = 4/109 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +T  IVAAY+S+  +   +I +LI  V+S L    + A    +   ER +PAV +++S+ 
Sbjct: 8   LTAKIVAAYLSSSTLAATEIPTLIKSVYSTLAATDNPA----SAPAERQQPAVSVKRSVT 63

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
              + CLE G + K LKRHL T H +T DEYR KW L  DYP+V+ EYA
Sbjct: 64  PDYIVCLECGDRQKVLKRHLTTGHGLTADEYRAKWALPRDYPLVAPEYA 112


>gi|260464128|ref|ZP_05812322.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259030113|gb|EEW31395.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 138

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 51/125 (40%), Positives = 75/125 (60%), Gaps = 5/125 (4%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           LE T  IV+A+VS +    +D+  L+ +V  ALQ +   A   +  +P ++ PAVPI KS
Sbjct: 9   LESTAKIVSAFVSRNRASPSDLVDLVENVGRALQAL---AGGTEKSKP-KIVPAVPISKS 64

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    +  LEDG + KSLKR+L +   MTP +YR KW L  DYP+V+  +   RS+ AK 
Sbjct: 65  VTPDFIISLEDGRRMKSLKRYLASL-GMTPADYRRKWGLPPDYPLVAPNFTALRSQAAKR 123

Query: 134 MGLGR 138
           + LG+
Sbjct: 124 IRLGQ 128


>gi|170745597|ref|YP_001776819.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170752154|ref|YP_001783300.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659251|gb|ACB28303.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659281|gb|ACB28332.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 151

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 72/130 (55%), Gaps = 11/130 (8%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR----APCQDNVQPERL 64
           S+  +  MT  +V+AYV  + VP++D+ +LI     AL  + +     AP      P + 
Sbjct: 11  SAADYGRMTAHLVSAYVRRNNVPVSDLATLIASAADALIGLTNSDTPAAPAASKTTPAQ- 69

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
                IR SI +  L   EDG ++++LKRHL T H +TP+ YR KW L  DYPMV+  Y+
Sbjct: 70  -----IRASITHEALISFEDGKRYQTLKRHL-TVHGLTPETYRAKWGLPRDYPMVAPGYS 123

Query: 125 TTRSKLAKNM 134
             RS +A ++
Sbjct: 124 ERRSAIATSL 133


>gi|328952055|ref|YP_004369389.1| transcriptional regulator, MucR family [Desulfobacca acetoxidans
           DSM 11109]
 gi|328452379|gb|AEB08208.1| transcriptional regulator, MucR family [Desulfobacca acetoxidans
           DSM 11109]
          Length = 146

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 78/140 (55%), Gaps = 9/140 (6%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN--VQPER------L 64
            L+MT  I+ ++ S   +   ++ S I  V++ L  +   A    +  V P        L
Sbjct: 5   LLKMTAQIITSHASISELSSQELISEIKSVYNTLAELAGEAATAPSPEVTPTETKGMTGL 64

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNL-ASDYPMVSREY 123
           KPA+P+ +S+++  + CLE G +FK+LK HL+  H MTP +Y  ++ L A  YP+VSR Y
Sbjct: 65  KPAIPVEESLQDDYIVCLECGQKFKTLKAHLRRAHQMTPADYYERFGLDAKKYPLVSRNY 124

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           +  R +LAK  GLG  R+ +
Sbjct: 125 SEQRRQLAKEKGLGDFRRSK 144


>gi|148550629|ref|YP_001260068.1| MucR family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148503048|gb|ABQ71301.1| transcriptional regulator, MucR family [Sphingomonas wittichii RW1]
          Length = 308

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 79/146 (54%), Gaps = 18/146 (12%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSAL---QRVVSRAPCQDNVQP-------- 61
            + +TV +++AY +N+ VP +++ +L+     AL     VVS AP +    P        
Sbjct: 9   VMSLTVALLSAYFANNTVPSSELPALVEGTRKALLGDAPVVSPAPEETVSAPVSVEPAAV 68

Query: 62  -----ERLKPAVPIRKSIENG-CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASD 115
                   KPAV +  S+ +   +  L DG  +KSLKRHL TH  +TP EYR +++L +D
Sbjct: 69  PPTPAPEFKPAVTVDASLASPDQILSLIDGKPYKSLKRHLSTH-GLTPAEYRARYDLPAD 127

Query: 116 YPMVSREYATTRSKLAKNMGLGRGRK 141
           YPMV+  Y+  R + A  +GLG  RK
Sbjct: 128 YPMVAPGYSAARREAALKLGLGGKRK 153


>gi|220925328|ref|YP_002500630.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219949935|gb|ACL60327.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 147

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 73/133 (54%), Gaps = 4/133 (3%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           ++F ++ +   +T DI  AY+S + +   ++  LI ++H+AL              P + 
Sbjct: 3   STFPNAGKLAVLTADIATAYLSRNHLQSGELPRLIGEIHAALHSAAQGTTAPSG--PPKP 60

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
            PA  IR+SI    L   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM   +Y+
Sbjct: 61  TPAE-IRRSITYDALISFEDGKPYKTLRRHL-TRLGLTPEAYREKWGLPPDYPMTCADYS 118

Query: 125 TTRSKLAKNMGLG 137
             RS+LA+ + LG
Sbjct: 119 KRRSELARALTLG 131


>gi|170752190|ref|YP_001783335.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659317|gb|ACB28367.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 151

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 72/138 (52%), Gaps = 3/138 (2%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D  A+  S+  +  MT  +V+AYV N+ VP +D+  LI     AL  +    P       
Sbjct: 4   DTIANAISAHDYGRMTATLVSAYVRNNHVPASDLAELIASAADAL--IGLGTPDASTAST 61

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
                   IR+S+ +  L   EDG ++K+LKRHL T   +TP+ YR KW L  DYPMV+ 
Sbjct: 62  AGKVTQAEIRRSVTHEALISFEDGKRYKTLKRHLTTC-GLTPETYRAKWGLPLDYPMVAP 120

Query: 122 EYATTRSKLAKNMGLGRG 139
            Y+  RS +A ++   RG
Sbjct: 121 GYSQRRSAIAASLQFNRG 138


>gi|170752166|ref|YP_001783312.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659293|gb|ACB28344.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 147

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/127 (38%), Positives = 74/127 (58%), Gaps = 11/127 (8%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV----VSRAPCQDNVQPERLKPAVPIR 71
           +T  ++AA+VS++ V  +D+ SLI   H+A+  +     S AP      P +      IR
Sbjct: 16  LTTRVIAAFVSHNHVAASDVPSLIALTHAAIASLQTAGSSTAPGTVKATPAQ------IR 69

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
            SI    L   EDG ++K+LKRHL T   +TP+ YR KW L +DYP+V+  YA  RS++A
Sbjct: 70  ASITYEALISFEDGKRYKTLKRHL-TACGLTPETYRAKWGLPNDYPLVAPGYAEKRSRIA 128

Query: 132 KNMGLGR 138
           K++ + R
Sbjct: 129 KSLVMPR 135


>gi|170750265|ref|YP_001756525.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656787|gb|ACB25842.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 146

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 75/132 (56%), Gaps = 13/132 (9%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN----VQPERLK 65
           S   LE    IVAAYVS + + +  + +LI  VH+A+  V+ RAP         QP+   
Sbjct: 20  STFMLEKVGAIVAAYVSRNAIEVTALPALIDQVHAAIA-VLRRAPSDFGGVGLSQPQ--- 75

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
               +  SI++  L    DG  +++LKRHL T H +TP+ YR K+ L +DYPMV+  YA 
Sbjct: 76  ----VEASIQDTGLISFIDGRSYQTLKRHL-TAHGLTPERYRAKYGLPADYPMVAPGYAA 130

Query: 126 TRSKLAKNMGLG 137
            RS++A+ + LG
Sbjct: 131 RRSEIARAIQLG 142


>gi|170748085|ref|YP_001754345.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654607|gb|ACB23662.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 142

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 75/135 (55%), Gaps = 3/135 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           ++ + D +   ++ T  +VAAYVS + V + D+  LI  VH+A+   V +     +    
Sbjct: 7   NEKTSDPNTDLIKCTASLVAAYVSRNAVGVGDLPVLIDQVHTAIS--VLQGGGSGSGPGW 64

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
               A  I  SI+   L    DG  +K+LKRHL T H +TP+ YR K+ L +DYPMV+  
Sbjct: 65  TGPTAAQIEASIQQDGLISFIDGRSYKTLKRHL-TAHGLTPERYRAKYGLPADYPMVAPG 123

Query: 123 YATTRSKLAKNMGLG 137
           YA  RS++AK + LG
Sbjct: 124 YAAKRSEIAKAIQLG 138


>gi|240142322|ref|YP_002966832.1| putative transcriptional regulator MucR [Methylobacterium
           extorquens AM1]
 gi|240012266|gb|ACS43491.1| putative transcriptional regulator MucR [Methylobacterium
           extorquens AM1]
          Length = 163

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 70/122 (57%), Gaps = 9/122 (7%)

Query: 20  IVAAYVSNHVVPMADIGSLITDVHSALQRVV----SRAPCQDNVQPERLKPAVPIRKSIE 75
           IV AYV+N+ +P   + SLI  V S L  +     S  P +D  +P     +  +RKSI 
Sbjct: 18  IVRAYVANNSIPAGGLPSLIVSVDSTLAGIANGQTSPKPAEDVSKPT----SAQVRKSIG 73

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              +    DG  +K+LKRHL + +++TP +YR ++ L +DYPMV   Y+  RS+LAK  G
Sbjct: 74  QDGIVSFIDGRTYKTLKRHL-SKNDLTPMQYRERFGLPNDYPMVCASYSARRSELAKQTG 132

Query: 136 LG 137
           LG
Sbjct: 133 LG 134


>gi|218531276|ref|YP_002422092.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218523579|gb|ACK84164.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 154

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S+ +    +++++ + +AYV NH +  AD+  LI   +SAL  +  +A    +  P   +
Sbjct: 7   SYAAMAAPVDLSIMVASAYVRNHTLAAADLPGLIQGTYSALAGL--KAEPDAHAAPRVQR 64

Query: 66  P-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           P A  IR+SI    L    DG  +  LKRHL+  H + PD YR ++ L +DYPMV+  Y+
Sbjct: 65  PTAGQIRRSISPEGLISFIDGAPYMMLKRHLR-RHGLDPDSYRARYGLPADYPMVAPSYS 123

Query: 125 TTRSKLAKNMGLGRGRKK 142
             RS++A+++GL + R+K
Sbjct: 124 ERRSEIARSVGLPQRRRK 141


>gi|170751263|ref|YP_001757523.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657785|gb|ACB26840.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 136

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 73/132 (55%), Gaps = 4/132 (3%)

Query: 8   DSSERFL-EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
           D  ER + ++ + +V AY+SN+ +P   I  L+  VH A   +  R P      PE+   
Sbjct: 6   DHLERTISDVALRVVTAYLSNNALPHTGIPPLLVTVHGAFSALAVR-PAVTEAPPEQPD- 63

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           A  IR S+    +    DG  +K++KRHL T H +TP+ YR ++ L  DYPM +  YA  
Sbjct: 64  AARIRGSVRPDGIVSFIDGRSYKTMKRHL-TAHGLTPERYRARYGLPDDYPMTAPGYAER 122

Query: 127 RSKLAKNMGLGR 138
           RS++AK + LG+
Sbjct: 123 RSEIAKAIRLGK 134


>gi|254420954|ref|ZP_05034678.1| ROS/MUCR transcriptional regulator protein [Brevundimonas sp. BAL3]
 gi|196187131|gb|EDX82107.1| ROS/MUCR transcriptional regulator protein [Brevundimonas sp. BAL3]
          Length = 151

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 71/136 (52%), Gaps = 8/136 (5%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAP-CQDNVQPERLKPAVPIRK 72
           L +T DIV A+++++ +    +  LI   H AL  +    P       PER   +  IRK
Sbjct: 15  LSLTADIVVAFLASNTLDAGAVPELIRSTHRALGGLGVLEPEAAPEATPERPNRSA-IRK 73

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+ +  +    DG  +++LKRHL TH   TPD YR  + L +DYPMV+  Y+  RS  AK
Sbjct: 74  SLSDEGIVSFVDGGTYRTLKRHLSTH-GYTPDSYRAHFGLPADYPMVAPAYSAIRSAQAK 132

Query: 133 NMGLG-----RGRKKR 143
             GLG       RKKR
Sbjct: 133 ANGLGAKRPPASRKKR 148


>gi|170745612|ref|YP_001752059.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659340|gb|ACB28389.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 134

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 68/128 (53%), Gaps = 11/128 (8%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV----VSRAPCQDNVQPERLKPAVPIR 71
           MT  +V+AYV  + VP++D+ +LI     AL  +       AP      P +      IR
Sbjct: 1   MTAHLVSAYVRRNNVPVSDLATLIASAADALIGLRNPDTPAAPAAGKTTPAQ------IR 54

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
            SI +  L   EDG  +K+LKRHL T   +TP+ YR KW L  DYPMV+  Y+  RS +A
Sbjct: 55  ASITHEALISFEDGRGYKTLKRHL-TACGLTPETYRAKWGLPRDYPMVAPGYSERRSAIA 113

Query: 132 KNMGLGRG 139
            ++ L  G
Sbjct: 114 MSLQLRNG 121


>gi|332187876|ref|ZP_08389609.1| ROS/MUCR transcriptional regulator family protein [Sphingomonas sp.
           S17]
 gi|332012037|gb|EGI54109.1| ROS/MUCR transcriptional regulator family protein [Sphingomonas sp.
           S17]
          Length = 162

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 77/129 (59%), Gaps = 5/129 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMA--DIGSLITDVHSALQRVVSRAPCQDNVQ-PERLKPAVPI 70
           +E+  ++  A++ N     +  ++ + +  +H  +  ++  AP   +V+ P    PAV +
Sbjct: 11  VELATELTIAWLGNPNTRTSAEEVPAFLGKMHETVSSLLGSAPQTTDVEAPTEYVPAVSV 70

Query: 71  RKSIEN-GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           RKS+ +   +  + DG  +K+L+RHL TH  +TP+EYR ++ L SDYPMV+  Y+ +R  
Sbjct: 71  RKSLASKDHIISMIDGKPYKTLRRHLATH-GLTPEEYRERYGLKSDYPMVAESYSESRRA 129

Query: 130 LAKNMGLGR 138
           +AK +GLGR
Sbjct: 130 MAKKIGLGR 138


>gi|170745331|ref|YP_001766788.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170658932|gb|ACB27986.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 159

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/126 (39%), Positives = 71/126 (56%), Gaps = 5/126 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E+  DIV AYV+++ V   ++  +I  +H+AL +  + A  Q      RL  A  I +
Sbjct: 11  IIELVTDIVVAYVASNSVRAGEVTRMIGAIHAALAKCGAAADPQPG---PRLTKAE-IAR 66

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI +  L   EDG  +KSL+RHL     ++PD YR KW L  DYPM +  Y+  RS LA+
Sbjct: 67  SITHEALISFEDGRPYKSLRRHL-GKRGLSPDTYREKWGLPPDYPMTAPGYSEFRSALAR 125

Query: 133 NMGLGR 138
             GLGR
Sbjct: 126 KHGLGR 131


>gi|294023729|ref|YP_003547048.1| MucR-family transcriptional regulator [Sphingobium japonicum UT26S]
 gi|292677509|dbj|BAI99025.1| MucR-family transcriptional regulator [Sphingobium japonicum UT26S]
          Length = 294

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 73/127 (57%), Gaps = 6/127 (4%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
              +TV +++AYVSN+ V  +++  LI    +AL     +AP  D        PA   RK
Sbjct: 9   LTSLTVQLLSAYVSNNTVESSELAGLIQSTRAALSE--DKAP--DAPAAPEFVPATTARK 64

Query: 73  SIEN-GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           S+ +   +  + DG  +K+LKRHL T+  +TP EYR ++ L  DYPMV+  Y+  R ++A
Sbjct: 65  SLASRDHIISMIDGKPYKTLKRHLATN-GLTPSEYRERYGLPRDYPMVAPGYSEQRREVA 123

Query: 132 KNMGLGR 138
           + +GLGR
Sbjct: 124 QRLGLGR 130


>gi|218528320|ref|YP_002419136.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218520623|gb|ACK81208.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 153

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/127 (37%), Positives = 71/127 (55%), Gaps = 5/127 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV--VSRAPCQDNVQPERLKPAVPIR 71
           +++T  IV AYV+ + +    +  LIT VH AL  +   S  P  +  + E+  PA  IR
Sbjct: 17  VDLTATIVMAYVAKNTLTAKALPGLITSVHEALAGLGGTSATPVAE-AEIEKPTPAQ-IR 74

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           KSI    L    DG  +K LKRHL+ H  + P  YR ++ L +DYPM +  Y+  R+++A
Sbjct: 75  KSITPDALISFIDGKPYKMLKRHLRLH-GLNPQGYRQRYGLPADYPMTASGYSARRAEVA 133

Query: 132 KNMGLGR 138
           +  GLGR
Sbjct: 134 RATGLGR 140


>gi|218528580|ref|YP_002419396.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218520883|gb|ACK81468.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 176

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/128 (40%), Positives = 76/128 (59%), Gaps = 5/128 (3%)

Query: 13  FLEMTVDIVAAYVS-NHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP-I 70
            +E+  +I++AYV+ NHV P ADI  L+  VH+AL  + +       ++ E  KP    +
Sbjct: 12  LIELAGEILSAYVTRNHVSP-ADIPRLLCSVHAALTGLAN-GHASTALKEEMDKPTPEQV 69

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           RKSI    L    DG  +K+LKRHL + H + P  Y  ++ L +DYPMV+  YA  RS+L
Sbjct: 70  RKSITPDALISFIDGKPYKTLKRHL-SAHGLDPYSYCQRYGLPNDYPMVAAAYAARRSEL 128

Query: 131 AKNMGLGR 138
           AK++GL R
Sbjct: 129 AKSIGLRR 136


>gi|162148687|ref|YP_001603148.1| mucR family transcriptional regulatory protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787264|emb|CAP56858.1| putative mucR family transcriptional regulatory protein
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 258

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 51/89 (57%)

Query: 50  VSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIK 109
            S A   D      L PAVPIR S+    + CLEDG + KSLKRHL +   MT  +Y+ K
Sbjct: 125 TSSAAPADTAPTSGLVPAVPIRASVFPDYIVCLEDGKKLKSLKRHLSSAFGMTIQDYKAK 184

Query: 110 WNLASDYPMVSREYATTRSKLAKNMGLGR 138
           W+L  +YP V+  YA  R  +A+  GLGR
Sbjct: 185 WDLPDEYPTVAPNYAEMRRDVARKSGLGR 213


>gi|114328465|ref|YP_745622.1| transcriptional regulatory protein mucR [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316639|gb|ABI62699.1| transcriptional regulatory protein mucR [Granulibacter bethesdensis
           CGDNIH1]
          Length = 170

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 83/149 (55%), Gaps = 6/149 (4%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSN--HVVPMADIGSLITDVHSALQRVV--SRAPCQDNV 59
           D +   +   +E+  ++  A++ N    +    + + +  +HSA+ ++   S     D V
Sbjct: 3   DETITDAAHAVELATELTIAWLGNPNTRIDAEQVPAFLGSMHSAILKLAGGSETAAADAV 62

Query: 60  QPERLKPAVPIRKSIEN-GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
                 PAV +RKS+ +   +  + DG  +K+L+RHL T+  +TP++YR ++NL +DYPM
Sbjct: 63  DTTEYTPAVSVRKSLASKDHIISMIDGKPYKTLRRHLATN-GLTPEQYRERYNLKADYPM 121

Query: 119 VSREYATTRSKLAKNMGLGRGRKKRVLTS 147
           VS  Y+ +R  +AK +GLGR    +V ++
Sbjct: 122 VSETYSESRRVMAKKIGLGRKPGTKVASA 150


>gi|330992892|ref|ZP_08316835.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329760046|gb|EGG76547.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 346

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 74/151 (49%), Gaps = 20/151 (13%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQD-------------- 57
           + +E+T DI+  Y+  + V   ++  LI  V ++L   ++  P  D              
Sbjct: 5   KLIEITGDIIREYIKINQVAPHELPGLIQSVRASLCGPMTMPPRTDMPPAAQVPPPAAGQ 64

Query: 58  ------NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWN 111
                  V      PAVP+ +S+    + CLEDG   + LKR+++    MT D+YR KWN
Sbjct: 65  GRVEATTVTEPGPVPAVPVERSVFPEYIVCLEDGRHMRVLKRYIQRMFGMTEDDYRKKWN 124

Query: 112 LASDYPMVSREYATTRSKLAKNMGLGRGRKK 142
           L  DYPMV+  Y+  R  +AK  GLG+  +K
Sbjct: 125 LPEDYPMVAPAYSLHRRFIAKMKGLGKSYRK 155


>gi|218529272|ref|YP_002420088.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218521575|gb|ACK82160.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 146

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 75/143 (52%), Gaps = 7/143 (4%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV--VSRAPCQDNVQPERLK 65
           D S     +T +I+ AYV N+ +P A +  LI  VH  L  +   +  P  D+ +P   +
Sbjct: 4   DDSCGLEAITANIIIAYVRNNHLPGAILPDLIRTVHETLLSLGTTTAPPAPDSARPTPAE 63

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
               +RKSI    L    DG  +K+LKRHL T   +    YR ++ L +DYPMV+  Y+ 
Sbjct: 64  ----VRKSITPDALISFIDGRPYKTLKRHL-TSRGLDAYSYRARFGLPADYPMVAASYSR 118

Query: 126 TRSKLAKNMGLGRGRKKRVLTSK 148
            RS++AK +GLG   + +  T +
Sbjct: 119 DRSEIAKALGLGIPNRSKAATER 141


>gi|170749787|ref|YP_001756047.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656309|gb|ACB25364.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 135

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 69/123 (56%), Gaps = 8/123 (6%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA-VPIRK 72
           +E+   I++AYV+ + VP   +  L+++VH ++  +          +P+  +P    I+ 
Sbjct: 8   VELAAKILSAYVTRNSVPAGTLPDLLSEVHRSITAL------DQPAEPQVRRPTEAQIKA 61

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L   EDG  +K+L+RHL T   +TP+ Y+ KW L  DYP+VS  Y+  RS +++
Sbjct: 62  SIRPDTLISFEDGKPYKALRRHL-TMRGLTPEAYKAKWGLPVDYPLVSAAYSARRSTISR 120

Query: 133 NMG 135
            +G
Sbjct: 121 QIG 123


>gi|95930105|ref|ZP_01312844.1| transcriptional regulator, MucR family [Desulfuromonas acetoxidans
           DSM 684]
 gi|95133799|gb|EAT15459.1| transcriptional regulator, MucR family [Desulfuromonas acetoxidans
           DSM 684]
          Length = 139

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 72/126 (57%), Gaps = 1/126 (0%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIR 71
           + LEM V+IV+A+ S   +   D+ + + ++H+AL+ + +     +  Q +  +PAV ++
Sbjct: 3   KLLEMAVEIVSAHASTTTMSKEDLVAELAEIHTALKAMENGEQVAEQ-QDQEQQPAVSMK 61

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           K+     +YC+  G    +L RHL+  H +TP EYR ++++    P+ ++ Y+  R K+A
Sbjct: 62  KAFGKDKVYCMICGKGMTTLGRHLRMVHGITPAEYRKQFDIPRTQPLAAKAYSEQRKKMA 121

Query: 132 KNMGLG 137
              GLG
Sbjct: 122 IERGLG 127


>gi|218531757|ref|YP_002422573.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218524060|gb|ACK84645.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 154

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 73/130 (56%), Gaps = 4/130 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV-PIRK 72
           +++T+ + +AY  NH +   D+  LI   +SAL   V +A  + +  P+  +  V  IR+
Sbjct: 15  VDLTIIVASAYGRNHTLAATDLPGLIQGTYSAL--AVLKAEPEAHAVPKVQRLTVGQIRR 72

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
            I    L    DG  +  LKRHL+  H + PD YR ++ L +DYPMV+  Y+  RS++A+
Sbjct: 73  PITTEGLTFFVDGKPYMMLKRHLR-RHGLDPDSYRARYGLPADYPMVAPSYSERRSEIAR 131

Query: 133 NMGLGRGRKK 142
           + GL   R+K
Sbjct: 132 SFGLPHRRRK 141


>gi|148553115|ref|YP_001260697.1| MucR family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148498305|gb|ABQ66559.1| transcriptional regulator, MucR family [Sphingomonas wittichii RW1]
          Length = 162

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 76/131 (58%), Gaps = 8/131 (6%)

Query: 14  LEMTVDIVAAYVSNH--VVPMADIGSLITDVHSALQRVVSRAPCQDN---VQPERLKPAV 68
           LE+  ++  A+++N        ++   +  +H A+  + S A          PE + PAV
Sbjct: 12  LELATELTIAWLANPNTRATKEEVPEFLKSMHEAVASLSSDASADAEPSAAAPEHV-PAV 70

Query: 69  PIRKSIENG-CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
            +RKS+ +   +  + DG  +K+L+RHL TH N+TP+EYR ++ L +DYPMV+  Y+  R
Sbjct: 71  SVRKSLASKDHIISMIDGKPYKTLRRHLSTH-NLTPEEYRERYGLKADYPMVAPSYSEHR 129

Query: 128 SKLAKNMGLGR 138
            ++AK +GLGR
Sbjct: 130 REMAKRIGLGR 140


>gi|294146435|ref|YP_003559101.1| AlgP-family transcriptional regulator [Sphingobium japonicum UT26S]
 gi|292676852|dbj|BAI98369.1| AlgP-family transcriptional regulator [Sphingobium japonicum UT26S]
          Length = 279

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 72/124 (58%), Gaps = 4/124 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +TV +V+A+VSN+ V    +  LI     AL   ++  P +D   P    PAV +RKS+ 
Sbjct: 12  LTVQLVSAFVSNNNVASEGLADLIRTTRLALTDDLAAKP-EDAAAPT-YTPAVSVRKSLS 69

Query: 76  NG-CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
           +   +  + DG  +K+LKRHL +H  +TP+EYR ++ L   YP+V+  Y+  R  +A  +
Sbjct: 70  SPEHILSMIDGRPYKTLKRHLASH-GLTPNEYRERYGLPKSYPLVAPNYSEARRAVATKL 128

Query: 135 GLGR 138
           GLG+
Sbjct: 129 GLGK 132


>gi|307295341|ref|ZP_07575180.1| transcriptional regulator, MucR family [Sphingobium
           chlorophenolicum L-1]
 gi|306878844|gb|EFN10063.1| transcriptional regulator, MucR family [Sphingobium
           chlorophenolicum L-1]
          Length = 262

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 76/134 (56%), Gaps = 7/134 (5%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +TV +V+A+VSN+ V   ++  LI     AL    +  P  D        PAV +RKS+ 
Sbjct: 12  LTVQLVSAFVSNNNVASENLADLIRTTRLALTDDPAAKP--DEAAAPTYTPAVSVRKSLS 69

Query: 76  NG-CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
           +   +  + DG  +K+LKRHL +H  +TP++YR ++ L   YP+V+  Y+  R  +A  +
Sbjct: 70  SPEHILSMIDGKPYKTLKRHLASH-GLTPNDYRERYGLPKSYPLVAPNYSEARRAVATKL 128

Query: 135 GLGRGRKKRVLTSK 148
           GLGR   K V+++K
Sbjct: 129 GLGR---KPVVSAK 139


>gi|170752182|ref|YP_001783327.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659309|gb|ACB28359.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 151

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 72/139 (51%), Gaps = 11/139 (7%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADI---GSLITDVHSALQRV-VSRAPCQDNV 59
           + S + S  +  MT +++AAYVS++ VP +D+    +      + LQ   ++  P    V
Sbjct: 6   NISSNFSLNYSRMTANLIAAYVSHNRVPASDLPALIAAAGAAFTGLQLASLATGPKDRKV 65

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
              +      I+ SI    L   EDG  ++++KRHL T   +TP+ YR KW L  DYPM 
Sbjct: 66  TQAQ------IQASITYEALISFEDGKPYQTIKRHLTTR-GLTPETYRAKWGLPPDYPMF 118

Query: 120 SREYATTRSKLAKNMGLGR 138
           +  Y   RSK+AK + L R
Sbjct: 119 APAYGVKRSKIAKRLALRR 137


>gi|114765235|ref|ZP_01444367.1| putative mucR family transcriptional regulatory protein [Pelagibaca
           bermudensis HTCC2601]
 gi|114542370|gb|EAU45398.1| putative mucR family transcriptional regulatory protein
           [Roseovarius sp. HTCC2601]
          Length = 142

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 62/124 (50%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSI 74
           E    IVAAY S   V   +I +L   +   L  V +            ++PA+P+ +++
Sbjct: 9   EQVSRIVAAYASRPDVTPDEIVALYRRLSGELDDVPAEVAPARAPARAGMQPALPLEQAV 68

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
               +YCL  G  FK LKRHL   H MT  EYR  + L  D+P+V+  Y+  ++  AK  
Sbjct: 69  TEDKVYCLCCGRGFKMLKRHLGAEHGMTEAEYRTAFGLPEDFPLVAPSYSRKKAAHAKEA 128

Query: 135 GLGR 138
           GLG+
Sbjct: 129 GLGK 132


>gi|218533415|ref|YP_002424230.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218525718|gb|ACK86302.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 324

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/122 (38%), Positives = 63/122 (51%), Gaps = 4/122 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           MTV I  +Y+S + +   +IG LI  V  AL  +  R     N   ++L     I+ SI 
Sbjct: 15  MTVRIAKSYLSKNRIGPQEIGPLIEQVSLALAHLRRRP---HNASGQQLPTQEEIQASIH 71

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              L   EDG  +  LKRHL T   +TP+ Y  KW L +DYPMV+  Y   R++LAK   
Sbjct: 72  ERHLISFEDGKSYHMLKRHL-TKLGLTPEAYLAKWGLPADYPMVAPFYTRKRARLAKRTR 130

Query: 136 LG 137
           LG
Sbjct: 131 LG 132



 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           I  SI++  L C EDG  ++ L RHL+    +TPD YR KW L +DYPM+S      R++
Sbjct: 202 IAASIQDTFLICFEDGEPYRMLSRHLRLF-GLTPDAYRAKWGLPADYPMMSASDLRHRAE 260

Query: 130 LAKNMGL 136
           LA+   L
Sbjct: 261 LARQRKL 267


>gi|170749695|ref|YP_001755955.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656217|gb|ACB25272.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 141

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 71/130 (54%), Gaps = 6/130 (4%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
           FD++   L+ ++ IV AYVS + V    +  ++   +  L ++ S  P      PE    
Sbjct: 13  FDAA---LKNSIKIVCAYVSRNSVSHTQLCEILVSTYEMLCQI-SVGPAPAVATPEAAT- 67

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           A  IR SI+   L    DG  +K+LKRHL T H +TP +YR K+ L  DYPMV+  YA  
Sbjct: 68  AREIRTSIQAEGLISFIDGRSYKTLKRHL-TAHGLTPQDYRAKYGLPRDYPMVAPGYAAK 126

Query: 127 RSKLAKNMGL 136
           RS++A+ + L
Sbjct: 127 RSEIARLLQL 136


>gi|218886897|ref|YP_002436218.1| MucR family transcriptional regulator [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757851|gb|ACL08750.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 133

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 67/134 (50%), Gaps = 2/134 (1%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +L+  +DIV A  S   +   +I S++  +  A++++    PC++   PE   P    
Sbjct: 2   EEYLKQALDIVKAQASVRTMNEEEISSMVQKIALAIRQISDGVPCEEQAAPE--APLPDA 59

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
            K+++   + CLE G  FK L R     H++TPD YR K+    D P+V +     R K 
Sbjct: 60  AKALKEKSITCLECGKTFKILTRKHLASHDLTPDSYRDKYGYRKDMPLVCKSLQRERRKK 119

Query: 131 AKNMGLGRGRKKRV 144
            K+M L   R+K+ 
Sbjct: 120 MKDMKLWEKRRKQA 133


>gi|83944197|ref|ZP_00956653.1| putative mucR family protein transcriptional regulatory protein
           [Sulfitobacter sp. EE-36]
 gi|83955102|ref|ZP_00963758.1| putative mucR family transcriptional regulatory protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83840431|gb|EAP79604.1| putative mucR family transcriptional regulatory protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83845064|gb|EAP82945.1| putative mucR family protein transcriptional regulatory protein
           [Sulfitobacter sp. EE-36]
          Length = 155

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 67/132 (50%), Gaps = 10/132 (7%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV--------VSRAPCQDNVQPERLKP 66
           E  + ++ A+       + DI +L   + +AL  +        +S+   Q     E   P
Sbjct: 11  EAAIRVITAFAGRESATVQDILALSQALPAALAGLQPAAAKAEISKVAAQFTT--ETAIP 68

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AVP+ +S  +  + CL  G  F  LKRHL+  H ++  EYRIK+NL  D+P+V+  Y+  
Sbjct: 69  AVPVAESFTDDSVTCLCCGRSFTMLKRHLRAEHGLSESEYRIKFNLDDDHPLVAPNYSLR 128

Query: 127 RSKLAKNMGLGR 138
           ++  AK  GLGR
Sbjct: 129 KADYAKKAGLGR 140


>gi|330990682|ref|ZP_08314638.1| Putative mucR family transcriptional regulatory protein y4pD
           [Gluconacetobacter sp. SXCC-1]
 gi|329762122|gb|EGG78610.1| Putative mucR family transcriptional regulatory protein y4pD
           [Gluconacetobacter sp. SXCC-1]
          Length = 98

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 43/63 (68%)

Query: 79  LYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGR 138
           + CLEDG + K LKRHL + ++MTP +YR KW+L   YPMV+  YA  RS LA+ +GL R
Sbjct: 6   IVCLEDGKKLKMLKRHLHSAYDMTPQQYREKWSLPESYPMVAPTYAVRRSALAQEIGLQR 65

Query: 139 GRK 141
             K
Sbjct: 66  ATK 68


>gi|77919911|ref|YP_357726.1| transcriptional regulator [Pelobacter carbinolicus DSM 2380]
 gi|77545994|gb|ABA89556.1| transcriptional regulator, MucR family [Pelobacter carbinolicus DSM
           2380]
          Length = 147

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 67/127 (52%), Gaps = 2/127 (1%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK--PAVPI 70
            LEM  +IVA++ S   +   ++ + + D+H AL  + S    +   + E     P V  
Sbjct: 4   LLEMAAEIVASHASTTPMSKEELIAELNDLHQALSAIESGTALEGGAEQEETSQAPVVSR 63

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           +K+     + C+  G   K+L RHLKT H MT  EYR ++++    P+ +R Y+ +R ++
Sbjct: 64  KKAFGKDKVVCMICGKPMKTLARHLKTAHGMTASEYRKQFDIPRTQPLAARAYSESRRQM 123

Query: 131 AKNMGLG 137
           A + GLG
Sbjct: 124 AIDRGLG 130


>gi|118577407|ref|YP_899647.1| MucR family transcriptional regulator [Pelobacter propionicus DSM
           2379]
 gi|118504912|gb|ABL01394.1| transcriptional regulator [Pelobacter propionicus DSM 2379]
          Length = 148

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 71/132 (53%), Gaps = 6/132 (4%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAP-CQDNVQPERLKPAV 68
           ++  +E+T  IV+A+ S   +   D+   I  V+S+L+ +    P   +  +P    PA+
Sbjct: 2   TQSLVELTASIVSAHASGSQMSKEDLLGEINAVYSSLKALEGGTPEALEASEPASQAPAL 61

Query: 69  PIRKSIEN---GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
            IRK+ ++   GC+ C + G  FK+L RHLK  H++ P +YR ++N++    + ++ Y+ 
Sbjct: 62  TIRKAFKDDQIGCMICGKTG--FKTLTRHLKQAHDLKPGQYRKQFNISPTQALTAKNYSE 119

Query: 126 TRSKLAKNMGLG 137
            R   AK   L 
Sbjct: 120 ARRAAAKENNLA 131


>gi|78355350|ref|YP_386799.1| MucR family transcriptional regulator [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78217755|gb|ABB37104.1| transcriptional regulator, MucR family [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 130

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 69/132 (52%), Gaps = 7/132 (5%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           L+  ++IV A  S   +   +I S++  +  ++Q++      + N++P+  +PA    K+
Sbjct: 5   LKQALEIVKAQASVRTMTEDEINSMVLKLAQSIQQIT-----EGNIEPQEAEPAADPAKA 59

Query: 74  IENGCLYCLEDGMQFKSLKR-HLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           I+   + CLE G  FK L R HL TH ++TP EYR KW    + P+V +     R K  K
Sbjct: 60  IKEKSITCLECGKTFKILTRKHLGTH-DLTPAEYREKWGYKKNLPLVCKTLQRERRKKMK 118

Query: 133 NMGLGRGRKKRV 144
           +M L   RK + 
Sbjct: 119 DMKLWEKRKAKA 130


>gi|117926885|ref|YP_867502.1| MucR family transcriptional regulator [Magnetococcus sp. MC-1]
 gi|117610641|gb|ABK46096.1| transcriptional regulator, MucR family [Magnetococcus sp. MC-1]
          Length = 159

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 77/158 (48%), Gaps = 25/158 (15%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV-----------------VSR 52
           S   ++ T  IV A+V N+ +   +I   I +VH++L  +                 V  
Sbjct: 2   SSDMVQKTAQIVEAFVRNNSITAREIPQFIKEVHASLTGLSQPADPPLAAPSVVAPKVEL 61

Query: 53  AP---CQDNVQPE-RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRI 108
           AP     +  QP  +  PAV I  SI +  + CL  G   K+LK HL   H++  DEYR 
Sbjct: 62  APVLVANEVGQPSGKPTPAVAIADSISDAFVTCLICGKPCKTLKGHLTRSHHLELDEYRA 121

Query: 109 KWNLASDYPMVSREYATTRSKLAKNMGLG----RGRKK 142
            ++L + YP+VS +Y+  R KLA + GLG    + RKK
Sbjct: 122 MFDLPTSYPVVSPDYSAKRRKLAIDSGLGDKLHKARKK 159


>gi|118580904|ref|YP_902154.1| MucR family transcriptional regulator [Pelobacter propionicus DSM
           2379]
 gi|118503614|gb|ABL00097.1| transcriptional regulator, MucR family [Pelobacter propionicus DSM
           2379]
          Length = 167

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 72/131 (54%), Gaps = 12/131 (9%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E+T +IV+A+ S   +   ++   I  V +AL+++ S  P  + V+     PA+ ++K
Sbjct: 5   LVELTANIVSAHASGSQLSRDELIQEINTVFTALKQLESGTPATE-VETAPAAPAMSLKK 63

Query: 73  SIEN---GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY------ 123
           + +N    C+ C + G  FK+L RHLK  HN+ P +YR ++N+ S   + ++ Y      
Sbjct: 64  AFQNDQVSCMICGKSG--FKTLTRHLKQAHNLKPGQYRKQFNIPSTQSLTAKNYSEARRQ 121

Query: 124 ATTRSKLAKNM 134
           A T + LA N+
Sbjct: 122 AATENNLAANL 132


>gi|294146968|ref|YP_003559634.1| MucR-family transcriptional regulator [Sphingobium japonicum UT26S]
 gi|292677385|dbj|BAI98902.1| MucR-family transcriptional regulator [Sphingobium japonicum UT26S]
          Length = 238

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 70/124 (56%), Gaps = 4/124 (3%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           +TV +++AYVS + VP   +  LI    +AL    +          E   PAV +R+S+ 
Sbjct: 12  LTVQLLSAYVSRNSVPSDSLADLIRTTRAALTENAAA--AVAEPAAETFTPAVSVRRSLA 69

Query: 76  NG-CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
           +   +  L DG  +K+LKRHL  H  +TP++YR ++ L S YP+V++ Y+  R  +A+  
Sbjct: 70  SPDRILSLIDGRPYKTLKRHLAAH-GLTPEQYRERYKLPSSYPLVAQSYSEARRAVAEKA 128

Query: 135 GLGR 138
           GLG+
Sbjct: 129 GLGK 132


>gi|78222519|ref|YP_384266.1| MucR family transcriptional regulator [Geobacter metallireducens
           GS-15]
 gi|78193774|gb|ABB31541.1| transcriptional regulator, MucR family [Geobacter metallireducens
           GS-15]
          Length = 166

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 71/129 (55%), Gaps = 8/129 (6%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK-PAVPIR 71
            LE+T  IV+++ +   +   ++   I  V++ LQ++   AP  +  Q E  K P + ++
Sbjct: 5   LLELTAGIVSSHAAMSELSTEELVQEIQKVYTTLQQLEGGAP--EAAQAEETKAPVISLK 62

Query: 72  KSIENG---CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           K+ +     C+ C + GM  K+L RHL   H+M P EYR ++N+ S   + +R+++  R 
Sbjct: 63  KAFQADQVVCMICGKGGM--KTLTRHLAQVHDMKPREYRKQFNIPSSQALTARKFSEARK 120

Query: 129 KLAKNMGLG 137
           K+A+  GL 
Sbjct: 121 KMAQERGLA 129


>gi|320354869|ref|YP_004196208.1| MucR family transcriptional regulator [Desulfobulbus propionicus
           DSM 2032]
 gi|320123371|gb|ADW18917.1| transcriptional regulator, MucR family [Desulfobulbus propionicus
           DSM 2032]
          Length = 147

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 67/128 (52%), Gaps = 2/128 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S+  +EMT +I+ + +S+  +   +I + + D    L+ +          +PE + PA+ 
Sbjct: 2   SKSLVEMTAEIIQSQISSKQMSTEEIKAALNDTFQTLKALQESESVGIEAEPEEINPAID 61

Query: 70  IRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +KSI+   + CLE G +FK L  +HLK+ H +   EYR K   ++  P+ ++  +  RS
Sbjct: 62  PKKSIQKNKIICLECGQEFKMLSPKHLKS-HGLNSKEYRKKHGFSARQPLCAKALSEKRS 120

Query: 129 KLAKNMGL 136
           +  K  GL
Sbjct: 121 QSGKERGL 128


>gi|322419527|ref|YP_004198750.1| MucR family transcriptional regulator [Geobacter sp. M18]
 gi|320125914|gb|ADW13474.1| transcriptional regulator, MucR family [Geobacter sp. M18]
          Length = 175

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 71/127 (55%), Gaps = 8/127 (6%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E+   IVA++ S+  +    +   I+ VHSAL+ + +  P +   +P   K ++ +++
Sbjct: 4   LVEIAAQIVASHASSTPMTSDQLIFEISKVHSALKNLEAGEPVEGVEEP---KTSLTVKE 60

Query: 73  SIENG---CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           + + G   C+ C + G  FK+L RHL T H+M P EY+ ++ +    P+ ++ Y+  R K
Sbjct: 61  AFKKGEVVCMLCGKGG--FKTLARHLNTAHSMKPGEYKKQFGIPGKQPLAAKNYSEARRK 118

Query: 130 LAKNMGL 136
           +A + GL
Sbjct: 119 MALDRGL 125


>gi|148264291|ref|YP_001230997.1| MucR family transcriptional regulator [Geobacter uraniireducens
           Rf4]
 gi|146397791|gb|ABQ26424.1| transcriptional regulator, MucR family [Geobacter uraniireducens
           Rf4]
          Length = 189

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 71/128 (55%), Gaps = 6/128 (4%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            LE+T +IV+++ S   +   ++   +  V+SALQ++ +  P +   Q E   PA+ ++K
Sbjct: 5   LLELTANIVSSHASVSEMSGEELLQELQKVYSALQKLET-VPVETGEQAEVKTPAISLKK 63

Query: 73  SIEN---GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           + +     C+ C + GM  K+L RHL   HNM P  YR ++ + S   + ++ ++  R K
Sbjct: 64  AFQPDQVSCMICGKTGM--KTLARHLAQVHNMKPGAYRKQFGIPSTQALTAKNFSEARRK 121

Query: 130 LAKNMGLG 137
           +A++ GL 
Sbjct: 122 MAQDRGLA 129


>gi|163744357|ref|ZP_02151717.1| transcriptional regulator [Oceanibulbus indolifex HEL-45]
 gi|161381175|gb|EDQ05584.1| transcriptional regulator [Oceanibulbus indolifex HEL-45]
          Length = 155

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 66/125 (52%), Gaps = 6/125 (4%)

Query: 20  IVAAYVSNHVVPMADIGSLITDVHS--ALQRVVSRAPCQDNVQPERLKP----AVPIRKS 73
           IV+ + S   V + DI +L+  + +  A   V + A     V P   K     A P  + 
Sbjct: 18  IVSGFASRSDVTIDDILTLVERLRASPAESAVTALANIPATVTPIAPKASGMSAAPGEQP 77

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           + +  ++CL  G  FK LKRHL   H +T  EYR+ +NLA+D P+V+  Y+  +++ AK 
Sbjct: 78  MTDDTIFCLCCGKGFKMLKRHLGAEHGLTEAEYRVMFNLAADAPLVAPSYSKRKAEYAKR 137

Query: 134 MGLGR 138
            GLG+
Sbjct: 138 AGLGK 142


>gi|189425371|ref|YP_001952548.1| MucR family transcriptional regulator [Geobacter lovleyi SZ]
 gi|189421630|gb|ACD96028.1| transcriptional regulator, MucR family [Geobacter lovleyi SZ]
          Length = 174

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 74/139 (53%), Gaps = 9/139 (6%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E+T +IV+++ +   +   ++   I  V++AL+ + S    ++    +   PA+  +K
Sbjct: 5   LVELTANIVSSHAATVEMSSDELLQEIQKVYAALKNLDSDNVIEEGTVAKEAAPAISPKK 64

Query: 73  SIENG---CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           SI+     CL C + G  FK+L RHLK  H +   EYR ++ +AS  P+ ++ Y+  R +
Sbjct: 65  SIQKDQIICLICGKGG--FKTLSRHLKQAHGLKASEYRKQFGIASGTPLAAKNYSEARRQ 122

Query: 130 LAKNMGLG----RGRKKRV 144
            A N  LG    +GR  R+
Sbjct: 123 SAINNNLGEKLAKGRATRM 141


>gi|94986509|ref|YP_594442.1| transcriptional regulator [Lawsonia intracellularis PHE/MN1-00]
 gi|94730758|emb|CAJ54120.1| predicted transcriptional regulator [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 132

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 70/132 (53%), Gaps = 6/132 (4%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPC-QDNVQPERLKPAVPIR 71
           FL+  +DIV A  S  V+   +I S++  + S + +VVS   C Q+   P  L+  +  R
Sbjct: 4   FLKEALDIVKAQASVRVMAEDEIISMVRRLSSGI-KVVSEGDCIQEEQAPTELQ--MDPR 60

Query: 72  KSIENGCLYCLEDGMQFKSLKR-HLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           KS++   + CLE G  FK L R HL++H  +  +EYR KW L  D P+V +     R   
Sbjct: 61  KSVKEKSITCLECGRTFKILTRKHLRSH-GLDANEYREKWGLKKDTPLVCKSLQRERRNK 119

Query: 131 AKNMGLGRGRKK 142
            K+M L   R+K
Sbjct: 120 MKDMKLWEKRRK 131


>gi|46204048|ref|ZP_00050577.2| hypothetical protein Magn03004453 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 121

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 44/61 (72%), Gaps = 1/61 (1%)

Query: 82  LEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRK 141
            EDG  +K+L+RHL T   ++P++YR KW L +DYPM S  Y+  RS+LA+ +GLG+ R+
Sbjct: 26  FEDGKPYKTLRRHL-TLRGLSPEQYRAKWGLPNDYPMTSASYSEQRSELARALGLGQQRR 84

Query: 142 K 142
           +
Sbjct: 85  R 85


>gi|163849546|ref|YP_001637589.1| transcriptional regulator protein-like protein [Methylobacterium
           extorquens PA1]
 gi|163661151|gb|ABY28518.1| transcriptional regulator protein-like protein [Methylobacterium
           extorquens PA1]
          Length = 125

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 40/62 (64%), Gaps = 1/62 (1%)

Query: 79  LYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGR 138
           +   EDG  +K+L RHL T   +TP+ YR KW L  DYPM++  Y+  RS+ A ++GLGR
Sbjct: 1   MISFEDGKAYKTLPRHL-TKQGLTPEAYRAKWGLPVDYPMIAPAYSAQRSRPALDLGLGR 59

Query: 139 GR 140
            R
Sbjct: 60  QR 61


>gi|242280857|ref|YP_002992986.1| MucR family transcriptional regulator [Desulfovibrio salexigens DSM
           2638]
 gi|242123751|gb|ACS81447.1| transcriptional regulator, MucR family [Desulfovibrio salexigens
           DSM 2638]
          Length = 131

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 67/134 (50%), Gaps = 5/134 (3%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E  L+  ++IV A  S   +   +I S++  + + ++++       D+  PE   P  P 
Sbjct: 2   EDHLKEALEIVKAQASVRTMTEEEITSMVHKLAAGIKKISE--GMLDSNSPEPTPPVDP- 58

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I    + CLE G  FK L KRHL   + +TPDEYR KW  A   P+V +     R K
Sbjct: 59  KKAIREKSIICLESGKSFKVLTKRHL-AKYGLTPDEYREKWGYAKKTPLVCKSLQRERRK 117

Query: 130 LAKNMGLGRGRKKR 143
             K M L   RKK+
Sbjct: 118 KMKEMKLWEKRKKQ 131


>gi|222056089|ref|YP_002538451.1| transcriptional regulator, MucR family [Geobacter sp. FRC-32]
 gi|221565378|gb|ACM21350.1| transcriptional regulator, MucR family [Geobacter sp. FRC-32]
          Length = 180

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 71/128 (55%), Gaps = 9/128 (7%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            LE+T  IV+++ S   +   ++ + +  VH+ALQ++   AP +   + E   PA+ ++K
Sbjct: 5   LLELTASIVSSHASVSEMSSEELLAELQKVHAALQKL--EAPAE--AESESKAPAISLKK 60

Query: 73  SIEN---GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           + +     C+ C + GM  K+L RHL   H+M P  YR ++ + S   + ++ ++  R K
Sbjct: 61  AFQPDQVSCMICGKTGM--KTLARHLAQVHDMKPGAYRKQFGIPSSQALTAKNFSEARRK 118

Query: 130 LAKNMGLG 137
           +A++ GL 
Sbjct: 119 MAQDRGLA 126


>gi|197118598|ref|YP_002139025.1| MucR family transcriptional regulator [Geobacter bemidjiensis Bem]
 gi|197087958|gb|ACH39229.1| transcriptional regulator, MucR family [Geobacter bemidjiensis Bem]
          Length = 185

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 69/127 (54%), Gaps = 8/127 (6%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E+   IVA++ S+  +    +   I  VH+AL+ + +  P + +   E  K ++ +++
Sbjct: 4   LVEIAAQIVASHASSTPMTSDQLIFEIGKVHTALKNLEAGEPVEGS---EETKTSLTVKE 60

Query: 73  SIENG---CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +   G   C+ C + G  FK+L RHL T H M P EY+ ++++    P+ ++ Y+  R K
Sbjct: 61  AFRKGEVVCMICGKGG--FKTLARHLNTAHGMKPGEYKKQFSIPGKQPLAAKNYSDARRK 118

Query: 130 LAKNMGL 136
           +A + GL
Sbjct: 119 MALDRGL 125


>gi|253700631|ref|YP_003021820.1| MucR family transcriptional regulator [Geobacter sp. M21]
 gi|251775481|gb|ACT18062.1| transcriptional regulator, MucR family [Geobacter sp. M21]
          Length = 173

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 69/127 (54%), Gaps = 8/127 (6%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E+   IVA++ S+  +    +   I  VH+AL+ + +  P + +   E  K ++ +++
Sbjct: 4   LVEIAAQIVASHASSTPMTSDQLIFEIGKVHTALKNLEAGEPVEGS---EETKTSLTVKE 60

Query: 73  SIENG---CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +   G   C+ C + G  FK+L RHL T H M P EY+ ++++    P+ ++ Y+  R K
Sbjct: 61  AFRKGEVVCMICGKGG--FKTLARHLNTAHGMKPGEYKKQFSIPGKQPLAAKNYSDARRK 118

Query: 130 LAKNMGL 136
           +A + GL
Sbjct: 119 MALDRGL 125


>gi|298505978|gb|ADI84701.1| transcriptional regulator, Ros/MucR family [Geobacter
           sulfurreducens KN400]
          Length = 167

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 70/128 (54%), Gaps = 5/128 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            LE+T  IV+++ +   +   ++   I  VHS LQ++   A   +    E   PA+ ++K
Sbjct: 5   LLELTASIVSSHAAVSELSTEELVQEIQKVHSTLQQLEGGAAAPEAAAEEAKAPAMTLKK 64

Query: 73  SIENG---CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           + +     C+ C + GM  K+L RHL   H M P EYR ++N+ S  P+ +++++  R +
Sbjct: 65  AFQADQVCCMICGKGGM--KTLTRHLAQVHQMKPGEYRKQFNIPSSQPLTAKKFSEARKQ 122

Query: 130 LAKNMGLG 137
           +AK+ GL 
Sbjct: 123 MAKDRGLA 130


>gi|323700555|ref|ZP_08112467.1| transcriptional regulator, MucR family [Desulfovibrio sp. ND132]
 gi|323460487|gb|EGB16352.1| transcriptional regulator, MucR family [Desulfovibrio desulfuricans
           ND132]
          Length = 143

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 62/124 (50%), Gaps = 7/124 (5%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +E  + IV A      +   +   ++ ++   L+ + +         P R +P V  +++
Sbjct: 4   VEKAMRIVEAQAGVRPMTADEACQMVKNLSDGLRELAN-----GEAAPTRQEPPVDPKRA 58

Query: 74  IENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           I N  + CLE G  FK+L KRHL++H  +TPDEYR KW      P+  RE A  RS+  K
Sbjct: 59  IRNKSIVCLECGRTFKTLSKRHLESH-GLTPDEYRAKWGYKKRTPLSCRETAKARSERMK 117

Query: 133 NMGL 136
            M L
Sbjct: 118 EMKL 121


>gi|84502388|ref|ZP_01000524.1| putative mucR family transcriptional regulatory protein [Oceanicola
           batsensis HTCC2597]
 gi|84389200|gb|EAQ01997.1| putative mucR family transcriptional regulatory protein [Oceanicola
           batsensis HTCC2597]
          Length = 138

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%)

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PA+P+ +++    +YCL  G  FK LKRHL   H +T  EYR  + L +D+P+V+  Y+ 
Sbjct: 54  PALPLDRAVTEDKVYCLCCGRGFKMLKRHLGAEHGLTEAEYRAMFGLPADFPLVAPNYSR 113

Query: 126 TRSKLAKNMGLGR 138
            ++  AK  G G+
Sbjct: 114 KKASHAKQAGFGK 126


>gi|239907916|ref|YP_002954657.1| ROSMUCR family transcriptional regulator [Desulfovibrio magneticus
           RS-1]
 gi|239797782|dbj|BAH76771.1| ROSMUCR family transcriptional regulator [Desulfovibrio magneticus
           RS-1]
          Length = 137

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 63/131 (48%), Gaps = 2/131 (1%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           FL+  ++IV A  S   +   +I S++  +   ++ +VS  P     +     PAV  +K
Sbjct: 4   FLKEALEIVKAQASVRNMSEEEITSMVRRLTDDIRGLVSAGPSLAAAEEVAATPAVDPKK 63

Query: 73  SIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           ++    + CLE G  FK L K+HL     +TP+EYR KW      P+V +E    R K  
Sbjct: 64  AVRERSIICLESGKSFKILTKKHL-AKFGLTPEEYRTKWGYPKGMPLVCKELQRERRKKM 122

Query: 132 KNMGLGRGRKK 142
           K M L   R K
Sbjct: 123 KEMRLWEKRVK 133


>gi|298530495|ref|ZP_07017897.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509869|gb|EFI33773.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 136

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 69/131 (52%), Gaps = 4/131 (3%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E  ++  ++IV A  S   +   +I S+I  +   +Q+  S+   ++ V  E+  PAV  
Sbjct: 2   EDHVKQALEIVKAQASVRNMTEEEINSMIKSLSEGIQKA-SQGAAEEQVSEEQ-HPAVDP 59

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I    + CLE G  FK + K+HL   H+MTP+EY+ KW    +  +V++  A  R K
Sbjct: 60  KKAIREKSIICLECGKSFKVITKKHL-AKHDMTPEEYKEKWGYKKNQSLVAKSLARERRK 118

Query: 130 LAKNMGLGRGR 140
             + M L + R
Sbjct: 119 KMQEMELWKKR 129


>gi|258406286|ref|YP_003199028.1| transcriptional regulator, MucR family [Desulfohalobium retbaense
           DSM 5692]
 gi|257798513|gb|ACV69450.1| transcriptional regulator, MucR family [Desulfohalobium retbaense
           DSM 5692]
          Length = 133

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 4/131 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           +L+  ++IV A      +   +I S++  + + L+ +V   P + +   E  +PAV  +K
Sbjct: 4   YLQQALEIVKAQAGVRNMTEEEITSMVHRLANQLKGIVEGEPQEQH--EEHQEPAVDPKK 61

Query: 73  SIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           +I    + CLE G  FK L KRHL   H +TP EY+ KW       ++++  A  R K  
Sbjct: 62  AIREKSVVCLECGKTFKVLTKRHL-AQHGLTPAEYKAKWGFKKTQSLIAKALARERRKKM 120

Query: 132 KNMGLGRGRKK 142
           ++M L   RKK
Sbjct: 121 QDMRLWERRKK 131


>gi|117925579|ref|YP_866196.1| MucR family transcriptional regulator [Magnetococcus sp. MC-1]
 gi|117609335|gb|ABK44790.1| transcriptional regulator, MucR family [Magnetococcus sp. MC-1]
          Length = 164

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 73/160 (45%), Gaps = 26/160 (16%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQD------------ 57
           S   ++ T  I+ +YVSN+ +    +  LI +V ++L+ +  +    D            
Sbjct: 2   SRDLIQTTAGIIQSYVSNNPIEAEQLTGLIGEVFNSLEELSQKGSLGDIDAATAEDLDRW 61

Query: 58  --------NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIK 109
                        +L+PAV + ++++   + CL  G   K+LK HL   H +   +YR  
Sbjct: 62  VDGLNKKERTGLTKLQPAVAVDQAVQEDSVTCLICGKTCKALKGHLTRTHKLDVADYRAM 121

Query: 110 WNLASDYPMVSREYATTRSKLAKNMGL------GRGRKKR 143
           +NL  D+PM +  Y+  R  LA+ +GL       R RKK+
Sbjct: 122 FNLPKDFPMTAPNYSARRRVLAEEVGLSEKLQASRERKKK 161


>gi|189425919|ref|YP_001953096.1| MucR family transcriptional regulator [Geobacter lovleyi SZ]
 gi|189422178|gb|ACD96576.1| transcriptional regulator, MucR family [Geobacter lovleyi SZ]
          Length = 160

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/133 (33%), Positives = 73/133 (54%), Gaps = 16/133 (12%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE-RLKPAV 68
           S   +E+T +IVAA+ S + +    + SLI  VH  L+ +      ++   PE   KPAV
Sbjct: 2   SSVLVELTSEIVAAHASVNEMTSEQMLSLIQKVHGLLKSL------EEGGSPEVEAKPAV 55

Query: 69  PI--RKSIENG---CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            +  +KSI+     CL C + G  FK+L RHLK  H+M P +YR ++ L +   +V++ Y
Sbjct: 56  TLQPKKSIQKDQVVCLICGKGG--FKTLTRHLKQVHDMKPGQYRKQFGLPAGTALVAKNY 113

Query: 124 ATTR--SKLAKNM 134
           +  R  S + +N+
Sbjct: 114 SEARRASAIERNL 126


>gi|218671088|ref|ZP_03520759.1| putative nodulation competitiveness transcriptional regulator
           [Rhizobium etli GR56]
          Length = 48

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 37/45 (82%)

Query: 98  HHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKK 142
           HH+++P+EYR KW+L +DYPMV+  YA  RS+LAK MGLG+ RK+
Sbjct: 1   HHSLSPEEYREKWDLPTDYPMVAPAYAEARSRLAKEMGLGQRRKR 45


>gi|322419711|ref|YP_004198934.1| MucR family transcriptional regulator [Geobacter sp. M18]
 gi|320126098|gb|ADW13658.1| transcriptional regulator, MucR family [Geobacter sp. M18]
          Length = 185

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 67/126 (53%), Gaps = 12/126 (9%)

Query: 18  VDIVAAYVSNHV--VPMA--DIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           V+I A  VS+H    PM   ++ + I  VH+AL+   S    Q     E  KP++ I+++
Sbjct: 5   VEIAAQLVSSHASSTPMTSDELLAEIAKVHAALK---SLEAGQTVEGAEEAKPSLSIKEA 61

Query: 74  IENG---CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
            +     CL C + G  FK+L RHL T H M P  Y+ ++ + S   + ++ Y+  R K+
Sbjct: 62  FKKNEVVCLICGKGG--FKTLARHLSTAHGMKPGAYKKQFGIPSKQALSAKSYSEARRKM 119

Query: 131 AKNMGL 136
           A++ GL
Sbjct: 120 AQDRGL 125


>gi|322420557|ref|YP_004199780.1| MucR family transcriptional regulator [Geobacter sp. M18]
 gi|320126944|gb|ADW14504.1| transcriptional regulator, MucR family [Geobacter sp. M18]
          Length = 168

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 69/129 (53%), Gaps = 8/129 (6%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK-PAVPIR 71
            LE+T  IV+++ S   +   D+   +  VH ALQ++       + V+ +  K PAVP++
Sbjct: 5   LLELTASIVSSHASVTEMSGEDLLLELQKVHGALQKL--EVETGEVVERDEAKEPAVPLK 62

Query: 72  KSIEN---GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           K+ +     C+ C + GM  K+L RHL   H + P EYR ++ + S   + ++ ++  R 
Sbjct: 63  KAFQPDQVSCMLCGKSGM--KTLTRHLAQVHGIKPGEYRKQFGIPSSQALTAKNFSEARR 120

Query: 129 KLAKNMGLG 137
           ++A+  GL 
Sbjct: 121 RMAQEKGLA 129


>gi|253701019|ref|YP_003022208.1| MucR family transcriptional regulator [Geobacter sp. M21]
 gi|251775869|gb|ACT18450.1| transcriptional regulator, MucR family [Geobacter sp. M21]
          Length = 177

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 70/128 (54%), Gaps = 8/128 (6%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E+   +V+A+ S+  +   ++ + I  VH+AL+++ +    +        KPA+ ++ 
Sbjct: 4   LVEIAAQLVSAHASSTPMTSDELLADIAKVHAALKKLDTGGTLETEGDA---KPALTVKN 60

Query: 73  SIENG---CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +I+     CL C + G  FK+L RHL T H+M P  YR ++ + S   +V++ Y+  R K
Sbjct: 61  AIKKNEVVCLVCGKGG--FKTLARHLTTVHDMKPGVYRKQFGIPSKQSLVAKSYSEARRK 118

Query: 130 LAKNMGLG 137
           +A + GL 
Sbjct: 119 MANDRGLA 126


>gi|39996961|ref|NP_952912.1| Ros/MucR family transcriptional regulator [Geobacter sulfurreducens
           PCA]
 gi|39983849|gb|AAR35239.1| transcriptional regulator, Ros/MucR family [Geobacter
           sulfurreducens PCA]
          Length = 167

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 70/128 (54%), Gaps = 5/128 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            LE+T  IV+++ +   +   ++   I  VH+ LQ++   A   +    E   PA+ ++K
Sbjct: 5   LLELTASIVSSHAAVSELSTEELVQEIQKVHATLQQLEGGAAAPEVAAEEAKAPAMTLKK 64

Query: 73  SIENG---CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           + +     C+ C + GM  K+L RHL   H M P EYR ++N+ S  P+ +++++  R +
Sbjct: 65  AFQADQVCCMICGKGGM--KTLTRHLAQVHQMKPGEYRKQFNIPSSQPLTAKKFSEARKQ 122

Query: 130 LAKNMGLG 137
           +AK+ GL 
Sbjct: 123 MAKDRGLA 130


>gi|242281037|ref|YP_002993166.1| MucR family transcriptional regulator [Desulfovibrio salexigens DSM
           2638]
 gi|242123931|gb|ACS81627.1| transcriptional regulator, MucR family [Desulfovibrio salexigens
           DSM 2638]
          Length = 128

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 66/134 (49%), Gaps = 9/134 (6%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRA-PCQDNVQPERLKPAVP 69
           E +L+  ++IV A  S   +   ++ S++  + + +Q +   A P Q+        PA  
Sbjct: 2   EDYLKEALEIVKAQASVRTMSEEEMTSMVRKLSAGIQAIAENALPAQEEA------PACE 55

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +KSI+   + C E G  FK + K+HL +H  +TPDEYR K+ L    P+V +     R 
Sbjct: 56  PKKSIKEKSIVCCECGKSFKIITKKHLASH-GLTPDEYREKYGLKKKTPLVCKSLQRERR 114

Query: 129 KLAKNMGLGRGRKK 142
           K  K M L   R K
Sbjct: 115 KKMKEMKLWTKRGK 128


>gi|253700837|ref|YP_003022026.1| MucR family transcriptional regulator [Geobacter sp. M21]
 gi|251775687|gb|ACT18268.1| transcriptional regulator, MucR family [Geobacter sp. M21]
          Length = 186

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 70/126 (55%), Gaps = 12/126 (9%)

Query: 18  VDIVAAYVSNHV--VPMA--DIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           V+I A  VS+H    PM   ++ + I+ VH+AL+ + +    +     +  KP+V ++++
Sbjct: 5   VEIAAQLVSSHASSTPMTSDELLAEISKVHAALKSLEAGESIEG---VDETKPSVSMKEA 61

Query: 74  I---ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
               E  CL C + G  FK+L RHL T H M P  Y+ ++ ++S   + ++ Y+  R K+
Sbjct: 62  FRKNEVVCLVCGKGG--FKTLARHLSTAHGMKPGAYKKQFGISSKQALSAKSYSEARRKM 119

Query: 131 AKNMGL 136
           A++ GL
Sbjct: 120 AQDRGL 125


>gi|197118385|ref|YP_002138812.1| MucR family transcriptional regulator [Geobacter bemidjiensis Bem]
 gi|197087745|gb|ACH39016.1| transcriptional regulator, MucR family [Geobacter bemidjiensis Bem]
          Length = 186

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 72/127 (56%), Gaps = 14/127 (11%)

Query: 18  VDIVAAYVSNHV--VPMA--DIGSLITDVHSALQRVVSRAPCQDNVQP-ERLKPAVPIRK 72
           V+I A  VS+H    PM   ++ + I+ VH+AL+ +       ++++  +  KP+V +++
Sbjct: 5   VEIAAQLVSSHASSTPMTSDELLAEISKVHAALKSL----EAGESIEGIDETKPSVSMKE 60

Query: 73  SI---ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +    E  CL C + G  FK+L RHL T H M P  Y+ ++ ++S   + ++ Y+  R K
Sbjct: 61  AFRKNEVVCLVCGKGG--FKTLARHLSTAHGMKPGAYKKQFGISSKQALSAKSYSEARRK 118

Query: 130 LAKNMGL 136
           +A++ GL
Sbjct: 119 MAQDRGL 125


>gi|317484823|ref|ZP_07943718.1| transcriptional regulator [Bilophila wadsworthia 3_1_6]
 gi|316923930|gb|EFV45121.1| transcriptional regulator [Bilophila wadsworthia 3_1_6]
          Length = 134

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 2/129 (1%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           L+  +DIV A  S  ++   +I S++  + S ++ V     C + +    ++     RKS
Sbjct: 5   LKEALDIVKAQASVRIMSEDEIISMVRRLSSDIKNVAEGEGCVEELASSDVQS--DPRKS 62

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I+   + C+E G  FK L R     HN+   EYR KW L  D P+V +     R K  K+
Sbjct: 63  IKEKSITCMECGKTFKILTRKHLASHNLDAAEYREKWGLKKDTPLVCKGLQRERRKKMKD 122

Query: 134 MGLGRGRKK 142
           M L   R+K
Sbjct: 123 MKLWEKRRK 131


>gi|298530002|ref|ZP_07017404.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509376|gb|EFI33280.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 135

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 64/130 (49%), Gaps = 3/130 (2%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E  ++  ++IV A  +   +   +I S+I  + + +Q        Q+    E   P+V  
Sbjct: 2   EDHVKQALEIVKAQAAVRNMTEEEINSMIKSLSAGIQEASKTDELQEKDSQE---PSVDP 58

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           +K+I+   + CLE G  FK L +     H+MTP+EY+ KW    +  +V++  A  R K 
Sbjct: 59  KKAIKEKSITCLECGKSFKVLTKKHFAKHDMTPEEYKAKWGYKKNQSLVAKSLARERRKK 118

Query: 131 AKNMGLGRGR 140
            ++M L + R
Sbjct: 119 MQDMELWKKR 128


>gi|197119459|ref|YP_002139886.1| Ros/MucR family transcriptional regulator [Geobacter bemidjiensis
           Bem]
 gi|197088819|gb|ACH40090.1| transcriptional regulator, Ros/MucR family [Geobacter bemidjiensis
           Bem]
          Length = 169

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 67/127 (52%), Gaps = 6/127 (4%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            LE+T +IV+++ S   +   D+   +  VH ALQ++   A  +   + +   PA+ ++K
Sbjct: 5   LLELTANIVSSHASVTEMSGEDLLLELQKVHVALQKLEVEA-GEGAEKADARGPAISLKK 63

Query: 73  SIEN---GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           + +     C+ C + GM  K+L RHL   H M P EYR  + + S   + +R ++  R +
Sbjct: 64  AFQPDQVSCMLCGKSGM--KTLARHLAQVHGMKPGEYRKLFGIPSGQALTARNFSEARRR 121

Query: 130 LAKNMGL 136
           +A+  GL
Sbjct: 122 MAQEKGL 128


>gi|253699803|ref|YP_003020992.1| MucR family transcriptional regulator [Geobacter sp. M21]
 gi|251774653|gb|ACT17234.1| transcriptional regulator, MucR family [Geobacter sp. M21]
          Length = 169

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 67/127 (52%), Gaps = 6/127 (4%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            LE+T +IV+++ S   +   D+   +  VH ALQ++   A  +   + +   PA+ ++K
Sbjct: 5   LLELTANIVSSHASVTEMSGEDLLLELQKVHVALQKLEVEA-GEGAEKADAKGPAISLKK 63

Query: 73  SIEN---GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           + +     C+ C + GM  K+L RHL   H M P EYR  + + S   + +R ++  R +
Sbjct: 64  AFQPDQISCMLCGKSGM--KTLARHLAQVHGMKPGEYRKLFGIPSGQALTARNFSEARRR 121

Query: 130 LAKNMGL 136
           +A+  GL
Sbjct: 122 MAQEKGL 128


>gi|303247430|ref|ZP_07333702.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
 gi|302491126|gb|EFL51018.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
          Length = 134

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 63/133 (47%), Gaps = 2/133 (1%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E FL+  ++IV A  S   +   +I S++  +   ++ +VS        + E   P V  
Sbjct: 2   EDFLKEALEIVKAQASVRNMTEEEITSMVRRLSDDIRGIVSAGTAIPGGEAEAPTPPVDP 61

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K++    + CLE G  FK L K+HL +   +TPD YR KW      P+V +E    R K
Sbjct: 62  KKAVRERSIICLESGKSFKILTKKHL-SKFGLTPDTYREKWGYPKGMPLVCKELQRERRK 120

Query: 130 LAKNMGLGRGRKK 142
             K M L   R K
Sbjct: 121 KMKEMRLWEKRVK 133


>gi|46581483|ref|YP_012291.1| transcriptional regulator [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601348|ref|YP_965748.1| MucR family transcriptional regulator [Desulfovibrio vulgaris DP4]
 gi|46450905|gb|AAS97551.1| transcriptional regulator, putative [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120561577|gb|ABM27321.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris DP4]
 gi|311235133|gb|ADP87987.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris
           RCH1]
          Length = 132

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 65/134 (48%), Gaps = 3/134 (2%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E  L+  ++IV A  S   +   +I S++  + +A++ +    P +   QPE     V  
Sbjct: 2   EDHLKQALEIVKAQASVRTMTEDEISSMVFKLANAIRSISDGEPAE---QPEAEAAPVDA 58

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
            ++++   + CLE G  FK + R     H++TPD YR K+    D P+V +     R K 
Sbjct: 59  SRALKEKSITCLECGKSFKIITRKHLMLHDLTPDTYREKYGYKKDMPLVCKALQRERRKK 118

Query: 131 AKNMGLGRGRKKRV 144
            K+M L   R+K V
Sbjct: 119 MKDMKLWEKRRKTV 132


>gi|116747798|ref|YP_844485.1| MucR family transcriptional regulator [Syntrophobacter fumaroxidans
           MPOB]
 gi|116696862|gb|ABK16050.1| transcriptional regulator, MucR family [Syntrophobacter
           fumaroxidans MPOB]
          Length = 177

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 67/140 (47%), Gaps = 20/140 (14%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV--------------VSRAPCQD 57
           + LE+ V+IV A VS   +   +I S++  V++AL R+              +      +
Sbjct: 4   KLLELAVEIVQAQVSIGKMTGEEIESVLVRVYNALHRMRRAEEEGRPVAMEEIGYGAADE 63

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDY 116
           +  P +  P    R SI+   + C+E G QF+ L   HL+TH  +TP EY+ KW      
Sbjct: 64  HEPPGKGDP----RDSIQEDQVICMECGSQFRQLTANHLRTH-QLTPREYKRKWGFPLKQ 118

Query: 117 PMVSREYATTRSKLAKNMGL 136
           P+ +R     RS+ AK  GL
Sbjct: 119 PLAARVLTKLRSRSAKKRGL 138


>gi|46580931|ref|YP_011739.1| transcriptional regulator [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601767|ref|YP_966167.1| MucR family transcriptional regulator [Desulfovibrio vulgaris DP4]
 gi|46450351|gb|AAS96999.1| transcriptional regulator, putative [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120561996|gb|ABM27740.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris DP4]
 gi|311234622|gb|ADP87476.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris
           RCH1]
          Length = 132

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 67/131 (51%), Gaps = 5/131 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           FL+  ++IV A  S   +   +I +++  + + L+ +   A  + N++    +     RK
Sbjct: 4   FLKEALEIVKAQASVRTMTEDEITAMVRKLATGLKAI---AEGEMNLEEGCCETGGDPRK 60

Query: 73  SIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           +I+   + CLE G  FK L K+HL +H  + PD YR KW L  + P+V +     R K  
Sbjct: 61  AIKEKTITCLECGKSFKILTKKHLASH-GLDPDSYREKWGLKKNSPLVCKSLQRERRKKM 119

Query: 132 KNMGLGRGRKK 142
           K+M L   R+K
Sbjct: 120 KDMKLWEKRRK 130


>gi|209545591|ref|YP_002277820.1| MucR family transcriptional regulator [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533268|gb|ACI53205.1| transcriptional regulator, MucR family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 299

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           +R  P  P++ S+    L CL  G  F  LKRH++  H  TP+ YR+ W L ++YPM S 
Sbjct: 201 KRDHPTHPVQNSVREDSLTCLHCGEAFTMLKRHIENKHRQTPEAYRVYWGLPANYPMASE 260

Query: 122 EYATTRSKLAKNMGLGR-GRKKR 143
            Y+  +   A+    G   R+KR
Sbjct: 261 AYSEMKKAEAEISKFGSYDRRKR 283


>gi|332703277|ref|ZP_08423365.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332553426|gb|EGJ50470.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 134

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 67/136 (49%), Gaps = 15/136 (11%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           FL+  ++IV A  S   +   +I S++  +   +Q + +      +   E   PA   +K
Sbjct: 4   FLKEALEIVKAQASVRNMTEEEIISMVKSLAGGIQAIGA------SEGGEAFNPAEDPKK 57

Query: 73  SIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           +++   + CL+ G  FK L K+HL TH  +TPD+YR KW+     P+V +     R K  
Sbjct: 58  AVKEKTIVCLDCGKSFKILTKKHLSTH-GLTPDQYREKWDYPKKMPLVCKSLQRERRKKM 116

Query: 132 KNM-------GLGRGR 140
           K+M       G G+G+
Sbjct: 117 KDMRLWEKRTGTGKGK 132


>gi|239908073|ref|YP_002954814.1| hypothetical protein DMR_34370 [Desulfovibrio magneticus RS-1]
 gi|239797939|dbj|BAH76928.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 133

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 61/132 (46%), Gaps = 2/132 (1%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +L+  ++IV A   +  +   +I S++  V S +  + +  P     Q E   P +  
Sbjct: 2   EEYLQSALEIVKAQAGSRPMTEEEILSMVKSVASGIAALTTGQPVLG--QEEAAAPGMDP 59

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           +KSI+   + CLE G  FK + R     H +TP+EYR K+       +  +  A  R   
Sbjct: 60  KKSIKEASIACLECGKSFKVITRKHLASHGLTPEEYRAKYGFKKTQALACKSLARERRAK 119

Query: 131 AKNMGLGRGRKK 142
            K+M L   R+K
Sbjct: 120 MKDMKLWERRQK 131


>gi|283850461|ref|ZP_06367749.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
 gi|283574032|gb|EFC22004.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
          Length = 134

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 65/132 (49%), Gaps = 2/132 (1%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           FL+  ++IV A  S   +   +I S++  +   ++ +V+        + E   PAV  +K
Sbjct: 4   FLKEALEIVKAQASVRNMTEEEITSMVRRLSDDIRGLVAAGAAAGAPEAEVQTPAVDPKK 63

Query: 73  SIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           ++    + CLE G  FK L K+HL +   +TPD YR KW    + P+V +E    R K  
Sbjct: 64  AVRERSIICLESGKSFKILTKKHL-SKFGLTPDTYREKWGYPKNMPLVCKELQRERRKKM 122

Query: 132 KNMGLGRGRKKR 143
           K M L   R K+
Sbjct: 123 KEMKLWEKRIKK 134


>gi|220904570|ref|YP_002479882.1| MucR family transcriptional regulator [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219868869|gb|ACL49204.1| transcriptional regulator, MucR family [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 132

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 64/133 (48%), Gaps = 9/133 (6%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVV-SRAPCQ-DNVQPERLKPAVPI 70
           +L+  ++I  A     V+   +I + I  V   ++ V    AP + D+ +      A   
Sbjct: 4   YLKEALEITRAQAGVRVMSEEEIATFIQKVALGIRAVAEGEAPSEMDSAEM-----AQEG 58

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           RKS++   + CLE G  FK L KRHL   H+MT  EYR KW    D P+V +     R K
Sbjct: 59  RKSVKEKSVTCLECGKSFKILTKRHL-AGHDMTTAEYREKWGFKKDAPLVCKALQRERRK 117

Query: 130 LAKNMGLGRGRKK 142
             K+M L   R+K
Sbjct: 118 KMKDMKLWEKRRK 130


>gi|162147484|ref|YP_001601945.1| transcriptional regulator protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786061|emb|CAP55643.1| putative transcriptional regulator protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 171

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 44/83 (53%), Gaps = 1/83 (1%)

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           +R  P  P++ S+    L CL  G  F  LKRH++  H  TP+ YR+ W L ++YPM S 
Sbjct: 73  KRDHPTHPVQNSVREDSLTCLHCGEAFTMLKRHIENKHRQTPEAYRVYWGLPANYPMASE 132

Query: 122 EYATTRSKLAKNMGLGR-GRKKR 143
            Y+  +   A+    G   R+KR
Sbjct: 133 AYSEMKKAEAEISKFGSYDRRKR 155


>gi|84502389|ref|ZP_01000525.1| Transcriptional regulator [Oceanicola batsensis HTCC2597]
 gi|84389201|gb|EAQ01998.1| Transcriptional regulator [Oceanicola batsensis HTCC2597]
          Length = 98

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 37/60 (61%)

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           L+PAV I  S+    L CLE G +   L+RHL+    MTP+EYR +W L  +YPMV+  Y
Sbjct: 25  LRPAVRIEDSVTPNFLVCLETGSRQVLLRRHLRETLRMTPEEYRDRWGLPPEYPMVAANY 84


>gi|303326659|ref|ZP_07357101.1| putative transcriptional regulator [Desulfovibrio sp. 3_1_syn3]
 gi|302862647|gb|EFL85579.1| putative transcriptional regulator [Desulfovibrio sp. 3_1_syn3]
          Length = 132

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 63/131 (48%), Gaps = 5/131 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           +L+  ++I  A     ++   +I + I  V   ++ V   A  +  V+ +  + A   RK
Sbjct: 4   YLKEALEITRAQAGVRIMTEEEIAAFIQKVAMGIRAV---AEGEAPVELDSAEMAQEARK 60

Query: 73  SIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           S++   + CLE G  FK L KRHL +H  M   EYR KW    D P+V +     R K  
Sbjct: 61  SVKEKSVTCLECGKSFKILTKRHLASH-GMDTAEYREKWGFKKDAPLVCKALQRERRKKM 119

Query: 132 KNMGLGRGRKK 142
           K+M L   R+K
Sbjct: 120 KDMKLWEKRRK 130


>gi|258406651|ref|YP_003199392.1| transcriptional regulator, MucR family [Desulfohalobium retbaense
           DSM 5692]
 gi|257798878|gb|ACV69814.1| transcriptional regulator, MucR family [Desulfohalobium retbaense
           DSM 5692]
          Length = 134

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E  ++  ++IV A      +   ++ S++ ++ S L+R+      Q+  + ++ +PAV  
Sbjct: 2   EDHMKQALEIVKAQAGVRTMTEEEMTSMVANIASKLKRIEGGE--QEPQEEQKQEPAVDP 59

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I    + CLE G  FK L KRHL TH  +TP EY+ KW       ++++  A  R K
Sbjct: 60  KKAIREKSVVCLECGKTFKVLTKRHLATH-GLTPAEYKAKWGFKKTQSLIAKSLARERKK 118

Query: 130 LAKNMGLGRGRKKR 143
             + M L + R+K+
Sbjct: 119 KMQEMQLWKRREKK 132


>gi|258405035|ref|YP_003197777.1| transcriptional regulator, MucR family [Desulfohalobium retbaense
           DSM 5692]
 gi|257797262|gb|ACV68199.1| transcriptional regulator, MucR family [Desulfohalobium retbaense
           DSM 5692]
          Length = 137

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 4/134 (2%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +++  ++IV A      +   +I S++  +   L+ +       +  + +  +PAV  
Sbjct: 2   EDYMKQALEIVKAQAGVRNMSEEEITSMVQALSQKLKNLEEGTQ--EQEEQQEQQPAVDP 59

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I    + CLE G QFK L K+HL TH  +TP EY+ KW       ++++  A  R K
Sbjct: 60  KKAIREKSVICLECGKQFKVLTKKHLATH-GLTPAEYKEKWGFKKTQALIAKSLARERKK 118

Query: 130 LAKNMGLGRGRKKR 143
             + M L   RKK+
Sbjct: 119 KMQEMQLWERRKKK 132


>gi|256830061|ref|YP_003158789.1| MucR family transcriptional regulator [Desulfomicrobium baculatum
           DSM 4028]
 gi|256579237|gb|ACU90373.1| transcriptional regulator, MucR family [Desulfomicrobium baculatum
           DSM 4028]
          Length = 134

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 68/138 (49%), Gaps = 9/138 (6%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR-APCQDNVQPERLKPAVP 69
           E +L+  ++IV A  S   +   +I S+I  +  +++ V    AP  D       +PAV 
Sbjct: 2   EDYLKQAIEIVKAQASVRNMNEDEITSMIRALTQSIRGVAEGVAPIVDT------EPAVD 55

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            + +I    + C E G  FK L KRHL TH  +TP+EYR K+       +V++  A  R 
Sbjct: 56  PKNAIREKSVICCECGKSFKVLTKRHLATH-GLTPEEYREKFGYKKGTSLVAKSLARDRR 114

Query: 129 KLAKNMGLGRGRKKRVLT 146
           K  + M L   RKK V T
Sbjct: 115 KTMQGMKLWEKRKKAVKT 132


>gi|89068740|ref|ZP_01156126.1| transcriptional regulator, MucR family protein [Oceanicola
           granulosus HTCC2516]
 gi|89045703|gb|EAR51765.1| transcriptional regulator, MucR family protein [Oceanicola
           granulosus HTCC2516]
          Length = 151

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 41/71 (57%)

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           +PI +++    +YCL  G  FK LKRHL   H +T  +YR ++ L  + P+V+  Y+  +
Sbjct: 65  LPIEQAVTPDKVYCLCCGRGFKMLKRHLGAEHGLTEQQYRRRFGLPEEMPLVAPNYSRQK 124

Query: 128 SKLAKNMGLGR 138
           +  AK  G G+
Sbjct: 125 ASYAKGAGFGK 135


>gi|297568261|ref|YP_003689605.1| transcriptional regulator, MucR family [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924176|gb|ADH84986.1| transcriptional regulator, MucR family [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 182

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 65/130 (50%), Gaps = 10/130 (7%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSAL---QRVVSRAPCQDNVQPERLKPAVP 69
            +EM  ++V A  S+  +   ++   +   ++ L   Q+  SR    D       KPA+ 
Sbjct: 5   LVEMAAELVQAQCSSTSLTAEEMAQSLQATYNVLHNLQQDESRGVAAD---VGLAKPALT 61

Query: 70  I--RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
               KSI+   + CLE G +FK+L  +HL+T H +T  EYR KW L+   P+ +RE    
Sbjct: 62  GSPEKSIQKHKIVCLECGEEFKTLSSKHLQT-HGLTGREYRQKWGLSLRQPLCARELTDR 120

Query: 127 RSKLAKNMGL 136
           R KL K  GL
Sbjct: 121 RKKLGKARGL 130


>gi|218508298|ref|ZP_03506176.1| transcriptional regulator protein - nodulation competitiveness
          determinant [Rhizobium etli Brasil 5]
          Length = 166

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 36/46 (78%)

Query: 1  MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSAL 46
          M D A+ +  E  +E+T DIVAAYVSNHVVP++D+ +LI+DVH AL
Sbjct: 1  MTDMATGNGPELLVELTADIVAAYVSNHVVPVSDLANLISDVHLAL 46


>gi|94263369|ref|ZP_01287184.1| transcriptional regulator-like [delta proteobacterium MLMS-1]
 gi|93456324|gb|EAT06454.1| transcriptional regulator-like [delta proteobacterium MLMS-1]
          Length = 200

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 66/142 (46%), Gaps = 10/142 (7%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV----VSRAPCQDNVQPERLKPAV 68
             EM  ++V A +S+  +   D+   + +  S L+ +    V  A    +V P    P  
Sbjct: 5   LTEMAAELVCAQLSSTSMSQEDVSKALHETFSTLKSLKNAEVGGATETSHVSPLAETPM- 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
              KSI+   + CLE G +F+SL  +HL+  H +T  EYR KW  +   P+ ++E    R
Sbjct: 64  ---KSIQKHKIICLECGEEFRSLSSKHLQG-HELTGKEYRRKWGFSMRQPLCAKELTAQR 119

Query: 128 SKLAKNMGLGRGRKKRVLTSKV 149
            +  K  GL    +K +L  K 
Sbjct: 120 KEAGKKRGLPENLRKSMLAKKA 141


>gi|283851225|ref|ZP_06368508.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
 gi|283573394|gb|EFC21371.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
          Length = 137

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 69/138 (50%), Gaps = 6/138 (4%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +L+  ++IV A  S   +   +I S++ +V + +Q         ++V  E   PA+  
Sbjct: 2   EEYLKAALEIVKAQASVRTMTDEEITSMLRNVAAGIQAAAE----AESVPAEAAAPAMDP 57

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            K+++   + CLE G  FK L K+HL  H  +TP+EYR K+      P+ ++     R K
Sbjct: 58  SKAVKESSVVCLECGKAFKVLTKKHLGAH-GLTPEEYRAKYGYKKGAPLAAKSLQRERRK 116

Query: 130 LAKNMGLGRGRKKRVLTS 147
             K+M L   R+K V  +
Sbjct: 117 KMKDMRLWERRRKPVAAA 134


>gi|94266495|ref|ZP_01290185.1| transcriptional regulator-like [delta proteobacterium MLMS-1]
 gi|93452882|gb|EAT03396.1| transcriptional regulator-like [delta proteobacterium MLMS-1]
          Length = 199

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 66/142 (46%), Gaps = 10/142 (7%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV----VSRAPCQDNVQPERLKPAV 68
             EM  ++V A +S+  +   D+   + +  S L+ +    V  A    +V P    P  
Sbjct: 5   LTEMAAELVCAQLSSTSMSQEDVSKALHETFSTLKSLKNAEVGGATETSHVSPLAETPM- 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
              KSI+   + CLE G +F+SL  +HL+  H +T  EYR KW  +   P+ ++E    R
Sbjct: 64  ---KSIQKHKIICLECGEEFRSLSSKHLQ-GHELTGKEYRRKWGFSMRQPLCAKELTAQR 119

Query: 128 SKLAKNMGLGRGRKKRVLTSKV 149
            +  K  GL    +K +L  K 
Sbjct: 120 KEAGKKRGLPENLRKSMLAKKA 141


>gi|298528759|ref|ZP_07016163.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298512411|gb|EFI36313.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 139

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (49%), Gaps = 4/131 (3%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E  ++  ++IV A  S   +   +I S+I  +   +Q+  S+   +   + E+ +PA   
Sbjct: 2   EDHVKQALEIVKAQASVRNMTEEEINSMIKSLSEGIQKA-SQEVAEPQAEQEQ-QPATDP 59

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I    + CLE G  FK L K+H    H+MT +EY+ KW    +  +V +  A  R K
Sbjct: 60  KKAIREKSILCLECGKSFKVLTKKHF-AKHDMTTEEYKEKWGYKKNQSLVCKSLARERKK 118

Query: 130 LAKNMGLGRGR 140
             + M L + R
Sbjct: 119 KMQEMELWKKR 129


>gi|239907041|ref|YP_002953782.1| hypothetical protein DMR_24050 [Desulfovibrio magneticus RS-1]
 gi|239796907|dbj|BAH75896.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 133

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/131 (30%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI--R 71
           L+  ++IV A      +  A+I S+I  V   +  V+S        +P+  + AV +  +
Sbjct: 5   LKSAIEIVTAQAKTRAMTEAEIVSMIQSVSGGISFVMS-----SQGEPDAQEAAVIMNPK 59

Query: 72  KSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
            S+++  + CLE G  FK L K+HL   HN+TP+EYR K+      P+V++     R K 
Sbjct: 60  DSVKDRSVTCLECGKVFKVLTKKHL-VAHNLTPEEYRAKYGFKKGAPLVAKSLQRERRKK 118

Query: 131 AKNMGLGRGRK 141
            + M L   +K
Sbjct: 119 MEEMRLWERKK 129


>gi|116747683|ref|YP_844370.1| MucR family transcriptional regulator [Syntrophobacter fumaroxidans
           MPOB]
 gi|116696747|gb|ABK15935.1| transcriptional regulator, MucR family [Syntrophobacter
           fumaroxidans MPOB]
          Length = 181

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/138 (28%), Positives = 67/138 (48%), Gaps = 12/138 (8%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR----------APCQDNV 59
           S++ LE+T +IV A  +   +   +I   +    + LQR+ +           APC+D+ 
Sbjct: 2   SKKLLEITAEIVQAQATVGKMSPEEIELTLVRTFATLQRMQTAEDGGKPLDPGAPCEDSR 61

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPM 118
             +R         SI+   + CLE G++ + L  +HL +H N+ P EY+ KW L     +
Sbjct: 62  LEDRTGDKGGPMDSIQENKVVCLECGVEMRQLTAKHLGSH-NLNPREYKRKWGLPLKQSL 120

Query: 119 VSREYATTRSKLAKNMGL 136
            ++  +  RSK A+  GL
Sbjct: 121 SAKSLSKARSKAARKRGL 138


>gi|332701276|ref|ZP_08421364.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332551425|gb|EGJ48469.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 135

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 3/133 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVV-SRAPCQDNVQPERLKPAVPIR 71
           +L+  ++IV A  S   +   +I S++  +   ++ V       + N   E  +     +
Sbjct: 4   YLKEALEIVKAQASVRNMTEEEITSMVMKLAEGIRNVGDGFMETEGNGNGEPQEAVTDPK 63

Query: 72  KSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           K++ +  + CLE G  FK+L KRHL   + +TPDEYR KW    + P+V +     R K 
Sbjct: 64  KAVRDKSITCLECGCSFKTLTKRHL-IKYGLTPDEYRDKWGYPHNMPLVCKSLQRERRKK 122

Query: 131 AKNMGLGRGRKKR 143
            K M L   R K+
Sbjct: 123 MKEMRLWERRAKK 135


>gi|212702312|ref|ZP_03310440.1| hypothetical protein DESPIG_00323 [Desulfovibrio piger ATCC 29098]
 gi|212674258|gb|EEB34741.1| hypothetical protein DESPIG_00323 [Desulfovibrio piger ATCC 29098]
          Length = 136

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 61/131 (46%), Gaps = 5/131 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           +L+  ++I  A  S  V+   +I S I  V + ++ V   A  +  V+ +        RK
Sbjct: 8   YLKEALEIARAQASVRVMSEEEITSFIQKVAAGIRTV---AEGEMPVELDSADMQQDARK 64

Query: 73  SIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           SI+   + CLE G  FK L KRHL   H M    YR KW    D P+V +     R +  
Sbjct: 65  SIKEKSVTCLECGKTFKILTKRHL-AMHGMDAAAYREKWGFKKDTPLVCKALQRERRRKM 123

Query: 132 KNMGLGRGRKK 142
           K+M L   R+K
Sbjct: 124 KDMKLWEKRRK 134


>gi|323697662|ref|ZP_08109574.1| transcriptional regulator, MucR family [Desulfovibrio sp. ND132]
 gi|323457594|gb|EGB13459.1| transcriptional regulator, MucR family [Desulfovibrio desulfuricans
           ND132]
          Length = 130

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 65/135 (48%), Gaps = 9/135 (6%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +L+  ++IV A  S   +   +I S++  + + + + ++     D+  P  + P    
Sbjct: 2   EDYLQEALEIVKAQASVRTMTEEEITSMVQKLAAGI-KAIAEGEAVDSAMPATIDP---- 56

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I    + C   G  FK L K+HL TH  MTP+EYR ++      P+V +     R K
Sbjct: 57  QKAIREKSILCCACGKSFKVLTKKHLATH-GMTPEEYREQYGYKKKLPLVCKSLQRERRK 115

Query: 130 LAKNMGL--GRGRKK 142
             K M L   RG+ K
Sbjct: 116 KMKEMQLWTKRGKNK 130


>gi|303328482|ref|ZP_07358919.1| putative transcriptional regulator [Desulfovibrio sp. 3_1_syn3]
 gi|302861476|gb|EFL84413.1| putative transcriptional regulator [Desulfovibrio sp. 3_1_syn3]
          Length = 134

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 63/131 (48%), Gaps = 5/131 (3%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           +L+  ++I  A  S  V+   +I + +  V   + RVV  A  +  V+    +  +  RK
Sbjct: 4   YLKEALEIAKAQASVRVMKEEEITAFVQKVTQGI-RVV--AETEQPVEMSTEEMVLEGRK 60

Query: 73  SIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           S++   + CLE G  FK L KRHL TH  ++ DEYR KW       +V +     R K  
Sbjct: 61  SVKEKSVTCLECGKNFKVLTKRHLATH-GISTDEYREKWGFKKGSALVCKALQRERRKKM 119

Query: 132 KNMGLGRGRKK 142
            +M L   R+K
Sbjct: 120 NDMKLWERRRK 130


>gi|283852310|ref|ZP_06369581.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
 gi|283572267|gb|EFC20256.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
          Length = 132

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 6/132 (4%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI-- 70
           +L + +DIV A      +   +I  +++ + ++++ + S AP      P    PA  +  
Sbjct: 4   YLSLALDIVKAQAKTRNMTEEEITGMVSKLATSIRTIDSGAP----AAPGGEGPAGSLDA 59

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           +K+++   + C+E G  FK L R       +TP++YR KW+     P+V +     R K 
Sbjct: 60  KKAVKERSITCMESGKAFKILTRRHLAKFGLTPEQYREKWSYPKGMPLVCKSLQRERRKK 119

Query: 131 AKNMGLGRGRKK 142
            + M L   R K
Sbjct: 120 MREMKLWERRGK 131


>gi|298530753|ref|ZP_07018155.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510127|gb|EFI34031.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 132

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 61/132 (46%), Gaps = 5/132 (3%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +L+  ++IV A  S   +   ++ ++I  +   ++      P       +   P V  
Sbjct: 2   EEYLKEALEIVKAQASVRNMTEEEMSAMILALSRGIRETAREMP---GAASQSAAPGVDP 58

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            ++I    + CLE G  F+ L K+HL   H MTP+EY+ KW    +  +V+R     R K
Sbjct: 59  ARAIREKSILCLECGKSFRVLTKKHL-GKHGMTPEEYKAKWGYKKNTSLVARSLTRNRRK 117

Query: 130 LAKNMGLGRGRK 141
             + M L + R+
Sbjct: 118 RMQEMQLWKKRQ 129


>gi|78355393|ref|YP_386842.1| MucR family transcriptional regulator [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78217798|gb|ABB37147.1| transcriptional regulator, MucR family [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 130

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 66/134 (49%), Gaps = 6/134 (4%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +L+  ++IV A  S   +   +I +++  +   ++ +   + C    +   +  AV  
Sbjct: 2   EAYLKEALEIVKAQASVRTMTEEEITTMVKTLAEGIKNI---SECSVTAEDAAV-DAVDA 57

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I+   + C+E G  FK L K+HL TH  +TPDEYR K       P+V +     R K
Sbjct: 58  KKAIKEKTITCVECGKSFKILTKKHLATH-GLTPDEYRAKCGYKKGTPLVCKSLQRERRK 116

Query: 130 LAKNMGLGRGRKKR 143
             K+M L   R ++
Sbjct: 117 KMKDMKLWERRTQK 130


>gi|301059672|ref|ZP_07200580.1| transcriptional regulator family protein [delta proteobacterium
           NaphS2]
 gi|300446238|gb|EFK10095.1| transcriptional regulator family protein [delta proteobacterium
           NaphS2]
          Length = 144

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 57/126 (45%), Gaps = 1/126 (0%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
             EM V++  A  S+  +   D+ + +T     L+ +       +    E  +P +  +K
Sbjct: 5   LTEMAVELATAQASHATMSDEDMETYLTKTFQTLKHLKDVEEGAEITTEEPAEPQLDPKK 64

Query: 73  SIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           SI    + CLE G +FK L  +HL+  H M   EYR K+  +S   + +R  +  R   A
Sbjct: 65  SILKNKVICLECGREFKILTSKHLQKEHGMDSKEYRQKYGFSSRQSLAARSLSAQRRATA 124

Query: 132 KNMGLG 137
           K   LG
Sbjct: 125 KKHKLG 130


>gi|303248757|ref|ZP_07335009.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
 gi|302489844|gb|EFL49773.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
          Length = 132

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 67/135 (49%), Gaps = 6/135 (4%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +L+  ++IV A  S   +   +I S++  +   ++ +   AP ++  Q   + P    
Sbjct: 2   EEYLKSALEIVKAQASVRNMTDEEITSMVRRLAIGIRDISGEAPAEEAQQAVGMDP---- 57

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I+   + CLE G  FK + K+HL +H  +TP+EY+ K       P+V +     R K
Sbjct: 58  KKAIKEKSVTCLECGKSFKVITKKHLASH-GLTPEEYKAKHGYKKSMPLVCKSLQRDRRK 116

Query: 130 LAKNMGLGRGRKKRV 144
             K+M L   + K V
Sbjct: 117 KMKDMRLWEKKGKVV 131


>gi|78357655|ref|YP_389104.1| MucR family transcriptional regulator [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78220060|gb|ABB39409.1| transcriptional regulator, MucR family [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 156

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 66/132 (50%), Gaps = 7/132 (5%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           +L+  ++IV A  S   +   +I S++  + S ++ +     C+ +V P+    A   ++
Sbjct: 28  YLKEALEIVKAQASVRNMTEDEITSMVMKLASGIKGI-----CEGSVTPDGGMDAQAAQR 82

Query: 73  SIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           SI+   + CLE G  FK + K+HL   H++    YR KW    + P+V +     R K  
Sbjct: 83  SIKEKTISCLECGKSFKIITKKHL-ALHDLDAVSYREKWGFKKNTPLVCKSLQRERRKKM 141

Query: 132 KNMGLGRGRKKR 143
           K+M L   R+K+
Sbjct: 142 KDMQLWEKRRKQ 153


>gi|218886076|ref|YP_002435397.1| MucR family transcriptional regulator [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757030|gb|ACL07929.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 132

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 60/133 (45%), Gaps = 6/133 (4%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER-LKPAVPIR 71
           FL+  ++IV A  S   +   +I S++  + + +     RA      +PE   +     R
Sbjct: 4   FLKEALEIVKAQASVRTMTEDEITSMVQKLANGI-----RAISLGEAEPEEACETCGDPR 58

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           K+++   + CLE G  FK L R     H +    YR KW L  + P+V +     R K  
Sbjct: 59  KAVKEKSITCLECGKSFKILTRKHLASHGLDAAAYREKWGLKKNTPLVCKALQRERRKKM 118

Query: 132 KNMGLGRGRKKRV 144
           K+M L   R+K V
Sbjct: 119 KDMKLWEKRRKHV 131


>gi|239909130|ref|YP_002955872.1| hypothetical protein DMR_44950 [Desulfovibrio magneticus RS-1]
 gi|239798997|dbj|BAH77986.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 131

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 7/126 (5%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E  L M ++IV A      +   +I +++  + + ++ +   A     + P+        
Sbjct: 2   EDHLAMAIEIVKAQAKVRNMKEDEIRAMVASLSATIRDMDLAAATGAGMPPD-------A 54

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           +++I+   + CLE G  FK L R     + +TPDEYR KW  A D P+V +     R K 
Sbjct: 55  KRAIKERTITCLESGKPFKILTRKHLAKYGLTPDEYRAKWGYARDMPLVCKALQRERRKK 114

Query: 131 AKNMGL 136
            + + L
Sbjct: 115 MRELRL 120


>gi|256828325|ref|YP_003157053.1| MucR family transcriptional regulator [Desulfomicrobium baculatum
           DSM 4028]
 gi|256577501|gb|ACU88637.1| transcriptional regulator, MucR family [Desulfomicrobium baculatum
           DSM 4028]
          Length = 130

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 64/134 (47%), Gaps = 6/134 (4%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +++  ++IV A  S   +   ++ S+I  +   ++ V       +  +PE        
Sbjct: 2   EEYVKQALEIVKAQASVRNMNEEELTSMIRSLTEGIKNVAE----GNQPEPEATLSLDDA 57

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I    + C+E    FK L KRHL TH  +TP+EYR KW       +V++  A  R K
Sbjct: 58  KKAIREKSIICMECSKSFKVLTKRHLATH-GLTPEEYREKWGYKKGTSLVAKSLARDRRK 116

Query: 130 LAKNMGLGRGRKKR 143
             ++M L   R K+
Sbjct: 117 KMQDMKLWEKRVKK 130


>gi|240142212|ref|YP_002966722.1| hypothetical protein MexAM1_META2p0534 [Methylobacterium extorquens
           AM1]
 gi|240012156|gb|ACS43381.1| Hypothetical protein MexAM1_META2p0534 [Methylobacterium extorquens
           AM1]
          Length = 322

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 9/94 (9%)

Query: 56  QDNVQPERLKPAVPIRKSI--------ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYR 107
           Q    P   K    IRK++          G + CLEDG   + LK+HLK    + P EY 
Sbjct: 195 QPTYAPRSAKEVEKIRKAVFVNDYEGKTGGFVRCLEDGQIRRMLKKHLK-FLEIPPAEYL 253

Query: 108 IKWNLASDYPMVSREYATTRSKLAKNMGLGRGRK 141
            KW L +D+P+V  +++ +R+   K  GL   R+
Sbjct: 254 AKWGLPADFPLVHPDFSASRANQIKTAGLWEQRR 287


>gi|239905505|ref|YP_002952244.1| ROSMUCR family transcriptional regulator [Desulfovibrio magneticus
           RS-1]
 gi|239795369|dbj|BAH74358.1| ROSMUCR family transcriptional regulator [Desulfovibrio magneticus
           RS-1]
          Length = 132

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 65/133 (48%), Gaps = 6/133 (4%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +L+  ++IV A  S   +   +I S++ +V + +Q          +       PA+  
Sbjct: 2   EEYLKAALEIVKAQASVRTMTDDEITSMLRNVAAGIQAAAEAEAAPTDAPT----PAMDP 57

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            K+++   + CLE G  FK L K+HL   HN+TP+EYR K+      P+ ++     R K
Sbjct: 58  SKAVKESSVVCLECGKSFKVLTKKHL-AAHNLTPEEYRAKYGYKKGAPLAAKSLQRERRK 116

Query: 130 LAKNMGLGRGRKK 142
             K+M L   R+K
Sbjct: 117 KMKDMRLWERRRK 129


>gi|256829069|ref|YP_003157797.1| MucR family transcriptional regulator [Desulfomicrobium baculatum
           DSM 4028]
 gi|256578245|gb|ACU89381.1| transcriptional regulator, MucR family [Desulfomicrobium baculatum
           DSM 4028]
          Length = 133

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 67/134 (50%), Gaps = 9/134 (6%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE-RLKPAVP 69
           E  L+  ++IV A  S   +   +I S+I  +  +++ V       + V P    +PAV 
Sbjct: 2   EDSLKQAIEIVKAQASVRNMNEDEITSMIKALAGSIRGVA------EGVAPVVETEPAVD 55

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            + +I    + C E G  FK L KRHL TH  +TP++Y+ K+       +V++  A +R 
Sbjct: 56  PKNAIREKSVICCECGKSFKVLTKRHLITH-GLTPEQYKEKYGYKKGTSLVAKSLARSRR 114

Query: 129 KLAKNMGLGRGRKK 142
           K  ++M L   RKK
Sbjct: 115 KTMQDMKLWEKRKK 128


>gi|332702257|ref|ZP_08422345.1| ROSMUCR transcriptional regulator [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332552406|gb|EGJ49450.1| ROSMUCR transcriptional regulator [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 137

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 58/135 (42%), Gaps = 3/135 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
           +LE  + IV A      +   ++ S+   +   L+  V   P     Q E  + A+   K
Sbjct: 3   YLEEALKIVKAQAGVRQMTPEEMISMTKKICQGLKEAV---PEGSQAQGEEEECALSPDK 59

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           +I    + CLE G +FK L R   + H ++P EY+ KW       ++++  A  R K   
Sbjct: 60  AIRERSVQCLECGKKFKVLTRKHLSQHGLSPKEYKAKWGYKKGTSLIAKGLARDRRKKMG 119

Query: 133 NMGLGRGRKKRVLTS 147
            + L   R  R  TS
Sbjct: 120 ELKLWEKRGSRGATS 134


>gi|303247568|ref|ZP_07333839.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
 gi|302491048|gb|EFL50942.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
          Length = 136

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 66/133 (49%), Gaps = 6/133 (4%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +L+  ++IV A  S   +   +I S++ +V + +Q         +    E + PA+  
Sbjct: 2   EDYLKAALEIVKAQASVRTMTDDEITSMLKNVAAGIQAAAE----AETAPAEAVTPAIDP 57

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            K+++   + CLE G  FK L K+HL   H +TP+EYR K+      P+ ++     R K
Sbjct: 58  AKAVKESSVVCLECGKSFKVLTKKHL-AAHGLTPEEYRAKYGYKKGAPLAAKSLQRERRK 116

Query: 130 LAKNMGLGRGRKK 142
             K+M L   R+K
Sbjct: 117 KMKDMRLWERRRK 129


>gi|116747952|ref|YP_844639.1| MucR family transcriptional regulator [Syntrophobacter fumaroxidans
           MPOB]
 gi|116697016|gb|ABK16204.1| transcriptional regulator, MucR family [Syntrophobacter
           fumaroxidans MPOB]
          Length = 183

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           + SI++  + CLE G Q + L  RHL + H +TP EY+ KW  +   P+ ++     RSK
Sbjct: 73  KSSIQDDKITCLECGTQMRQLTARHL-SAHGLTPREYKKKWGFSFKQPLSAKSLTKARSK 131

Query: 130 LAKNMGL 136
            AK  GL
Sbjct: 132 AAKKRGL 138


>gi|120601922|ref|YP_966322.1| MucR family transcriptional regulator [Desulfovibrio vulgaris DP4]
 gi|120562151|gb|ABM27895.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris DP4]
          Length = 135

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 65/131 (49%), Gaps = 3/131 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV-PIRK 72
           L+  ++IV A      +   ++ S++  + +++Q ++   P +++ + E     V    K
Sbjct: 5   LKQALEIVRAQARVRAMTADEMASMVKALAASIQGLMDGGPPEEHCEEEDEDGVVLEATK 64

Query: 73  SIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           SI    + CLE G  F+ L  RHL +H  +TPDEYR KW +     ++ +     R K  
Sbjct: 65  SIRERSVLCLECGKSFRILTTRHLASH-GLTPDEYRAKWGIKKGGSLICKALQRERRKKM 123

Query: 132 KNMGLGRGRKK 142
           K+M L   R+K
Sbjct: 124 KSMQLWERRRK 134


>gi|163747564|ref|ZP_02154913.1| GAF sensor hybrid histidine kinase [Oceanibulbus indolifex HEL-45]
 gi|161379161|gb|EDQ03581.1| GAF sensor hybrid histidine kinase [Oceanibulbus indolifex HEL-45]
          Length = 476

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%)

Query: 79  LYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           L CLE G +   L+RHL+  H M+P+ YR KW L  D+ + S  Y   R+
Sbjct: 421 LTCLECGAKLSLLRRHLRQEHGMSPEVYRAKWGLPEDFELSSGAYRAMRA 470


>gi|170739063|ref|YP_001767718.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193337|gb|ACA15284.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 168

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 1/74 (1%)

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           I  ++    +  LE+G  ++SLKRHL     +TP++YR KW L  DYPM +   +  R  
Sbjct: 69  IESTVTPEHIVSLENGKPYRSLKRHLAA-RGLTPEQYRAKWGLPPDYPMTAAAASGGRPA 127

Query: 130 LAKNMGLGRGRKKR 143
              +  +  G + R
Sbjct: 128 AGPDPAVPVGPRAR 141


>gi|332701481|ref|ZP_08421569.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332551630|gb|EGJ48674.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 140

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 54/124 (43%), Gaps = 3/124 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            ++  ++IV A  S   +   +I S++  + S+L  V   A    N   ++ +PA   +K
Sbjct: 4   MIKQVLEIVKAQASVRQMTEEEIVSMVKKLASSLGGV---AEVAGNGTTQQQEPACDTKK 60

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI  G + CLE G  FK +       H +  + Y  KW L     +  +     R K  K
Sbjct: 61  SIREGTVICLECGKSFKVITNKHLAEHGLDKESYLAKWGLPKGTALACKRLVRERRKTMK 120

Query: 133 NMGL 136
           +M L
Sbjct: 121 DMKL 124


>gi|116748961|ref|YP_845648.1| MucR family transcriptional regulator [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698025|gb|ABK17213.1| transcriptional regulator, MucR family [Syntrophobacter
           fumaroxidans MPOB]
          Length = 181

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 61/135 (45%), Gaps = 11/135 (8%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQ---------RVVSRAPCQDNVQPE 62
           + +E++ DI+   VS   +   ++   +  V  ALQ          V+  A   +    E
Sbjct: 4   KLVEISADIIQNQVSTTPMSPDELVLSLQKVFRALQDMQKSETDGTVLDLARPLEEGSEE 63

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
              P +  R+SI+   + CLE G + + L  RHL   H +TP EYR K+      P+ ++
Sbjct: 64  SGPPQLSPRESIQQDKIVCLECGAEMRQLTARHL-VSHELTPREYRKKYGFTMRTPLSAK 122

Query: 122 EYATTRSKLAKNMGL 136
                RSK AK  GL
Sbjct: 123 SLTKARSKAAKKRGL 137


>gi|163849488|ref|YP_001637531.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|163661093|gb|ABY28460.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
          Length = 145

 Score = 50.1 bits (118), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 51/107 (47%), Gaps = 7/107 (6%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV--VSRAPCQDNVQPERLK 65
           D S     +T  I+ AYV N+ +P A +  LI  VH  L  +   +  P  D+ +P   +
Sbjct: 4   DDSCGLEAVTASIIIAYVRNNRLPGAILPDLIRTVHQTLLSLGTTTAPPAPDSARPTPAE 63

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNL 112
               +RKSI    L    DG  +K+LKRHL T   +    YR ++ L
Sbjct: 64  ----VRKSITPDALISFIDGRPYKTLKRHL-TSRGLDAYSYRARFGL 105


>gi|218782445|ref|YP_002433763.1| MucR family transcriptional regulator [Desulfatibacillum
           alkenivorans AK-01]
 gi|218763829|gb|ACL06295.1| transcriptional regulator, MucR family [Desulfatibacillum
           alkenivorans AK-01]
          Length = 173

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 64/144 (44%), Gaps = 24/144 (16%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV-----------VSRAPC------ 55
             E+  +IVAA V +  +   ++G  +  V   L ++           +++ P       
Sbjct: 5   LTEIAAEIVAAQVGSTSMTSEEVGEALKSVFKTLVQLRMAEGGEEAEALTQVPAALGEEG 64

Query: 56  -QDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLA 113
             D +   R +P   IRK+     + CLE G +FK L K HLK  H+M   EYR K+   
Sbjct: 65  VSDQLAELRQRPIRSIRKNK----VICLECGAEFKQLTKGHLK-EHDMDAKEYRKKYGFK 119

Query: 114 SDYPMVSREYATTRSKLAKNMGLG 137
           +  P+ ++  +  R + AK   LG
Sbjct: 120 ARQPLSAQSLSAKRRQSAKERNLG 143


>gi|94265272|ref|ZP_01289031.1| transcriptional regulator, Ros/MucR family [delta proteobacterium
           MLMS-1]
 gi|93454253|gb|EAT04569.1| transcriptional regulator, Ros/MucR family [delta proteobacterium
           MLMS-1]
          Length = 166

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 63/137 (45%), Gaps = 20/137 (14%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSAL---QRVVSRAPCQDNV------Q 60
           S+  +EM  ++V +  +   +   ++   +   ++ L   QR  +R    D        Q
Sbjct: 2   SKTLVEMAAELVQSQCAATSMTADEVAQSLQATYNVLHNLQRDEARGVAADAGGSPFADQ 61

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMV 119
           PE         KSI+   + CLE G +FK +  +HL++H ++T  EYR KW L     + 
Sbjct: 62  PE---------KSIQKHKIVCLECGEEFKMISPKHLRSH-DLTGREYRRKWGLPLRQALC 111

Query: 120 SREYATTRSKLAKNMGL 136
           SRE +  R K  K  GL
Sbjct: 112 SRELSERRKKAGKERGL 128


>gi|94268728|ref|ZP_01291266.1| transcriptional regulator, Ros/MucR family [delta proteobacterium
           MLMS-1]
 gi|93451484|gb|EAT02315.1| transcriptional regulator, Ros/MucR family [delta proteobacterium
           MLMS-1]
          Length = 166

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 63/137 (45%), Gaps = 20/137 (14%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSAL---QRVVSRAPCQDN------VQ 60
           S+  +EM  ++V +  +   +   ++   +   ++ L   QR  +R    D        Q
Sbjct: 2   SKTLVEMAAELVQSQCAATSMTADEVAQSLQATYNVLHNLQRDEARGVAADAGGSPFAEQ 61

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMV 119
           PE         KSI+   + CLE G +FK +  +HL++H ++T  EYR KW L     + 
Sbjct: 62  PE---------KSIQKHKIVCLECGEEFKMISPKHLRSH-DLTGREYRRKWGLPLRQALC 111

Query: 120 SREYATTRSKLAKNMGL 136
           SRE +  R K  K  GL
Sbjct: 112 SRELSERRKKAGKERGL 128


>gi|239908834|ref|YP_002955576.1| hypothetical protein DMR_41990 [Desulfovibrio magneticus RS-1]
 gi|239798701|dbj|BAH77690.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 134

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 61/127 (48%), Gaps = 4/127 (3%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +L+  ++IV A  S   +   +I S++  + + +  +   A  + +   +   PA+  
Sbjct: 2   EEYLQSALEIVKAQASARPMTEDEIISMVRSIANGIAAI--NAGQESSKTEDSAAPAMDP 59

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I+   + CLE G  FK + K+HL  H  +TP+EY+ K        +  +  A  R  
Sbjct: 60  KKAIKEASITCLECGKSFKVITKKHLAVH-GLTPEEYKAKHGYKKTQALACKSLARERRA 118

Query: 130 LAKNMGL 136
             K+M L
Sbjct: 119 KMKDMKL 125


>gi|317153558|ref|YP_004121606.1| ROSMUCR transcriptional regulator [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316943809|gb|ADU62860.1| ROSMUCR transcriptional regulator [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 128

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 64/133 (48%), Gaps = 7/133 (5%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E  L+  ++IV A  S   +   +I S++  + + ++ +      +  ++P+    ++  
Sbjct: 2   EDHLKEALEIVKAQASVRTMTEEEITSMVQKLAAGIKAIAEGGGIE--IEPD---ASLDP 56

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I    + C   G  FK L K+HL + H++TP+EYR K+      P+V +     R K
Sbjct: 57  KKAIREKTIICCVCGKSFKILTKKHL-SSHDLTPEEYREKFGYKKKLPLVCKSLQRERRK 115

Query: 130 LAKNMGLGRGRKK 142
             K M L   R K
Sbjct: 116 KMKEMKLWTKRGK 128


>gi|239905785|ref|YP_002952524.1| hypothetical protein DMR_11470 [Desulfovibrio magneticus RS-1]
 gi|239795649|dbj|BAH74638.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 145

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 66/138 (47%), Gaps = 6/138 (4%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           ++ E  ++  ++IV A  S   +   +I S++  + + +  +      QD+     ++P 
Sbjct: 12  ETMEDHVKSALEIVKAQASVRSMTDEEISSMVRRLAAGILEISLGLCPQDDEDAVEMEP- 70

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKR-HLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
              +K+++   + CLE G  FK + R HL TH  +TP+EY+ K       P+V +     
Sbjct: 71  ---KKAVKEKSITCLECGKSFKVITRKHLATH-GLTPEEYKAKHGYKKTMPLVCKGLQRE 126

Query: 127 RSKLAKNMGLGRGRKKRV 144
           R K  K+M L   + K V
Sbjct: 127 RRKKMKDMRLWEKKVKTV 144


>gi|218887346|ref|YP_002436667.1| MucR family transcriptional regulator [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758300|gb|ACL09199.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 130

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 6/128 (4%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +E +L+  +DIV A  S   +   +I +++  +   ++ +       ++     + P   
Sbjct: 2   TESYLKEALDIVKAQASVRTMTEDEITTMVRRLAEGIRTLSEGGALPESGDGAAMDP--- 58

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+I+   + C E G  FK L K+HL TH   TP+ YR K       P+V +     R 
Sbjct: 59  -KKAIKEKSITCCECGKSFKILTKKHLATH-GFTPETYREKCGYKKGTPLVCKSLQRERR 116

Query: 129 KLAKNMGL 136
           K  ++M L
Sbjct: 117 KKMRDMKL 124


>gi|303248174|ref|ZP_07334438.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
 gi|302490438|gb|EFL50347.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
          Length = 132

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 62/126 (49%), Gaps = 6/126 (4%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRV-VSRAPCQDNVQPERLKPAVPIR 71
           +L + +DIV A      +   +I ++++ +  +++ + ++    ++    +    A+  +
Sbjct: 4   YLSLALDIVKAQARVRNMTEEEITAMMSKLAGSIKSIDLASGGARELASGD---TALDPK 60

Query: 72  KSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           K+++   + C+E G  +K L KRHL     +TP+EYR KW      P+V +     R K 
Sbjct: 61  KAVKERTITCMESGKPYKILTKRHL-AKFGLTPEEYRAKWGYPKGMPLVCKALQRERRKK 119

Query: 131 AKNMGL 136
            + M L
Sbjct: 120 MREMQL 125


>gi|114765234|ref|ZP_01444366.1| Predicted transcriptional regulator [Pelagibaca bermudensis
           HTCC2601]
 gi|114542369|gb|EAU45397.1| Predicted transcriptional regulator [Roseovarius sp. HTCC2601]
          Length = 91

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/44 (56%), Positives = 29/44 (65%)

Query: 77  GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           G L CLE G +   L+RHL+    MTP+EYR KW L  DYPMVS
Sbjct: 31  GTLLCLETGQRRPLLRRHLRETLGMTPEEYRKKWGLPDDYPMVS 74


>gi|283852807|ref|ZP_06370070.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
 gi|283571799|gb|EFC19796.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
          Length = 132

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 63/135 (46%), Gaps = 6/135 (4%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +L+  ++IV A  S   +   +I S+I  +   ++ +    P     Q   +      
Sbjct: 2   EDYLKSALEIVRAQASVRHMTDEEITSMIRRLAVGIRDISGEVPAGVAEQTMDMDA---- 57

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I+   + C+E G  FK + K+HL +H  +TP+EY+ K       P+V +     R K
Sbjct: 58  KKAIKEKSVTCMECGKSFKVITKKHLASH-GLTPEEYKAKHGYKKSMPLVCKSLQRDRRK 116

Query: 130 LAKNMGLGRGRKKRV 144
             K+M L   + K V
Sbjct: 117 KMKDMRLWEKKGKVV 131


>gi|46581487|ref|YP_012295.1| transcriptional regulator [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601345|ref|YP_965745.1| MucR family transcriptional regulator [Desulfovibrio vulgaris DP4]
 gi|46450909|gb|AAS97555.1| transcriptional regulator, putative [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120561574|gb|ABM27318.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris DP4]
 gi|311235136|gb|ADP87990.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris
           RCH1]
          Length = 128

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 10/127 (7%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI-- 70
            L+  + IV A  S   +   D+ +++  +   ++ + +       + PE     V I  
Sbjct: 4   LLKEALGIVKAQASVRTMTEDDMLAMVHRLAEGIRNISA------GITPEAEDEQVAIDP 57

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           RK+I+   + C+E G  FK + K+HL TH  +TP+ YR K       P+V +     R K
Sbjct: 58  RKAIKEKSITCVECGKVFKLISKKHLATH-GLTPETYREKCGYKKGTPLVCKGLQRERRK 116

Query: 130 LAKNMGL 136
             K+M L
Sbjct: 117 KMKDMKL 123


>gi|239904743|ref|YP_002951481.1| hypothetical protein DMR_01040 [Desulfovibrio magneticus RS-1]
 gi|239794606|dbj|BAH73595.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 135

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 61/133 (45%), Gaps = 8/133 (6%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR--APCQDNVQPERLKPAVPI 70
           +L+  ++IV A  S   +   +I S++  V + +  V S      +       + P    
Sbjct: 4   YLQSALEIVKAQASARPMTEDEIISMVRSVANGIAAVSSGQLVASEAESAAPAMDP---- 59

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I+   + CLE G  FK + K+HL TH  +T +EY+ K+      P+  +  A  R  
Sbjct: 60  KKAIKEASITCLECGKSFKVITKKHLATH-GLTTEEYKAKYGYKKTQPLACKSLARDRRN 118

Query: 130 LAKNMGLGRGRKK 142
             K+M L   R K
Sbjct: 119 KMKDMKLWERRTK 131


>gi|239907544|ref|YP_002954285.1| hypothetical protein DMR_29080 [Desulfovibrio magneticus RS-1]
 gi|239797410|dbj|BAH76399.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 135

 Score = 43.9 bits (102), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 65/134 (48%), Gaps = 6/134 (4%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQ-DNVQPERLKPAVP 69
           E +++  +DIV A  S    PM +   +I+ V S  + + + +  Q   +  +   PA+ 
Sbjct: 2   EEYIQSALDIVKAQASAR--PMTE-DEIISMVKSVAKGIAAVSTGQLATIDADAAAPAMD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+I+   + CLE G  FK + K+HL +H  +T +EY+ K+       +  +  A  R 
Sbjct: 59  PKKAIKEASITCLECGKSFKVITKKHLASH-GLTSEEYKAKYGYKKTQALACKSLARERR 117

Query: 129 KLAKNMGLGRGRKK 142
              K+M L   R K
Sbjct: 118 TKMKDMKLWERRTK 131


>gi|239907905|ref|YP_002954646.1| hypothetical protein DMR_32690 [Desulfovibrio magneticus RS-1]
 gi|239797771|dbj|BAH76760.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 135

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 66/134 (49%), Gaps = 6/134 (4%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQ-DNVQPERLKPAVP 69
           E +++  ++IV A  +    PM +   +I+ V S  Q + + +  Q   +  +   PA+ 
Sbjct: 2   EEYIQSALEIVKAQANAR--PMTE-DEIISMVKSVAQGIAAVSTGQIATINADAAAPAID 58

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+I+   + CLE G  FK + K+HL   H +TP+EY+ K+       +VS+     R 
Sbjct: 59  PKKAIKEASVTCLECGKSFKVITKKHL-AAHGLTPEEYKEKFGYKKTQALVSKALVRERR 117

Query: 129 KLAKNMGLGRGRKK 142
              K+M L   R K
Sbjct: 118 AKMKDMKLWERRGK 131


>gi|239908258|ref|YP_002954999.1| hypothetical protein DMR_36220 [Desulfovibrio magneticus RS-1]
 gi|239798124|dbj|BAH77113.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 135

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 62/133 (46%), Gaps = 4/133 (3%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +++  ++IV A  S   +   +I S++  V   +  V +       +  +   PA+  
Sbjct: 2   EEYIQSALEIVKAQASARPMTEEEIISMVKSVAKGIAAVSTGQIA--TIDADAAAPAMDP 59

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +K+I+   + CLE G  FK + K+HL +H  +T +EY+ K+       +  +  A  R  
Sbjct: 60  KKAIKEASITCLECGKSFKVITKKHLASH-GLTSEEYKAKYGYKKTQALACKSLARERRT 118

Query: 130 LAKNMGLGRGRKK 142
             K+M L   R K
Sbjct: 119 KMKDMKLWERRTK 131


>gi|332702440|ref|ZP_08422528.1| ROSMUCR transcriptional regulator [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332552589|gb|EGJ49633.1| ROSMUCR transcriptional regulator [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 138

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 52/118 (44%), Gaps = 4/118 (3%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           E +LE  + IV A      +   +I S++  +   ++        +       + P+ P 
Sbjct: 2   ESYLEDALGIVKAQAGVRHMTEEEIVSMVRTLAEGIKNATEGIVIEGEGDKGEI-PSDP- 59

Query: 71  RKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
            K+I    + CLE G +FK L KRHL  H  +TP EY+ K        ++++  A  R
Sbjct: 60  SKAIRERSVQCLECGKKFKVLTKRHLALH-GLTPKEYKAKHGYKKGTSLIAKGLARDR 116


>gi|169825353|ref|YP_001691246.1| hypothetical protein M446_6989 [Methylobacterium sp. 4-46]
 gi|168199275|gb|ACA21221.1| hypothetical protein M446_6989 [Methylobacterium sp. 4-46]
          Length = 318

 Score = 37.7 bits (86), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEY 106
           AV + K++    +  LEDG  +KSL+RHL T   +TP++Y
Sbjct: 28  AVQVEKTVTPDAIISLEDGKPYKSLRRHLNT-RGLTPEQY 66


>gi|332703655|ref|ZP_08423743.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332553804|gb|EGJ50848.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 133

 Score = 37.4 bits (85), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 58/130 (44%), Gaps = 5/130 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           L+  ++IVAA      +   +I ++   +  +L +++  +   D+ Q +  +P +   K 
Sbjct: 5   LKEALEIVAAQARVRHMTEDEIVAMTRSLVISLNQILGESST-DSTQDQ--EPVIDPAKH 61

Query: 74  IENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
                + CLE G  FKS+  RHLK  H +    Y  KW+L     +  +  A  R    K
Sbjct: 62  RREKSITCLECGKSFKSITSRHLKL-HGLDKKTYLAKWDLPKGTSLTCKALARERRDRMK 120

Query: 133 NMGLGRGRKK 142
            M L   R+K
Sbjct: 121 EMKLWNYREK 130


>gi|191168600|ref|ZP_03030383.1| hypothetical protein EcB7A_3290 [Escherichia coli B7A]
 gi|190901346|gb|EDV61112.1| hypothetical protein EcB7A_3290 [Escherichia coli B7A]
          Length = 182

 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%)

Query: 81  CLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           CLE G     L RH+   H +  DEYR+KWN+     +    Y   +S+  K
Sbjct: 27  CLECGKLLIFLPRHIWFVHGIRADEYRVKWNIPKHIALAGISYLEKQSEYMK 78


>gi|326445186|ref|ZP_08219920.1| hypothetical protein SclaA2_29167 [Streptomyces clavuligerus ATCC
           27064]
          Length = 249

 Score = 37.4 bits (85), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +G + CL  G +F+SL  HL   H+ T  EYR +  LA+   +++ +  T  S+
Sbjct: 82  DGLVTCLSCGRRFRSLGPHLARAHHTTAAEYRAEHRLAATTALMATDVRTALSR 135


>gi|157158496|ref|YP_001464151.1| hypothetical protein EcE24377A_3136 [Escherichia coli E24377A]
 gi|193065111|ref|ZP_03046185.1| hypothetical protein EcE22_1583 [Escherichia coli E22]
 gi|194426189|ref|ZP_03058744.1| hypothetical protein EcB171_1784 [Escherichia coli B171]
 gi|256019388|ref|ZP_05433253.1| hypothetical protein ShiD9_10771 [Shigella sp. D9]
 gi|307310574|ref|ZP_07590222.1| transcriptional regulator, MucR family [Escherichia coli W]
 gi|309793863|ref|ZP_07688288.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|332280507|ref|ZP_08392920.1| conserved hypothetical protein [Shigella sp. D9]
 gi|157080526|gb|ABV20234.1| hypothetical protein EcE24377A_3136 [Escherichia coli E24377A]
 gi|192927242|gb|EDV81862.1| hypothetical protein EcE22_1583 [Escherichia coli E22]
 gi|194415497|gb|EDX31764.1| hypothetical protein EcB171_1784 [Escherichia coli B171]
 gi|306909469|gb|EFN39964.1| transcriptional regulator, MucR family [Escherichia coli W]
 gi|308122270|gb|EFO59532.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|315062122|gb|ADT76449.1| conserved hypothetical protein [Escherichia coli W]
 gi|323159989|gb|EFZ45954.1| transcriptional regulatory protein [Escherichia coli E128010]
 gi|323377298|gb|ADX49566.1| hypothetical protein EKO11_0925 [Escherichia coli KO11]
 gi|332102859|gb|EGJ06205.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 182

 Score = 37.4 bits (85), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%)

Query: 81  CLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           CLE G     L RH+   H +  DEYR+KWN+     +    Y   +S+  K
Sbjct: 27  CLECGKLLIFLPRHIWFVHGIRADEYRVKWNIPKHIALAGISYLEKQSEYMK 78


>gi|85084471|ref|XP_957313.1| hypothetical protein NCU06422 [Neurospora crassa OR74A]
 gi|28918403|gb|EAA28077.1| predicted protein [Neurospora crassa OR74A]
          Length = 562

 Score = 37.4 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 4/60 (6%)

Query: 51  SRAPCQDNVQPERLKPAVP----IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEY 106
           +R    D  +PE +KP       ++K ++  C+ C E    F  L RHL T  +  P EY
Sbjct: 479 AREESSDATEPELVKPDAERIKRVKKELKTICMVCGEKFQHFGQLFRHLNTERHRMPKEY 538


>gi|300923201|ref|ZP_07139256.1| hypothetical protein HMPREF9548_01408 [Escherichia coli MS 182-1]
 gi|301326144|ref|ZP_07219530.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|300420510|gb|EFK03821.1| hypothetical protein HMPREF9548_01408 [Escherichia coli MS 182-1]
 gi|300847109|gb|EFK74869.1| conserved hypothetical protein [Escherichia coli MS 78-1]
          Length = 182

 Score = 37.4 bits (85), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%)

Query: 81  CLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           CLE G     L RH+   H +  DEYR+KWN+     +    Y   +S+  K
Sbjct: 27  CLECGKLLIFLPRHIWFVHGIRADEYRVKWNIPKHIALAGISYLEKQSEYMK 78


>gi|240142394|ref|YP_002966904.1| hypothetical protein MexAM1_META2p0719 [Methylobacterium extorquens
           AM1]
 gi|240012338|gb|ACS43563.1| Hypothetical protein MexAM1_META2p0719 [Methylobacterium extorquens
           AM1]
          Length = 242

 Score = 37.0 bits (84), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 34/68 (50%)

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVP  +S+    +  L  G    +L R +       P+ YR ++ L  +YP+++    
Sbjct: 148 EPAVPPSRSLTPDAVIDLAGGKPHGNLGRFIADARGEDPETYRRRFGLPKEYPLMAPRLI 207

Query: 125 TTRSKLAK 132
            TR ++++
Sbjct: 208 RTRGRVSE 215


>gi|212530504|ref|XP_002145409.1| Ulp1 protease family protein [Penicillium marneffei ATCC 18224]
 gi|210074807|gb|EEA28894.1| Ulp1 protease family protein [Penicillium marneffei ATCC 18224]
          Length = 1029

 Score = 36.6 bits (83), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 25/47 (53%)

Query: 91  LKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLG 137
           L+R      N TPD  +  WN A+D+ +V+RE    R++ A    LG
Sbjct: 132 LRRSRSQQTNYTPDPLKKTWNFANDFRVVNREARLERARAALEASLG 178


>gi|27383526|ref|NP_775059.1| putative transcriptional regulator [Citrobacter freundii]
 gi|216967805|ref|YP_002333313.1| hypothetical protein pCTXM360_p31 [Klebsiella pneumoniae]
 gi|27261379|gb|AAN87720.1| putative transcriptional regulator [Citrobacter freundii]
 gi|215397977|gb|ACJ65254.1| hypothetical protein [Klebsiella pneumoniae]
 gi|323700902|gb|ADY00055.1| hypothetical protein [Escherichia coli]
          Length = 169

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 20/42 (47%)

Query: 79  LYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           + CLE G  F  L  HL   H M   EYR +W +    P+ S
Sbjct: 11  IQCLECGKYFSFLAPHLNKTHQMNAREYRERWAIPLHTPLAS 52


>gi|297276595|ref|XP_002801191.1| PREDICTED: zinc finger protein 14-like [Macaca mulatta]
          Length = 642

 Score = 35.4 bits (80), Expect = 2.4,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 5/47 (10%)

Query: 66  PAVPIRKSIENG-----CLYCLEDGMQFKSLKRHLKTHHNMTPDEYR 107
           P V I K    G     C +C +D M   SL RH+++H    P+EY+
Sbjct: 88  PNVNINKETSTGAKPHECSFCGKDFMHHSSLNRHMRSHIGQKPNEYQ 134


>gi|75075664|sp|Q4R4C7|ZNF14_MACFA RecName: Full=Zinc finger protein 14
 gi|67971392|dbj|BAE02038.1| unnamed protein product [Macaca fascicularis]
          Length = 642

 Score = 35.4 bits (80), Expect = 2.5,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 5/47 (10%)

Query: 66  PAVPIRKSIENG-----CLYCLEDGMQFKSLKRHLKTHHNMTPDEYR 107
           P V I K    G     C +C +D M   SL RH+++H    P+EY+
Sbjct: 88  PNVNINKETSTGAKPHECSFCGKDFMHHSSLNRHMRSHIGQKPNEYQ 134


>gi|313677904|gb|ADR74165.1| hypothetical protein [uncultured bacterium 52B7]
          Length = 147

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 26/52 (50%)

Query: 83  EDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
           +DG   + + +H + + N T +EY  KWN  S Y  +S +Y    +    N+
Sbjct: 70  KDGTGVEIIGKHQQANGNSTREEYHFKWNWGSSYKTISVQYDEGNAVFMDNV 121


>gi|332087364|gb|EGI92492.1| transcriptional regulatory protein [Shigella boydii 5216-82]
          Length = 182

 Score = 35.0 bits (79), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 81  CLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           CLE G     L RH+   H +  DEYR KWN+     +    Y   +S+  K
Sbjct: 27  CLECGKLLIFLPRHIWFVHGIRADEYREKWNIPKHIALAGISYLEKQSEYMK 78


>gi|156384831|ref|XP_001633336.1| predicted protein [Nematostella vectensis]
 gi|156220404|gb|EDO41273.1| predicted protein [Nematostella vectensis]
          Length = 2070

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%)

Query: 39   ITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTH 98
            + DV   L R   RA   D +Q   L P   +  S++ G     +DG + KSLK +L T 
Sbjct: 1911 VLDVRGGLLRSQRRAHTSDVLQVRALSPNSLVTSSVDQGLSMWKDDGQRLKSLKGNLPTL 1970

Query: 99   H 99
            H
Sbjct: 1971 H 1971


>gi|170725434|ref|YP_001759460.1| AraC family transcriptional regulator [Shewanella woodyi ATCC
           51908]
 gi|169810781|gb|ACA85365.1| transcriptional regulator, AraC family [Shewanella woodyi ATCC
           51908]
          Length = 316

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 81  CLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGR 140
           C E GM   SL+R  K   +++P  Y   W LA  Y +V +  + T   +A  +G    R
Sbjct: 234 CNEAGMSRASLQRKFKAELDLSPMAYLGSWRLAKAYQLV-KNSSLTLDNIADRIGYADAR 292

Query: 141 KKR 143
             R
Sbjct: 293 TLR 295


>gi|91091546|ref|XP_970948.1| PREDICTED: similar to zinc finger protein 91 [Tribolium castaneum]
 gi|270000921|gb|EEZ97368.1| hypothetical protein TcasGA2_TC011190 [Tribolium castaneum]
          Length = 834

 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 42  VHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTH 98
           VH+  Q V S A  +  V P+++KP +P  KS +N C  C +     ++L  H+KTH
Sbjct: 642 VHAKEQLVKSTAVVR--VSPKKMKPVLPKSKSPQNKCKTCGKICSSEQNLNVHMKTH 696


>gi|320182274|gb|EFW57177.1| hypothetical protein SGB_00646 [Shigella boydii ATCC 9905]
          Length = 182

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%)

Query: 81  CLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           CLE G     L RH+   H +  DEYR KWN+     +    Y   +S+  K
Sbjct: 27  CLECGKLLIFLPRHIWFVHGIRADEYREKWNIPKHIALAGISYLEKQSEYMK 78


>gi|329938103|ref|ZP_08287554.1| 4-carboxymuconolactone decarboxylase domain-containing protein
          [Streptomyces griseoaurantiacus M045]
 gi|329302592|gb|EGG46482.1| 4-carboxymuconolactone decarboxylase domain-containing protein
          [Streptomyces griseoaurantiacus M045]
          Length = 166

 Score = 34.7 bits (78), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 4/67 (5%)

Query: 17 TVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIEN 76
          T + V AY   H  P  D+ +L  +V+ A+ R+   A     V+P +L+  V IR S  N
Sbjct: 3  TNETVTAYAPEHT-PRLDMATLAPEVYKAMIRL--DAAAGQGVEP-KLRELVKIRASQLN 58

Query: 77 GCLYCLE 83
           C +CL+
Sbjct: 59 HCAFCLD 65


>gi|163849545|ref|YP_001637588.1| transcriptional regulator protein-like protein [Methylobacterium
          extorquens PA1]
 gi|163661150|gb|ABY28517.1| transcriptional regulator protein-like protein [Methylobacterium
          extorquens PA1]
          Length = 80

 Score = 34.7 bits (78), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 36/70 (51%), Gaps = 2/70 (2%)

Query: 5  ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
          A     +R + +T +IV AYV+ + V  A++  L+  VH+ L R+ S     +  +  R 
Sbjct: 9  ADIVEQDRLVTLTTEIVTAYVTRNHVQAAELPGLLRSVHAGLLRLSS--GSGEPTEERRT 66

Query: 65 KPAVPIRKSI 74
            A  IR+SI
Sbjct: 67 LTAAEIRRSI 76


>gi|332854330|ref|XP_003316272.1| PREDICTED: zinc finger protein 14 [Pan troglodytes]
          Length = 642

 Score = 34.7 bits (78), Expect = 4.7,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 66  PAVPIRKSIENG-----CLYCLEDGMQFKSLKRHLKTHHNMTPDEYR 107
           P V I K    G     C +C  D M   SL RH+++H    P+EY+
Sbjct: 88  PNVNINKETFTGAKPHECSFCGRDFMHHSSLNRHMRSHTGQKPNEYQ 134


>gi|197097542|ref|NP_001125950.1| zinc finger protein 14 [Pongo abelii]
 gi|75070676|sp|Q5R9F0|ZNF14_PONAB RecName: Full=Zinc finger protein 14
 gi|55729764|emb|CAH91610.1| hypothetical protein [Pongo abelii]
          Length = 642

 Score = 34.7 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 5/47 (10%)

Query: 66  PAVPIRKSIENG-----CLYCLEDGMQFKSLKRHLKTHHNMTPDEYR 107
           P V I K    G     C +C  D M   SL RH+++H    P+EY+
Sbjct: 88  PNVNINKETFTGAKPHECSFCGRDFMHHSSLNRHMRSHTGQKPNEYQ 134


>gi|195035291|ref|XP_001989111.1| GH10225 [Drosophila grimshawi]
 gi|193905111|gb|EDW03978.1| GH10225 [Drosophila grimshawi]
          Length = 121

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 5/44 (11%)

Query: 75  ENGCLYCLEDG----MQFKS-LKRHLKTHHNMTPDEYRIKWNLA 113
           EN    C EDG      FK+ LKRH+ TH  + PDE  I W  +
Sbjct: 3   ENKSFRCSEDGCGKAFWFKAALKRHMNTHKEVDPDEPTISWGCS 46


>gi|239907856|ref|YP_002954597.1| hypothetical protein DMR_32200 [Desulfovibrio magneticus RS-1]
 gi|239797722|dbj|BAH76711.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 178

 Score = 34.3 bits (77), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 9/114 (7%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +E T D+   Y+++      DI +    V S+    VS     DNV P +LK  V    +
Sbjct: 20  VEQTTDLAGKYLTSLAKMRVDIAN--GQVASSPVSGVS-----DNVAPMKLK--VNPHNA 70

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           I+   + C   G +FK+L +     H +T D Y      A + P++ R+    R
Sbjct: 71  IQADKIVCCICGGEFKTLTKGHLAEHGLTRDTYLDLCGYAKNTPLMCRDQIAAR 124


>gi|221123490|ref|XP_002163048.1| PREDICTED: similar to predicted protein, partial [Hydra
           magnipapillata]
          Length = 238

 Score = 33.9 bits (76), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 12/74 (16%)

Query: 39  ITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLK------ 92
           I  +++  Q +  RA    N + E+        K++E  C+ C+EDG+  K L       
Sbjct: 154 IASIYAWTQGLSHRAKLDGNQELEKFS------KALEKACVDCVEDGLMTKDLAGCIYGI 207

Query: 93  RHLKTHHNMTPDEY 106
           +++K  H +  DEY
Sbjct: 208 KNVKREHYLLTDEY 221


>gi|239908287|ref|YP_002955028.1| hypothetical protein DMR_36510 [Desulfovibrio magneticus RS-1]
 gi|239798153|dbj|BAH77142.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 185

 Score = 33.5 bits (75), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 11/81 (13%)

Query: 78  CLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK------- 129
           C+ C   G +FK+L K+HL TH  +T +EY  K++++     V     TT  +       
Sbjct: 69  CVKCALCGAEFKTLTKKHLATH-GLTREEYMKKFDVSKKDMSVKVARKTTSGEDNPLKQM 127

Query: 130 --LAKNMGLGRGRKKRVLTSK 148
             + K+ G+ RG  K+ +  K
Sbjct: 128 QMIMKDFGIARGEVKKFVMDK 148


Searching..................................................done


Results from round 2




>gi|254780783|ref|YP_003065196.1| transcription regulator protein [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040460|gb|ACT57256.1| transcription regulator protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 149

 Score =  235 bits (600), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 149/149 (100%), Positives = 149/149 (100%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ
Sbjct: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS
Sbjct: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSKV 149
           REYATTRSKLAKNMGLGRGRKKRVLTSKV
Sbjct: 121 REYATTRSKLAKNMGLGRGRKKRVLTSKV 149


>gi|16125201|ref|NP_419765.1| transcriptional regulator [Caulobacter crescentus CB15]
 gi|13422225|gb|AAK22933.1| transcriptional regulator [Caulobacter crescentus CB15]
          Length = 181

 Score =  219 bits (559), Expect = 8e-56,   Method: Composition-based stats.
 Identities = 70/142 (49%), Positives = 91/142 (64%), Gaps = 3/142 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            +     +EMT  IV+AYV N+VV  AD+ +LI  VH+AL  V +         P   +P
Sbjct: 43  MEDQSDLIEMTAGIVSAYVGNNVVSTADLPALIKQVHAALANVGAP---DAEAAPTPKEP 99

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AVP++KSI    L CLEDG +FKSLKRHL+T ++MTP++YR KW L  DYPMV+  YA  
Sbjct: 100 AVPVKKSITPDYLICLEDGRKFKSLKRHLRTKYDMTPEDYRAKWGLPKDYPMVAPNYAEA 159

Query: 127 RSKLAKNMGLGRGRKKRVLTSK 148
           RS LAK MGLG+G +K    +K
Sbjct: 160 RSNLAKQMGLGQGGRKPARKAK 181


>gi|170750309|ref|YP_001756569.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656831|gb|ACB25886.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 137

 Score =  217 bits (554), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 67/139 (48%), Positives = 94/139 (67%), Gaps = 4/139 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           DA+ +    +L ++VDIV+A+VSN+ VP  ++  LI  +H+ L  +            E 
Sbjct: 2   DATGEGQPDYLTLSVDIVSAFVSNNPVPAPELPGLIAAIHATLHGLGEP----SAPPAEE 57

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           L+PAVP+R+S++   + CLEDG +FKSLKRHL+TH+N+TP+EYR KW L  DYPMV+  Y
Sbjct: 58  LRPAVPVRRSVQPDFIVCLEDGKKFKSLKRHLRTHYNLTPEEYRGKWGLPPDYPMVAPNY 117

Query: 124 ATTRSKLAKNMGLGRGRKK 142
           A  RS LAK+MGLG  R+K
Sbjct: 118 AAARSSLAKSMGLGHQRRK 136


>gi|227821334|ref|YP_002825304.1| transcriptional regulatory protein, Ros/MucR family [Sinorhizobium
           fredii NGR234]
 gi|227340333|gb|ACP24551.1| transcriptional regulatory protein, Ros/MucR family [Sinorhizobium
           fredii NGR234]
          Length = 143

 Score =  217 bits (553), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 79/145 (54%), Positives = 105/145 (72%), Gaps = 2/145 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++    S+E  +E+T +IVAAYVSNHVVP+A++ +LI DVHSAL    + AP    V 
Sbjct: 1   MSENTLGASNELLVELTAEIVAAYVSNHVVPVAELPTLIADVHSALNN--TTAPAPVVVP 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THHN++P+EYR KW+L +DYPMV+
Sbjct: 59  VEKPKPAVSVRKSVQDDQITCLECGGTFKSLKRHLMTHHNLSPEEYREKWDLPADYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA  RS+LAK MGLG+ RK+R  
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKRRGK 143


>gi|315122005|ref|YP_004062494.1| transcription regulator protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495407|gb|ADR52006.1| transcription regulator protein [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 143

 Score =  217 bits (553), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 117/143 (81%), Positives = 128/143 (89%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MDDDA+FD SE+ LEMTV+IVAAYV NHVVPM DIGSL+ DVH+ L+ ++S  P QDN+ 
Sbjct: 1   MDDDATFDGSEKILEMTVNIVAAYVGNHVVPMGDIGSLVADVHTVLRNLISHNPGQDNLP 60

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            ERLKPAVPIRKSIENG LYCLEDGM+FKSLKRHL THHNMTP+EYRIKWNLASDYPMVS
Sbjct: 61  TERLKPAVPIRKSIENGLLYCLEDGMKFKSLKRHLMTHHNMTPEEYRIKWNLASDYPMVS 120

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
           REYA TRSKLAKNMGLGRGRKKR
Sbjct: 121 REYANTRSKLAKNMGLGRGRKKR 143


>gi|325292293|ref|YP_004278157.1| Transcriptional regulatory protein [Agrobacterium sp. H13-3]
 gi|1710641|sp|Q04152|ROS_AGRTU RecName: Full=Transcriptional regulatory protein ros
 gi|142275|gb|AAA22106.1| ros protein [Agrobacterium tumefaciens]
 gi|325060146|gb|ADY63837.1| Transcriptional regulatory protein [Agrobacterium sp. H13-3]
          Length = 142

 Score =  217 bits (553), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 77/141 (54%), Positives = 101/141 (71%), Gaps = 2/141 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + A  ++ +  +E+T DIVAAYVSNHVVP+ ++  LI+DVH+AL    + AP    V 
Sbjct: 1   MTETAYGNAQDLLVELTADIVAAYVSNHVVPVTELPGLISDVHTALSG--TSAPASVAVN 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+MTP+EYR KW+L  DYPMV+
Sbjct: 59  VEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRK 141
             YA  RS+LAK MGLG+ RK
Sbjct: 119 PAYAEARSRLAKEMGLGQRRK 139


>gi|15964752|ref|NP_385105.1| transcription regulator protein [Sinorhizobium meliloti 1021]
 gi|307304328|ref|ZP_07584080.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
 gi|307319433|ref|ZP_07598860.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           AK83]
 gi|1709180|sp|P55323|MUCR_RHIME RecName: Full=Transcriptional regulatory protein mucR
 gi|642657|gb|AAA74239.1| putative zinc finger protein [Sinorhizobium meliloti]
 gi|15073930|emb|CAC45571.1| Transcriptional regulator of exopolysaccharide biosynthesis
           [Sinorhizobium meliloti 1021]
 gi|306894805|gb|EFN25564.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           AK83]
 gi|306902796|gb|EFN33389.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
          Length = 143

 Score =  216 bits (551), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 79/145 (54%), Positives = 105/145 (72%), Gaps = 2/145 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + +   S+E  +E+T +IVAAYVSNHVVP+A++ +LI DVHSAL    + AP    V 
Sbjct: 1   MTETSLGTSNELLVELTAEIVAAYVSNHVVPVAELPTLIADVHSALNN--TTAPAPVVVP 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THHN++P+EYR KW+L +DYPMV+
Sbjct: 59  VEKPKPAVSVRKSVQDDQITCLECGGTFKSLKRHLMTHHNLSPEEYRDKWDLPADYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA  RS+LAK MGLG+ RK+R  
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKRRGK 143


>gi|15888254|ref|NP_353935.1| transcriptional regulator [Agrobacterium tumefaciens str. C58]
 gi|15155910|gb|AAK86720.1| transcriptional regulator [Agrobacterium tumefaciens str. C58]
          Length = 142

 Score =  216 bits (551), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 77/141 (54%), Positives = 101/141 (71%), Gaps = 2/141 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + A  ++ +  +E+T DIVAAYVSNHVVP+ ++  LI+DVH+AL    + AP    V 
Sbjct: 1   MTETAYGNAQDLLVELTADIVAAYVSNHVVPVTELPGLISDVHTALSG--TSAPASVAVN 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+MTP+EYR KW+L  DYPMV+
Sbjct: 59  VEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRK 141
             YA  RS+LAK MGLG+ RK
Sbjct: 119 PAYAEARSRLAKEMGLGQRRK 139


>gi|296447404|ref|ZP_06889330.1| transcriptional regulator, MucR family [Methylosinus trichosporium
           OB3b]
 gi|296255107|gb|EFH02208.1| transcriptional regulator, MucR family [Methylosinus trichosporium
           OB3b]
          Length = 135

 Score =  216 bits (550), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 70/137 (51%), Positives = 94/137 (68%), Gaps = 3/137 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           +S   +E+  DIV+AYVSN+ VP AD+  LI +V+ AL RV +    +     E  KPAV
Sbjct: 2   TSTNNIELAADIVSAYVSNNSVPAADLPGLINEVYGALMRVGTGVVPEPA---EAPKPAV 58

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +RKS+ N  + CLEDG +FKSLKRHL+T + ++P+EYR KW LA+DYPMV+  YA  RS
Sbjct: 59  SVRKSVTNDFIVCLEDGKKFKSLKRHLRTQYGLSPEEYREKWGLAADYPMVAPNYAKARS 118

Query: 129 KLAKNMGLGRGRKKRVL 145
            LAK MGLG+ R++R  
Sbjct: 119 NLAKQMGLGQQRRRRAR 135


>gi|154245782|ref|YP_001416740.1| MucR family transcriptional regulator [Xanthobacter autotrophicus
           Py2]
 gi|154159867|gb|ABS67083.1| transcriptional regulator, MucR family [Xanthobacter autotrophicus
           Py2]
          Length = 155

 Score =  216 bits (550), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 69/142 (48%), Positives = 93/142 (65%), Gaps = 4/142 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D  S  +S  +++   +IVAAYVSN+ V   ++ +LI  V+ AL ++ + A       
Sbjct: 1   MSDSDSNSTSPSYIDFATEIVAAYVSNNSVSATELPALIESVYRALGQLGTPAAPV---- 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E  KPAVP++KS+    + CLEDG +FKSLKRHL+T + MTP+ YR KW L  DYPMV+
Sbjct: 57  VEEQKPAVPVKKSVTPEYIVCLEDGKKFKSLKRHLRTSYGMTPEVYREKWGLPKDYPMVA 116

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAKNMGLG+ RKK
Sbjct: 117 PAYAAARSELAKNMGLGQTRKK 138


>gi|150395838|ref|YP_001326305.1| MucR family transcriptional regulator [Sinorhizobium medicae
           WSM419]
 gi|6465846|emb|CAB61530.1| MucR protein [Sinorhizobium meliloti]
 gi|150027353|gb|ABR59470.1| transcriptional regulator, MucR family [Sinorhizobium medicae
           WSM419]
          Length = 143

 Score =  215 bits (549), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 78/145 (53%), Positives = 105/145 (72%), Gaps = 2/145 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + +   S+E  +E+T +IVAAYVSNHVVP+A++ +LI DVHSAL    + AP    V 
Sbjct: 1   MTETSLGTSNELLVELTAEIVAAYVSNHVVPVAELPTLIADVHSALNN--TTAPAPVVVP 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THHN++P++YR KW+L +DYPMV+
Sbjct: 59  VEKPKPAVSVRKSVQDDQITCLECGGTFKSLKRHLMTHHNLSPEDYRDKWDLPADYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA  RS+LAK MGLG+ RK+R  
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKRRGK 143


>gi|254501217|ref|ZP_05113368.1| ROS/MUCR transcriptional regulator protein [Labrenzia alexandrii
           DFL-11]
 gi|222437288|gb|EEE43967.1| ROS/MUCR transcriptional regulator protein [Labrenzia alexandrii
           DFL-11]
          Length = 138

 Score =  215 bits (548), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 73/142 (51%), Positives = 99/142 (69%), Gaps = 6/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D+         +++T DIV+AYVSN+ V   ++  LI +V+ ALQ+    A   +  +
Sbjct: 1   MTDNLVE---ANLIDLTADIVSAYVSNNTVASTELPGLINEVYGALQKT---AAASNEPE 54

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE LKPAVP++KS+    + CLEDG +FKSLKRHL+TH+NMTP+EYR KW+LA DYPMV+
Sbjct: 55  PEPLKPAVPVKKSVMPDFIICLEDGKKFKSLKRHLRTHYNMTPEEYREKWDLAPDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 115 PNYAAARSELAKKMGLGQQRKR 136


>gi|114707178|ref|ZP_01440076.1| transcriptional regulator [Fulvimarina pelagi HTCC2506]
 gi|114537374|gb|EAU40500.1| transcriptional regulator [Fulvimarina pelagi HTCC2506]
          Length = 142

 Score =  215 bits (547), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 72/143 (50%), Positives = 105/143 (73%), Gaps = 4/143 (2%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           MD  +   D++E  +E+T ++VAAYVSN+ +P++++ SLI+DV+ AL R  + A      
Sbjct: 1   MDQIEPLVDNNEMLMELTAEVVAAYVSNNSLPVSELPSLISDVYGALGRTTAPA---QEP 57

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           Q E+ +PAVPI+KS+ +  + CLEDG +FKSLKRHL TH+N++P+EYR KW+L +DYPMV
Sbjct: 58  QAEKPRPAVPIKKSVTDDYIICLEDGKKFKSLKRHLMTHYNLSPEEYRDKWDLPADYPMV 117

Query: 120 SREYATTRSKLAKNMGLGRGRKK 142
           +  YA  RS+LAK MGLG  R++
Sbjct: 118 APNYAAARSRLAKQMGLGHKRRR 140


>gi|154246781|ref|YP_001417739.1| MucR family transcriptional regulator [Xanthobacter autotrophicus
           Py2]
 gi|154160866|gb|ABS68082.1| transcriptional regulator, MucR family [Xanthobacter autotrophicus
           Py2]
          Length = 139

 Score =  214 bits (546), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 65/141 (46%), Positives = 95/141 (67%), Gaps = 3/141 (2%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           +    +  ++E+  DIV+AYVSN+ V + D+ SLI +V+  LQR+ S    ++    E  
Sbjct: 2   SETTDTTTYIELATDIVSAYVSNNTVALTDLPSLIHEVYGTLQRLSSG---EEEPVSEPA 58

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           KPAV ++KS+    + CLEDG +FKSLKRHL+T ++MTP++YR KW L +DYPMV+  YA
Sbjct: 59  KPAVAVKKSVHPDFIICLEDGKKFKSLKRHLRTRYDMTPEQYREKWGLPADYPMVAPNYA 118

Query: 125 TTRSKLAKNMGLGRGRKKRVL 145
             RS+LAK MGLG+ R++   
Sbjct: 119 AARSELAKQMGLGQQRRRGAA 139


>gi|90418906|ref|ZP_01226817.1| transcriptional regulator protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336986|gb|EAS50691.1| transcriptional regulator protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 142

 Score =  214 bits (546), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 71/145 (48%), Positives = 105/145 (72%), Gaps = 3/145 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MD   + +++E  +E+T ++VAAYVSN+ +P++++ +LI+D++ AL R  S       VQ
Sbjct: 1   MDQIENVENNEMLMELTAEVVAAYVSNNSLPVSELPALISDIYGALGRTNS---APQAVQ 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAVP++KS+ +  + CLEDG +FKSLKRHL TH+N++P+EYR KW+LA DYPMV+
Sbjct: 58  AEKPKPAVPVKKSVTDDYIICLEDGKKFKSLKRHLMTHYNLSPEEYREKWDLAPDYPMVA 117

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA  RS+LAK MGLG  R++   
Sbjct: 118 PNYAAARSRLAKQMGLGHKRRRAAR 142


>gi|118593473|ref|ZP_01550853.1| transcriptional regulator, MucR family protein [Stappia aggregata
           IAM 12614]
 gi|118433952|gb|EAV40610.1| transcriptional regulator, MucR family protein [Stappia aggregata
           IAM 12614]
          Length = 138

 Score =  214 bits (545), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 74/143 (51%), Positives = 97/143 (67%), Gaps = 6/143 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D          +++T DIV+AYVSN+ V   D+  LI +V+ ALQR    A      +
Sbjct: 1   MTD---SPVDANLIDLTADIVSAYVSNNTVASTDLPGLINEVYGALQRT---ASTSTEPE 54

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE LKPAVP++KS+    + CLEDG +FKSLKRHL+TH+NMTP+EYR KW+L +DYPMV+
Sbjct: 55  PEPLKPAVPVKKSVMPDYIICLEDGKKFKSLKRHLRTHYNMTPEEYREKWDLGADYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
             YA  RS+LAK MGLG+ RK+ 
Sbjct: 115 PNYAAARSELAKKMGLGQQRKRS 137


>gi|221233935|ref|YP_002516371.1| transcriptional regulator [Caulobacter crescentus NA1000]
 gi|220963107|gb|ACL94463.1| transcriptional regulator [Caulobacter crescentus NA1000]
          Length = 139

 Score =  214 bits (545), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 70/142 (49%), Positives = 91/142 (64%), Gaps = 3/142 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            +     +EMT  IV+AYV N+VV  AD+ +LI  VH+AL  V +         P   +P
Sbjct: 1   MEDQSDLIEMTAGIVSAYVGNNVVSTADLPALIKQVHAALANVGAP---DAEAAPTPKEP 57

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AVP++KSI    L CLEDG +FKSLKRHL+T ++MTP++YR KW L  DYPMV+  YA  
Sbjct: 58  AVPVKKSITPDYLICLEDGRKFKSLKRHLRTKYDMTPEDYRAKWGLPKDYPMVAPNYAEA 117

Query: 127 RSKLAKNMGLGRGRKKRVLTSK 148
           RS LAK MGLG+G +K    +K
Sbjct: 118 RSNLAKQMGLGQGGRKPARKAK 139


>gi|254471857|ref|ZP_05085258.1| transcriptional regulator, MucR family [Pseudovibrio sp. JE062]
 gi|211959059|gb|EEA94258.1| transcriptional regulator, MucR family [Pseudovibrio sp. JE062]
          Length = 138

 Score =  214 bits (545), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 73/138 (52%), Positives = 96/138 (69%), Gaps = 3/138 (2%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           +   +    +E+T DIV+AYV N+ V  AD+  LI DV+ ALQ+           +PE L
Sbjct: 2   SEIPADNNLMELTADIVSAYVGNNTVASADLPVLINDVYVALQKTSGD---LSEPEPEPL 58

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           KPAVP++KS+ N  + CLEDG +FKSLKRHL+TH++MTP+EYR KW L SDYPMV+  YA
Sbjct: 59  KPAVPVKKSVTNDYIICLEDGKKFKSLKRHLRTHYDMTPEEYREKWGLPSDYPMVAPHYA 118

Query: 125 TTRSKLAKNMGLGRGRKK 142
             RS+LAK MGLG+ RK+
Sbjct: 119 AARSELAKKMGLGQQRKR 136


>gi|163759047|ref|ZP_02166133.1| transcriptional regulator [Hoeflea phototrophica DFL-43]
 gi|162283451|gb|EDQ33736.1| transcriptional regulator [Hoeflea phototrophica DFL-43]
          Length = 140

 Score =  214 bits (545), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 73/142 (51%), Positives = 98/142 (69%), Gaps = 4/142 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +    + S+  +E+T +IVAAYVSN+ V   D+ ++I+ VHSAL      A       
Sbjct: 1   MTEVTKDNGSDFLIELTAEIVAAYVSNNSVAANDLPNVISQVHSAL----GGATAPVEEV 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAVP+R+SI+N  L CLEDG +FKSLKRHL TH+ +TP++YR KW+LA DYPMV+
Sbjct: 57  VEKPKPAVPVRRSIQNDYLICLEDGQKFKSLKRHLMTHYGLTPEQYREKWDLAPDYPMVA 116

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 117 PSYAEARSRLAKEMGLGQKRKR 138


>gi|1710640|sp|P55324|ROSA_AGRRD RecName: Full=Transcriptional regulatory protein rosAr
 gi|599613|emb|CAA58116.1| rosAR [Agrobacterium tumefaciens]
          Length = 142

 Score =  214 bits (545), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 77/141 (54%), Positives = 101/141 (71%), Gaps = 2/141 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + A  ++ +  +E+T DIVAAYVSNHVVP+ ++  LI+DVH+AL    + AP    V 
Sbjct: 1   MTETAYGNAQDLLVELTADIVAAYVSNHVVPVTELPGLISDVHTALSG--TSAPASVAVN 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+MTP+EYR KW+L  DYPMV+
Sbjct: 59  VEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLQVDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRK 141
             YA  RS+LAK MGLG+ RK
Sbjct: 119 PAYAEARSRLAKEMGLGQRRK 139


>gi|298293345|ref|YP_003695284.1| MucR family transcriptional regulator [Starkeya novella DSM 506]
 gi|296929856|gb|ADH90665.1| transcriptional regulator, MucR family [Starkeya novella DSM 506]
          Length = 154

 Score =  213 bits (543), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 75/140 (53%), Positives = 96/140 (68%), Gaps = 5/140 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D  S  SS  +L +T D+VAA+V N+ VP  ++  LI  VH AL R+ + AP    V 
Sbjct: 1   MSDQDS--SSVDYLGLTADVVAAFVGNNSVPATELPDLIAKVHGALLRLSTPAPA---VV 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E LKPAVP++KS+    + CLEDG++FKSLKRHL+T +NMTP+EYR KW L +DYPMV+
Sbjct: 56  EEVLKPAVPVKKSVTPEYIICLEDGLKFKSLKRHLRTKYNMTPEEYRAKWGLPNDYPMVA 115

Query: 121 REYATTRSKLAKNMGLGRGR 140
             YA  RS LAK MGLG+ R
Sbjct: 116 PSYAEARSNLAKKMGLGQQR 135


>gi|197106177|ref|YP_002131554.1| transcriptional regulator [Phenylobacterium zucineum HLK1]
 gi|196479597|gb|ACG79125.1| transcriptional regulator [Phenylobacterium zucineum HLK1]
          Length = 171

 Score =  213 bits (542), Expect = 9e-54,   Method: Composition-based stats.
 Identities = 73/145 (50%), Positives = 92/145 (63%), Gaps = 3/145 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           +   D     +EMT DIV+AYV N+ V  AD+  LI  VH AL  V S A     V+ + 
Sbjct: 30  NGRMDEKTEVIEMTADIVSAYVGNNTVAAADLPGLIQSVHRALAGVSSGAEA---VEAQP 86

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            +PAVPIR+SI    L CLEDG +FKSLKRHL+T +NM+P+EYR KW L  DYPMV+  Y
Sbjct: 87  KEPAVPIRRSITPDYLVCLEDGRKFKSLKRHLRTKYNMSPEEYRAKWGLPKDYPMVAPNY 146

Query: 124 ATTRSKLAKNMGLGRGRKKRVLTSK 148
           A  RS LAK MGLG+G ++     +
Sbjct: 147 AKARSDLAKQMGLGQGGRQAPRKKR 171


>gi|217977836|ref|YP_002361983.1| transcriptional regulator, MucR family [Methylocella silvestris
           BL2]
 gi|217503212|gb|ACK50621.1| transcriptional regulator, MucR family [Methylocella silvestris
           BL2]
          Length = 137

 Score =  212 bits (540), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 79/142 (55%), Positives = 96/142 (67%), Gaps = 6/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D      S  ++E+  DIV+AYVSN+ VP +D+ SLI DVHSAL RV S         
Sbjct: 1   MSD---ASGSNSYIELAADIVSAYVSNNSVPASDLPSLINDVHSALLRVTSGVVAPIVET 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P   KPAVP +KS+ N  L CLEDG +FKSLKRHL+T +NM+PDEYR KW LA DYPMV+
Sbjct: 58  P---KPAVPAKKSVTNDFLVCLEDGRKFKSLKRHLRTQYNMSPDEYREKWGLAPDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS LAK MGLG+ R++
Sbjct: 115 PNYAKARSNLAKQMGLGQQRRR 136


>gi|298290678|ref|YP_003692617.1| MucR family transcriptional regulator [Starkeya novella DSM 506]
 gi|296927189|gb|ADH87998.1| transcriptional regulator, MucR family [Starkeya novella DSM 506]
          Length = 140

 Score =  212 bits (540), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 72/142 (50%), Positives = 94/142 (66%), Gaps = 6/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D    DS   ++E+  DIV+AYVSN+ V   D+ +L+ DVH ALQRV           
Sbjct: 1   MSDTKDADS---YIELAADIVSAYVSNNSVSANDLTALLGDVHGALQRVGKG---DAEPV 54

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E  KPAVPI++S+    + CLEDG +FKSLKRHL+T +N+TP+EYR KW L +DYPMV+
Sbjct: 55  AEPAKPAVPIKRSVAPEFIVCLEDGKKFKSLKRHLRTQYNLTPEEYREKWGLPADYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS LAK MGLG+ R++
Sbjct: 115 PNYAAARSALAKEMGLGQQRRR 136


>gi|110633228|ref|YP_673436.1| MucR family transcriptional regulator [Mesorhizobium sp. BNC1]
 gi|110284212|gb|ABG62271.1| transcriptional regulator, MucR family [Chelativorans sp. BNC1]
          Length = 156

 Score =  212 bits (540), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 69/141 (48%), Positives = 98/141 (69%), Gaps = 3/141 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           D+ +  + +  +E+T D+VAAYVSN+ VP++++ +LI DVH+AL RV       + V  E
Sbjct: 19  DEQNTKNEDVLVELTADVVAAYVSNNPVPVSELSNLIADVHAALGRVTRST---EQVATE 75

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
           + KPAV  ++S+ +  + CLEDG +FKSLKRHL TH+ +TP++YR KW L   YPMV+  
Sbjct: 76  KQKPAVNPKRSVHDDYIICLEDGKKFKSLKRHLMTHYGLTPEQYREKWGLDPSYPMVAPN 135

Query: 123 YATTRSKLAKNMGLGRGRKKR 143
           YA  RS+LAK MGLGR RK +
Sbjct: 136 YAVARSQLAKKMGLGRKRKGK 156


>gi|307946167|ref|ZP_07661502.1| transcriptional regulatory protein rosAr [Roseibium sp. TrichSKD4]
 gi|307769831|gb|EFO29057.1| transcriptional regulatory protein rosAr [Roseibium sp. TrichSKD4]
          Length = 138

 Score =  211 bits (539), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 74/130 (56%), Positives = 94/130 (72%), Gaps = 3/130 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E+T DIV+AYVSN+ V   D+ +LI +V+ ALQR    A      +PE LKPAVPI+K
Sbjct: 10  LIELTSDIVSAYVSNNTVASTDLPNLINEVYGALQRT---ATASQEPEPEPLKPAVPIKK 66

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S+    + CLEDG +FKSLKRHL+TH++MTPDEYR KW L  DYPMV+  YA  RS+LAK
Sbjct: 67  SVMPDYIICLEDGKKFKSLKRHLRTHYDMTPDEYREKWELGPDYPMVAPNYAAARSELAK 126

Query: 133 NMGLGRGRKK 142
            MGLG+ RK+
Sbjct: 127 KMGLGQQRKR 136


>gi|254419080|ref|ZP_05032804.1| ROS/MUCR transcriptional regulator protein [Brevundimonas sp. BAL3]
 gi|196185257|gb|EDX80233.1| ROS/MUCR transcriptional regulator protein [Brevundimonas sp. BAL3]
          Length = 142

 Score =  211 bits (539), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 71/143 (49%), Positives = 93/143 (65%), Gaps = 3/143 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            D     LEMT DIV+AYV N+ V    + +LI ++H+AL  V +       V PE  +P
Sbjct: 1   MDEKPELLEMTADIVSAYVGNNTVTAEALPALIANIHAALSGVSNG---PVEVPPEPKEP 57

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AVPIRKSI    L CLEDG +FKSLKRHL+T ++M+P++YR KW L  DYPMV+  YA  
Sbjct: 58  AVPIRKSINADFLICLEDGRKFKSLKRHLRTKYDMSPEDYRAKWGLPKDYPMVAPNYAKA 117

Query: 127 RSKLAKNMGLGRGRKKRVLTSKV 149
           RS+LAK MGLG+G +K    ++ 
Sbjct: 118 RSELAKQMGLGQGGRKPARVARA 140


>gi|91976417|ref|YP_569076.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           BisB5]
 gi|91682873|gb|ABE39175.1| transcriptional regulator, MucR family [Rhodopseudomonas palustris
           BisB5]
          Length = 138

 Score =  211 bits (539), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 72/138 (52%), Positives = 97/138 (70%), Gaps = 2/138 (1%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S  + + F+E+T  IV+AYVSN+  P  +I  LI  VH+ALQR+ S  P    ++P   K
Sbjct: 2   SDPAGKSFIELTATIVSAYVSNNPTPAGEIPGLIGQVHAALQRLSSGRPETPALEP--AK 59

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVP++KS+    L CLEDG +FKSLKRHL+T + MTP++YR KW L +DYPMV+  YA 
Sbjct: 60  PAVPLKKSMTPEYLICLEDGKRFKSLKRHLRTQYKMTPEQYREKWGLPADYPMVAPNYAV 119

Query: 126 TRSKLAKNMGLGRGRKKR 143
            RS+LAK MGLG+ R++R
Sbjct: 120 ERSQLAKKMGLGQQRRRR 137


>gi|222085297|ref|YP_002543827.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Agrobacterium radiobacter K84]
 gi|221722745|gb|ACM25901.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Agrobacterium radiobacter K84]
          Length = 143

 Score =  211 bits (537), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 79/145 (54%), Positives = 103/145 (71%), Gaps = 2/145 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A     +  +E+T DIVAAYVSNHVVP+ D+ +LI+DVHSAL    + AP    V 
Sbjct: 1   MTDTALGTGQDLLVELTADIVAAYVSNHVVPVTDLPNLISDVHSALSSTSAPAPAVTVV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+LA+DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDDQITCLECGGSFKSLKRHLMTHHSLSPEEYREKWDLAADYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA  RS+LAK MGLG+ RK+   
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKRGAR 143


>gi|190890962|ref|YP_001977504.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Rhizobium etli CIAT 652]
 gi|218663386|ref|ZP_03519316.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Rhizobium etli IE4771]
 gi|190696241|gb|ACE90326.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Rhizobium etli CIAT 652]
          Length = 143

 Score =  211 bits (537), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 78/142 (54%), Positives = 103/142 (72%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A+ +  E  +E+T DIVAAYVSNHVVP++D+ +LI+DVHSAL       P    V 
Sbjct: 1   MTDMATGNGPELLVELTADIVAAYVSNHVVPVSDLANLISDVHSALSNTSVPQPAAAVV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDEQITCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|154251327|ref|YP_001412151.1| MucR family transcriptional regulator [Parvibaculum lavamentivorans
           DS-1]
 gi|154155277|gb|ABS62494.1| transcriptional regulator, MucR family [Parvibaculum
           lavamentivorans DS-1]
          Length = 138

 Score =  210 bits (536), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 68/138 (49%), Positives = 90/138 (65%), Gaps = 4/138 (2%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
              ++MT +IV+AYV ++ +   +I  LI  V +AL      AP       E+L+PAV I
Sbjct: 5   AELIDMTAEIVSAYVGHNTLSPDEIPGLINKVFAALAGANGIAPA----PAEKLEPAVSI 60

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           RKS+    L CLEDG +FKSLKRHL+TH+N+TP++YR KW L  DYPMV+  YA  RS+L
Sbjct: 61  RKSVTPDHLICLEDGKKFKSLKRHLRTHYNLTPEQYREKWGLPRDYPMVAPNYAQARSRL 120

Query: 131 AKNMGLGRGRKKRVLTSK 148
           AK MGLG+G   R  T+K
Sbjct: 121 AKKMGLGQGAGGRRRTAK 138


>gi|51012474|gb|AAT92553.1| transcriptional regulatory protein RosR [Rhizobium leguminosarum
           bv. trifolii]
 gi|51012476|gb|AAT92554.1| transcriptional regulatory protein RosR [Rhizobium leguminosarum
           bv. trifolii TA1]
 gi|170783772|gb|ACB37370.1| RosR [Rhizobium leguminosarum bv. viciae]
 gi|170783774|gb|ACB37371.1| RosR [Rhizobium leguminosarum bv. viciae]
 gi|170783778|gb|ACB37373.1| RosR [Rhizobium leguminosarum bv. trifolii]
 gi|170783780|gb|ACB37374.1| RosR [Rhizobium leguminosarum bv. phaseoli]
 gi|170783782|gb|ACB37375.1| RosR [Rhizobium leguminosarum bv. phaseoli]
          Length = 143

 Score =  210 bits (536), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 78/142 (54%), Positives = 104/142 (73%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A+ ++ E  +E+T DIVAAYVSNHVVP++D+ +LI+DVHSAL       P    V 
Sbjct: 1   MTDIATGNAPELLVELTADIVAAYVSNHVVPVSDLANLISDVHSALSNTSVPQPAAAIV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDEQITCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|148555299|ref|YP_001262881.1| MucR family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148500489|gb|ABQ68743.1| transcriptional regulator, MucR family [Sphingomonas wittichii RW1]
          Length = 137

 Score =  210 bits (536), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 64/143 (44%), Positives = 90/143 (62%), Gaps = 6/143 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D+     +E  + +T DIV+A+VSN+ V ++D+  LI +VH+AL  +       +   
Sbjct: 1   MSDNNGL--TETLIALTADIVSAHVSNNSVAVSDLPLLIQNVHNALASLGDEVAEPEV-- 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
             + +PAV IR SI+   + CLEDG + K LKRHL TH+ MTP++YR KWNL +DYPMV+
Sbjct: 57  --KQEPAVSIRASIKPDYIVCLEDGKKLKMLKRHLMTHYQMTPEQYRAKWNLPADYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
             YA  R  LAK +GLG  R+ R
Sbjct: 115 PNYAEQRRSLAKKIGLGTKRRTR 137


>gi|260462413|ref|ZP_05810621.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259031907|gb|EEW33175.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 141

 Score =  210 bits (536), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 70/140 (50%), Positives = 100/140 (71%), Gaps = 3/140 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           ++   ++E  +E+T D+VAAYVSN+ VP+ ++ +LI+DVH+AL RV   A   +    ++
Sbjct: 5   ESPSRNNEALIELTADVVAAYVSNNPVPVGELPNLISDVHAALGRVGGTA---EQPPADK 61

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            KPAV  ++S+ +  + CLEDG +FKSLKRHL TH+++TP++YR KWNL   YPMV+  Y
Sbjct: 62  QKPAVNPKRSVHDDYIVCLEDGKKFKSLKRHLMTHYDLTPEQYREKWNLDPSYPMVAPNY 121

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           A  RS+LAK MGLGR RK R
Sbjct: 122 AAARSQLAKKMGLGRKRKAR 141


>gi|13475233|ref|NP_106797.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14025984|dbj|BAB52583.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 149

 Score =  210 bits (535), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 73/148 (49%), Positives = 100/148 (67%), Gaps = 4/148 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++A   + +  +E+T D+V+AYVSN+ VP+ D+ +LI  VH+AL+            +
Sbjct: 1   MTEEAD-KNIDTLIELTADVVSAYVSNNPVPVGDLPALIGQVHAALKGTAGFVSA---AK 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE L+PAVPIRKS+    + CL+DG +FKSLKRHL THH +TPDEYR KW+L +DYPMV+
Sbjct: 57  PEALEPAVPIRKSVTPDYIICLDDGKKFKSLKRHLSTHHGLTPDEYRAKWHLPADYPMVA 116

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSK 148
             YA  RS LAK MGLGR  K+    ++
Sbjct: 117 PNYAAARSALAKTMGLGRKPKEPEARTR 144


>gi|13476351|ref|NP_107921.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14027112|dbj|BAB54066.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 141

 Score =  210 bits (535), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 70/140 (50%), Positives = 99/140 (70%), Gaps = 3/140 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           +    +++  +E+T D+VAAYVSN+ VP+ ++ +LI+DVH+AL RV   A   +    ++
Sbjct: 5   ETPSRNNDALIELTADVVAAYVSNNPVPVGELPNLISDVHAALGRVGGTA---EQPPADK 61

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            KPAV  ++S+ +  + CLEDG +FKSLKRHL TH+++TPD+YR KWNL   YPMV+  Y
Sbjct: 62  QKPAVNPKRSVHDDYIVCLEDGKKFKSLKRHLMTHYDLTPDQYREKWNLDPSYPMVAPNY 121

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           A  RS+LAK MGLGR RK R
Sbjct: 122 AAARSQLAKKMGLGRKRKAR 141


>gi|260461752|ref|ZP_05809998.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
 gi|319785301|ref|YP_004144777.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|259032393|gb|EEW33658.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
 gi|317171189|gb|ADV14727.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 155

 Score =  210 bits (535), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 67/144 (46%), Positives = 96/144 (66%), Gaps = 2/144 (1%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           +  F+++   +++T D+V+AYVSN+ VP+ ++ +LI  +H AL+R  +        +P  
Sbjct: 3   EEDFENANNLIDLTADVVSAYVSNNPVPVGELPALIGQLHEALKRTAAGRVSAQ--EPTA 60

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             PAVPIRKS+    +  LEDG +FKSLKRHL TH+ +TPDEYR KW L +DYPMV+  Y
Sbjct: 61  FTPAVPIRKSVTPDYIISLEDGKKFKSLKRHLSTHYGLTPDEYRAKWGLPADYPMVAPNY 120

Query: 124 ATTRSKLAKNMGLGRGRKKRVLTS 147
           A  RS LAK MGLGR  K+  +++
Sbjct: 121 AAARSALAKTMGLGRKPKEPEVSA 144


>gi|319784581|ref|YP_004144057.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170469|gb|ADV14007.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 141

 Score =  210 bits (534), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 71/140 (50%), Positives = 99/140 (70%), Gaps = 3/140 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           +    +S+  +E+T D+VAAYVSN+ VP+ ++ +LI+DVH+AL RV   A   +    ++
Sbjct: 5   ETPSRNSDALIELTADVVAAYVSNNPVPVGELPNLISDVHAALGRVGGTA---EQPPADK 61

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            KPAV  ++S+ +  + CLEDG +FKSLKRHL TH+++TPD+YR KWNL   YPMV+  Y
Sbjct: 62  QKPAVNPKRSVHDDYIVCLEDGKKFKSLKRHLMTHYDLTPDQYREKWNLDPTYPMVAPNY 121

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           A  RS+LAK MGLGR RK R
Sbjct: 122 AAARSQLAKKMGLGRKRKAR 141


>gi|86356889|ref|YP_468781.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Rhizobium etli CFN 42]
 gi|2497993|sp|Q52741|ROSR_RHIET RecName: Full=Transcriptional regulatory protein rosR; AltName:
           Full=Nodulation competitiveness determinant
 gi|1421774|gb|AAC44878.1| nodulation competitiveness determinant [Rhizobium etli]
 gi|86280991|gb|ABC90054.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Rhizobium etli CFN 42]
          Length = 143

 Score =  210 bits (534), Expect = 6e-53,   Method: Composition-based stats.
 Identities = 78/142 (54%), Positives = 104/142 (73%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A+ ++ E  +E+T DIVAAYVSNHVVP++D+ +LI+DVHSAL       P    V 
Sbjct: 1   MTDMATGNAPELLVELTADIVAAYVSNHVVPVSDLANLISDVHSALSNTSVPQPAAAVV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDEQITCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|118593335|ref|ZP_01550719.1| transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118434013|gb|EAV40670.1| transcriptional regulator [Stappia aggregata IAM 12614]
          Length = 149

 Score =  210 bits (534), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 69/145 (47%), Positives = 97/145 (66%), Gaps = 5/145 (3%)

Query: 1   MDDDASFDSSER--FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           M+  A   ++     +++T ++V+AYVSN+ V  +D+  LI  VH+AL  +         
Sbjct: 5   MNQTAPDATAPETILVDLTAEVVSAYVSNNTVVSSDLPDLIKGVHAALSSINQ---LSQE 61

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
            + E L PAVP+RKS+    L CLEDG +FKSLKRHL+TH+++TP+EYR KW L SDYPM
Sbjct: 62  PEVEELVPAVPVRKSVTGDFLICLEDGKKFKSLKRHLRTHYDLTPEEYRAKWGLPSDYPM 121

Query: 119 VSREYATTRSKLAKNMGLGRGRKKR 143
           V+  YA  RS+LAK+MGLG+ R K+
Sbjct: 122 VAPNYAAARSQLAKDMGLGQTRTKK 146


>gi|39934921|ref|NP_947197.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           CGA009]
 gi|192290450|ref|YP_001991055.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           TIE-1]
 gi|39648771|emb|CAE27293.1| putative transcriptional regulator MucR [Rhodopseudomonas palustris
           CGA009]
 gi|192284199|gb|ACF00580.1| transcriptional regulator, MucR family [Rhodopseudomonas palustris
           TIE-1]
          Length = 138

 Score =  210 bits (534), Expect = 7e-53,   Method: Composition-based stats.
 Identities = 69/138 (50%), Positives = 96/138 (69%), Gaps = 2/138 (1%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S    + ++E+T  IV+AYVSN+    ++I +LI  VH+ALQR+ +  P  +    E  K
Sbjct: 2   SDTPGKSYIELTASIVSAYVSNNATQASEIPALIGQVHAALQRLSAGRP--EVAPQEPAK 59

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVP++KS+    L CLEDG +FKSLKRHL+T + MTP++YR KW L +DYPMV+  YA 
Sbjct: 60  PAVPVKKSVTPEYLICLEDGKRFKSLKRHLRTQYKMTPEQYREKWGLPADYPMVAPNYAV 119

Query: 126 TRSKLAKNMGLGRGRKKR 143
            RS+LAK MGLG+ R++R
Sbjct: 120 ERSQLAKKMGLGQQRRRR 137


>gi|170783770|gb|ACB37369.1| RosR [Rhizobium gallicum bv. gallicum]
          Length = 143

 Score =  209 bits (533), Expect = 8e-53,   Method: Composition-based stats.
 Identities = 78/142 (54%), Positives = 104/142 (73%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A+ ++ E  +E+T DIVAAYVSNHVVP++D+ +LI+DVHSAL       P    V 
Sbjct: 1   MTDMATGNAPELLVELTADIVAAYVSNHVVPVSDLANLISDVHSALSNTSVPQPAAAIV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDEQITCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|116251147|ref|YP_766985.1| nodulation competitiveness transcriptional regulator [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|241203745|ref|YP_002974841.1| MucR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|115255795|emb|CAK06876.1| putative nodulation competitiveness transcriptional regulator
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|170783776|gb|ACB37372.1| RosR [Rhizobium leguminosarum bv. trifolii]
 gi|240857635|gb|ACS55302.1| transcriptional regulator, MucR family [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 143

 Score =  209 bits (533), Expect = 9e-53,   Method: Composition-based stats.
 Identities = 78/142 (54%), Positives = 103/142 (72%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A+  + E  +E+T DIVAAYVSNHVVP++D+ +LI+DVHSAL       P    V 
Sbjct: 1   MTDIATGSAPELLVELTADIVAAYVSNHVVPVSDLANLISDVHSALSNTSVPQPAAAIV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDEQITCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|56552308|ref|YP_163147.1| MucR family transcriptional regulator [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241761634|ref|ZP_04759721.1| transcriptional regulator, MucR family [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753999|ref|YP_003226892.1| MucR family transcriptional regulator [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|56543882|gb|AAV90036.1| transcriptional regulator, MucR family [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241373942|gb|EER63475.1| transcriptional regulator, MucR family [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258553362|gb|ACV76308.1| transcriptional regulator, MucR family [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 137

 Score =  208 bits (531), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 69/143 (48%), Positives = 94/143 (65%), Gaps = 6/143 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M DD +   SE  + +T DIV+A+VSN+ V +AD+  LI +VH AL  + S A  +   +
Sbjct: 1   MSDDNAL--SETLITLTADIVSAHVSNNSVSVADVPQLIQNVHHALSAL-SEANAEPEAR 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE   PAV +R S++   + CLEDG + K LKRHL TH+ +TP++YR KWNL +DYPMV+
Sbjct: 58  PE---PAVSVRASVKPDYIICLEDGKKLKMLKRHLATHYQLTPEQYRAKWNLPADYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
             YA  R  LAK +GLG  R+KR
Sbjct: 115 PNYADQRRSLAKKIGLGTQRRKR 137


>gi|20803991|emb|CAD31568.1| PUTATIVE TRANSCRIPTIONAL REGULATOR PROTEIN [Mesorhizobium loti R7A]
          Length = 154

 Score =  208 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 69/140 (49%), Positives = 93/140 (66%), Gaps = 3/140 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
            + +   ++  +E+T  +V+AYVSN+ VP+ ++  LI  +H AL+     A  +   +PE
Sbjct: 2   TEETESKADSLIELTAHVVSAYVSNNPVPVGELPGLIGQIHIALKGTAGGAAPE---KPE 58

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
            LKPAVPIRKS+    +  LEDG +FKSLKRHL TH+ +TPDEYR KW L +DYPMV+  
Sbjct: 59  ALKPAVPIRKSVTPDYIISLEDGKKFKSLKRHLATHYGLTPDEYRAKWELPADYPMVAPN 118

Query: 123 YATTRSKLAKNMGLGRGRKK 142
           YA  RS LAK MGLGR  K+
Sbjct: 119 YAAARSALAKTMGLGRKPKE 138


>gi|13488062|ref|NP_085654.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14027903|dbj|BAB54495.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 153

 Score =  208 bits (531), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 69/142 (48%), Positives = 95/142 (66%), Gaps = 4/142 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++A  ++ +  +E+T D+V+AYVSN+ VP+ ++ +LI  VH+AL+        +   +
Sbjct: 1   MTEEAD-NNIDVLIELTADVVSAYVSNNPVPIGELPALIGQVHTALKGTAGSVSAK---E 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P  L PAVPI+KS+    + CLEDG +FKSLKRHL T   +TPDEYR KW L+ DYPMV+
Sbjct: 57  PVVLNPAVPIKKSVTPDYIICLEDGKKFKSLKRHLSTDFGLTPDEYRAKWGLSGDYPMVA 116

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS LAK MGLGR  K+
Sbjct: 117 PNYAAERSALAKTMGLGRKPKE 138


>gi|158422710|ref|YP_001524002.1| putative transcriptional regulator [Azorhizobium caulinodans ORS
           571]
 gi|158329599|dbj|BAF87084.1| putative transcriptional regulator [Azorhizobium caulinodans ORS
           571]
          Length = 180

 Score =  208 bits (530), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 70/133 (52%), Positives = 93/133 (69%), Gaps = 3/133 (2%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           +    S  ++E+  DIV+AYVSN+ V  AD+ +LI +VH+ALQRV      +    PE L
Sbjct: 44  SEATESTTYIELAADIVSAYVSNNSVAAADLPNLINEVHAALQRVSKG---ESEPAPEPL 100

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           KPAVP++KS+    + CLEDG +FKSLKRHL+T +NM+P++YR KW L  DYPMV+  YA
Sbjct: 101 KPAVPVKKSVTPDFIVCLEDGKKFKSLKRHLRTQYNMSPEQYREKWALPPDYPMVAPNYA 160

Query: 125 TTRSKLAKNMGLG 137
             RS+LAK MGLG
Sbjct: 161 AARSELAKQMGLG 173


>gi|13475111|ref|NP_106675.1| transcriptional regulatory protein [Mesorhizobium loti MAFF303099]
 gi|14025862|dbj|BAB52461.1| transcriptional regulatory protein [Mesorhizobium loti MAFF303099]
          Length = 154

 Score =  208 bits (530), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 68/140 (48%), Positives = 92/140 (65%), Gaps = 3/140 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
            + +   ++  +E+T  +V+AYVSN+ VP+ ++  LI  +H AL+     A  + +   E
Sbjct: 2   TEETESKADNLIELTAHVVSAYVSNNPVPVGELPGLIGQIHIALKGTAGGAAPEKS---E 58

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
            LKPAVPIRKS+    +  LEDG +FKSLKRHL TH+ +TPDEYR KW L +DYPMV+  
Sbjct: 59  ALKPAVPIRKSVTPDYIISLEDGKKFKSLKRHLATHYGLTPDEYRAKWELPADYPMVAPN 118

Query: 123 YATTRSKLAKNMGLGRGRKK 142
           YA  RS LAK MGLGR  K+
Sbjct: 119 YAAARSALAKTMGLGRKPKE 138


>gi|209548484|ref|YP_002280401.1| MucR family transcriptional regulator [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209534240|gb|ACI54175.1| transcriptional regulator, MucR family [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 143

 Score =  208 bits (529), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 77/142 (54%), Positives = 104/142 (73%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + A+ ++ E  +E+T DIVAAYVSNHVVP++D+ +LI+DVHSAL       P    V 
Sbjct: 1   MTEMATGNAPELLVELTADIVAAYVSNHVVPVSDLANLISDVHSALSNTSVPQPAAAIV- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+
Sbjct: 60  -EKQKPAVSVRKSVQDEQITCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK MGLG+ RK+
Sbjct: 119 PAYAEARSRLAKEMGLGQRRKR 140


>gi|302382313|ref|YP_003818136.1| MucR family transcriptional regulator [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192941|gb|ADL00513.1| transcriptional regulator, MucR family [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 148

 Score =  208 bits (529), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 72/147 (48%), Positives = 92/147 (62%), Gaps = 3/147 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           D    D     LEMT DIV+AYV N+ V   D+ SLI+++H+AL +V +     +    E
Sbjct: 2   DTTRMDERSELLEMTADIVSAYVGNNSVSANDLPSLISNIHAALSQVSTGVVEVEPEVKE 61

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
               AVPIRKSI    L CLEDG +FKSLKRHL+T ++M+P+EYR KW L  DYPMV+  
Sbjct: 62  P---AVPIRKSISPDFLICLEDGRKFKSLKRHLRTKYDMSPEEYRAKWGLPKDYPMVAPN 118

Query: 123 YATTRSKLAKNMGLGRGRKKRVLTSKV 149
           YA  RS LAK MGLG+G +K     + 
Sbjct: 119 YAKARSDLAKQMGLGQGGRKPARAPRA 145


>gi|182678616|ref|YP_001832762.1| MucR family transcriptional regulator [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634499|gb|ACB95273.1| transcriptional regulator, MucR family [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 138

 Score =  207 bits (528), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 72/139 (51%), Positives = 94/139 (67%), Gaps = 3/139 (2%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           +    S  ++E+  DIV+AYVSN+ VP +D+ SLI +VHSAL R             E  
Sbjct: 2   SETSPSNSYIELAADIVSAYVSNNSVPASDLPSLINEVHSALLR---VTTGTVTPTVEIP 58

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           KPAVP +KS+ N  + CLEDG +FKSLKRHL+T +NM+PDEYR KW L +DYPMV+  YA
Sbjct: 59  KPAVPTKKSVTNEFIVCLEDGRKFKSLKRHLRTQYNMSPDEYREKWGLPADYPMVAPNYA 118

Query: 125 TTRSKLAKNMGLGRGRKKR 143
             RS LAK MGLG+ R+++
Sbjct: 119 KARSNLAKQMGLGQQRRRK 137


>gi|316934990|ref|YP_004109972.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           DX-1]
 gi|315602704|gb|ADU45239.1| transcriptional regulator, MucR family [Rhodopseudomonas palustris
           DX-1]
          Length = 138

 Score =  206 bits (526), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 68/138 (49%), Positives = 98/138 (71%), Gaps = 2/138 (1%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S  + + ++E+T  IV+AYVS++    ++I +LI  VH+ALQR+ +  P    ++P   K
Sbjct: 2   SDTTGKSYIELTASIVSAYVSHNATQASEIPALIGQVHAALQRLSASRPEAAPLEPS--K 59

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVP++KS+    L CLEDG +FKSLKRHL+T + MTP++YR KW L +DYPMV+  YA 
Sbjct: 60  PAVPVKKSVTPEYLICLEDGKRFKSLKRHLRTQYKMTPEQYREKWGLPADYPMVAPNYAV 119

Query: 126 TRSKLAKNMGLGRGRKKR 143
            RS+LAK MGLG+ R++R
Sbjct: 120 ERSQLAKKMGLGQQRRRR 137


>gi|27378179|ref|NP_769708.1| transcriptional regulator [Bradyrhizobium japonicum USDA 110]
 gi|27351326|dbj|BAC48333.1| blr3068 [Bradyrhizobium japonicum USDA 110]
          Length = 138

 Score =  206 bits (526), Expect = 6e-52,   Method: Composition-based stats.
 Identities = 71/138 (51%), Positives = 95/138 (68%), Gaps = 2/138 (1%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S   ++ F+E+T  IV+AY+ N+  P A+I +LI+ VH AL RV S     +    E  K
Sbjct: 2   SDAGAKNFIELTASIVSAYLGNNPTPAAEIPNLISQVHGALVRVSSGR--VEAAPLEPAK 59

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAV ++KSI    L CLEDG +FKSLKRHL+T +NMTP++YR KW L +DYPMV+  YA 
Sbjct: 60  PAVSLKKSIAPDYLVCLEDGKRFKSLKRHLRTQYNMTPEQYREKWGLPADYPMVAPNYAV 119

Query: 126 TRSKLAKNMGLGRGRKKR 143
            RS+LAK MGLG+ ++KR
Sbjct: 120 ARSQLAKQMGLGQQQRKR 137


>gi|16519655|ref|NP_443775.1| transcriptional regulator, Roc/MucR family [Sinorhizobium fredii
           NGR234]
 gi|2497992|sp|P55363|MUCR_RHISN RecName: Full=Transcriptional regulatory protein mucR homolog
 gi|2182305|gb|AAB91613.1| transcriptional regulator, Roc/MucR family [Sinorhizobium fredii
           NGR234]
          Length = 143

 Score =  206 bits (524), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 76/145 (52%), Positives = 99/145 (68%), Gaps = 2/145 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +     S+E   E+T +IVAAYVS HVVP A++ +LI DVHSAL    + AP      
Sbjct: 1   MTETTLGASNELLAELTAEIVAAYVSTHVVPGAELPTLIADVHSALNNATAPAPV--IAP 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAV IRKS+++  + CLE G  FKSLKRHL THHN++P++YR KW+L +DYPMV+
Sbjct: 59  IEKPKPAVSIRKSVQDDQITCLECGGAFKSLKRHLMTHHNLSPEDYREKWDLPADYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA  RS+LAK +GLG  RK+R  
Sbjct: 119 PAYAEARSRLAKEIGLGERRKRRGK 143


>gi|86750629|ref|YP_487125.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           HaA2]
 gi|86573657|gb|ABD08214.1| transcriptional regulator, MucR family [Rhodopseudomonas palustris
           HaA2]
          Length = 139

 Score =  205 bits (522), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 70/140 (50%), Positives = 96/140 (68%), Gaps = 2/140 (1%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S  + +  +E+T  IV+AYVSN+  P  ++ SL+  VH+ALQR+ S       ++P   K
Sbjct: 2   SDAAGKSLIELTATIVSAYVSNNPTPAGEVPSLLGQVHAALQRLSSGRAEAPALEP--AK 59

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVP++KS+    L CLEDG +FKSLKRHL+T + MTP++YR KW L SDYPMV+  YA 
Sbjct: 60  PAVPLKKSMTPEYLICLEDGKRFKSLKRHLRTQYKMTPEQYREKWGLPSDYPMVAPNYAV 119

Query: 126 TRSKLAKNMGLGRGRKKRVL 145
            RS+LAK MGLG+ R++R  
Sbjct: 120 ERSQLAKKMGLGQQRRRRSK 139


>gi|188579771|ref|YP_001923216.1| MucR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179343269|gb|ACB78681.1| transcriptional regulator, MucR family [Methylobacterium populi
           BJ001]
          Length = 145

 Score =  205 bits (521), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 69/141 (48%), Positives = 94/141 (66%), Gaps = 4/141 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR-APCQDNV 59
           M++    ++   ++ +T DIVAAYVSN+ VP A++  LI  +H AL +V S  A      
Sbjct: 1   MNET---ETPVDYVALTADIVAAYVSNNPVPAAELAGLIGSIHGALLQVGSGQAVAPQPA 57

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E L+PAVPI+KSI+   + CLEDG  FKSLKRHL+  +N++P++YR KW LA DYPMV
Sbjct: 58  AQEPLQPAVPIKKSIQPDYIVCLEDGRTFKSLKRHLRAKYNLSPEQYRAKWGLAPDYPMV 117

Query: 120 SREYATTRSKLAKNMGLGRGR 140
           +  YA  RS LAK +GLG+ R
Sbjct: 118 APNYAKARSDLAKAIGLGQVR 138


>gi|148254483|ref|YP_001239068.1| MucR family transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146406656|gb|ABQ35162.1| transcriptional regulator, MucR family [Bradyrhizobium sp. BTAi1]
          Length = 138

 Score =  205 bits (521), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 77/143 (53%), Positives = 101/143 (70%), Gaps = 7/143 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A     + F+++T DIV+AY+SN+  P A+I SLI+ VH+AL RV   A  +    
Sbjct: 1   MTDGAG----KSFIDLTADIVSAYLSNNPTPAAEIPSLISQVHAALTRV---AAGRSEPA 53

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE  +PAVP++KSI    L CLEDG +FKSL+RHL+T +NMTP++YR KWNL  DYPMV+
Sbjct: 54  PEPARPAVPVKKSIHPDYLVCLEDGKRFKSLRRHLRTQYNMTPEQYRDKWNLPPDYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
             YA TRS+LAK MGLG+ R +R
Sbjct: 114 PNYAVTRSQLAKKMGLGQQRPER 136


>gi|220926935|ref|YP_002502237.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219951542|gb|ACL61934.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 145

 Score =  205 bits (521), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 64/146 (43%), Positives = 91/146 (62%), Gaps = 6/146 (4%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M D D     +E  + +T DIV+AYVS + VP +++  L+T +H  LQ +VS  P     
Sbjct: 2   MTDVDGRDADAEELVTLTADIVSAYVSKNSVPASELPGLLTSIHGTLQALVSPPPAA--- 58

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
            PE+  P +P++K++    +  LEDG  +KSLKRHL T   +TP++YR KW L  DYPMV
Sbjct: 59  -PEKPVPPIPVKKTVTPDAIISLEDGKPYKSLKRHLTTR-GLTPEQYREKWGLPPDYPMV 116

Query: 120 SREYATTRSKLAKNMGLGRGRKKRVL 145
           +  YA  RS+LAK++GLG+ RK R  
Sbjct: 117 AANYAAQRSELAKSIGLGQQRKNRAP 142


>gi|146339707|ref|YP_001204755.1| Ros/MucR family transcriptional regulator [Bradyrhizobium sp.
           ORS278]
 gi|146192513|emb|CAL76518.1| putative transcriptional regulatory protein, Ros/MucR family
           [Bradyrhizobium sp. ORS278]
          Length = 138

 Score =  205 bits (521), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 74/138 (53%), Positives = 100/138 (72%), Gaps = 3/138 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           +  + + F+++T DIV+AY+SN+  P A+I SLI+ VH+AL RV   A  +    PE  +
Sbjct: 2   TEGAGKSFIDLTADIVSAYLSNNPTPAAEIPSLISQVHAALTRV---AAGRSEPAPEPTR 58

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVP++KSI    L CLEDG +FKSL+RHL+T +NMTP++YR KWNL  DYPMV+  YA 
Sbjct: 59  PAVPVKKSIHPDYLVCLEDGKRFKSLRRHLRTQYNMTPEQYRDKWNLPPDYPMVAPNYAV 118

Query: 126 TRSKLAKNMGLGRGRKKR 143
           TRS+LAK MGLG+ R +R
Sbjct: 119 TRSQLAKKMGLGQQRPER 136


>gi|92118139|ref|YP_577868.1| MucR family transcriptional regulator [Nitrobacter hamburgensis
           X14]
 gi|91801033|gb|ABE63408.1| transcriptional regulator, MucR family [Nitrobacter hamburgensis
           X14]
          Length = 137

 Score =  204 bits (520), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 75/143 (52%), Positives = 103/143 (72%), Gaps = 7/143 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A     + FL++T +IV+AYVSN+  P ++I +LI+ VH+AL RV S    +  + 
Sbjct: 1   MSDTAG----KSFLDLTAEIVSAYVSNNTTPASEIPALISQVHAALTRVSSG---RGELP 53

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E  KPAVP++KS+    L CLEDG +FKSLKRHL+T +NM+P++YR KW L +DYPMV+
Sbjct: 54  AEPAKPAVPVKKSMTADYLICLEDGKRFKSLKRHLRTQYNMSPEQYRDKWKLPADYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
             YA TRS+LAKNMGLG+ R++R
Sbjct: 114 PNYAVTRSQLAKNMGLGQQRRRR 136


>gi|323135887|ref|ZP_08070970.1| transcriptional regulator, MucR family [Methylocystis sp. ATCC
           49242]
 gi|322398978|gb|EFY01497.1| transcriptional regulator, MucR family [Methylocystis sp. ATCC
           49242]
          Length = 135

 Score =  204 bits (519), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 62/132 (46%), Positives = 88/132 (66%), Gaps = 3/132 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +++  DIV+AYVSN+ VP AD+ +LI++V++AL RV S         P+       ++KS
Sbjct: 7   IQLAADIVSAYVSNNSVPAADLPALISEVYNALLRVGSSVVAAPAEPPKPAI---AVKKS 63

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    + CLEDG +FKSLKRHL+T + ++P+EYR KW L  DYPMV+  YA  RS LAK 
Sbjct: 64  VTTDYIICLEDGKKFKSLKRHLRTQYGLSPEEYREKWGLPPDYPMVAPNYAKARSNLAKQ 123

Query: 134 MGLGRGRKKRVL 145
           MGLG+ R++R  
Sbjct: 124 MGLGQQRRRRGK 135


>gi|85715574|ref|ZP_01046554.1| ROSMUCR transcriptional regulator [Nitrobacter sp. Nb-311A]
 gi|85697513|gb|EAQ35390.1| ROSMUCR transcriptional regulator [Nitrobacter sp. Nb-311A]
          Length = 137

 Score =  204 bits (519), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 75/143 (52%), Positives = 103/143 (72%), Gaps = 7/143 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A     + FL++T +IV+AYVSN+  P ++I  LI+ VH+AL RV S    +  + 
Sbjct: 1   MSDSAG----KSFLDLTAEIVSAYVSNNTTPASEIPVLISQVHAALMRVSSG---RSELP 53

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E +KPAVPI+KS+    L CLEDG +FKSLKRHL+T +NM+P++YR KW L +DYPMV+
Sbjct: 54  VEPVKPAVPIKKSMTADYLVCLEDGKRFKSLKRHLRTQYNMSPEQYRDKWKLPADYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
             YA TRS+LAK+MGLG+ R++R
Sbjct: 114 PNYAVTRSQLAKDMGLGQQRRRR 136


>gi|75676412|ref|YP_318833.1| ROSMUCR transcriptional regulator [Nitrobacter winogradskyi Nb-255]
 gi|74421282|gb|ABA05481.1| transcriptional regulator, MucR family [Nitrobacter winogradskyi
           Nb-255]
          Length = 137

 Score =  204 bits (519), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 76/143 (53%), Positives = 103/143 (72%), Gaps = 7/143 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A    S+ FL++T +IV+AY+SN+  P ++I +LI  VH+AL RV S    +  + 
Sbjct: 1   MSDSA----SKSFLDLTAEIVSAYLSNNTTPASEIPALINQVHAALTRVSSG---RGELP 53

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E  KPAVP+RKS+    L CLEDG +FKSLKRHL+T +NM+P++YR KW L +DYPMV+
Sbjct: 54  AEPAKPAVPVRKSMTADYLICLEDGKRFKSLKRHLRTQYNMSPEQYRDKWKLPADYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
             YA TRS+LAKNMGLG+ R++R
Sbjct: 114 PNYAVTRSQLAKNMGLGQQRRRR 136


>gi|163849882|ref|YP_001637925.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|218528514|ref|YP_002419330.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|240137108|ref|YP_002961577.1| Transcriptional regulatory protein mucR [Methylobacterium
           extorquens AM1]
 gi|163661487|gb|ABY28854.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|218520817|gb|ACK81402.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
 gi|240007074|gb|ACS38300.1| Transcriptional regulatory protein mucR [Methylobacterium
           extorquens AM1]
          Length = 145

 Score =  204 bits (519), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 69/141 (48%), Positives = 96/141 (68%), Gaps = 4/141 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR-APCQDNV 59
           M++    ++   ++ +T DIVAAYVSN+ VP A++  LI ++H AL +V +  A     V
Sbjct: 1   MNET---ETPVDYVALTADIVAAYVSNNPVPAAELAGLIGNIHGALIQVGTGRAAAPQPV 57

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E L+PAVPI+KSI+   L CLEDG  FKSLKRHL+  +N++P++YR KW L+ DYPMV
Sbjct: 58  AQEALQPAVPIKKSIQPDYLVCLEDGRTFKSLKRHLRAKYNLSPEQYRAKWGLSPDYPMV 117

Query: 120 SREYATTRSKLAKNMGLGRGR 140
           +  YA  RS LAK +GLG+ R
Sbjct: 118 APNYAKARSDLAKAIGLGQVR 138


>gi|114328099|ref|YP_745256.1| transcriptional regulator [Granulibacter bethesdensis CGDNIH1]
 gi|114316273|gb|ABI62333.1| transcriptional regulator [Granulibacter bethesdensis CGDNIH1]
          Length = 200

 Score =  203 bits (518), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 59/138 (42%), Positives = 86/138 (62%), Gaps = 5/138 (3%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           +      R LE+T  IVAA++S++ V    I S I  +H  L  + +       V+PERL
Sbjct: 49  SDDTPPSRLLELTAQIVAAHISHNSVQAEAIPSFIQQIHHTLSTIGTPV-----VEPERL 103

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
            PAVP+++S+    + CLEDG + K LKRHL++ ++MTP++YR +W+L  DYPMV+  YA
Sbjct: 104 TPAVPVKRSVFPDYIVCLEDGKKLKMLKRHLQSAYSMTPEQYRQRWSLPPDYPMVAPNYA 163

Query: 125 TTRSKLAKNMGLGRGRKK 142
             RS LAK  GLGR  ++
Sbjct: 164 ERRSSLAKQNGLGRKTRE 181


>gi|315500368|ref|YP_004089171.1| transcriptional regulator, mucr family [Asticcacaulis excentricus
           CB 48]
 gi|315418380|gb|ADU15020.1| transcriptional regulator, MucR family [Asticcacaulis excentricus
           CB 48]
          Length = 141

 Score =  203 bits (518), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 65/142 (45%), Positives = 88/142 (61%), Gaps = 3/142 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            +   +  ++ VDIV AYV N+ VP +++ +LI  VH AL  +      +     E   P
Sbjct: 1   MEEQNKLTDLVVDIVTAYVGNNSVPASELPALIHSVHKALGGLTGEPEAKVE---EAKTP 57

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AV I+KSI +  + CLEDG +FKSLKRHL+T +NM+P+EYR KWNL  DYPMV+  YA  
Sbjct: 58  AVSIKKSISDDYIICLEDGRKFKSLKRHLRTKYNMSPEEYRAKWNLPKDYPMVAPNYAAA 117

Query: 127 RSKLAKNMGLGRGRKKRVLTSK 148
           RS LAK MGLG G ++     +
Sbjct: 118 RSNLAKQMGLGTGGRQAARKPR 139


>gi|254559120|ref|YP_003066215.1| MucR family transcriptional regulator [Methylobacterium extorquens
           DM4]
 gi|254266398|emb|CAX22162.1| Transcriptional regulatory protein mucR [Methylobacterium
           extorquens DM4]
          Length = 145

 Score =  203 bits (518), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 69/141 (48%), Positives = 96/141 (68%), Gaps = 4/141 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR-APCQDNV 59
           M++    ++   ++ +T DIVAAYVSN+ VP A++  LI ++H AL +V +  A     V
Sbjct: 1   MNET---ETPVDYVALTADIVAAYVSNNPVPAAELAGLIGNIHGALIQVGTGRAATPQPV 57

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E L+PAVPI+KSI+   L CLEDG  FKSLKRHL+  +N++P++YR KW L+ DYPMV
Sbjct: 58  AQEALQPAVPIKKSIQPDYLVCLEDGRTFKSLKRHLRAKYNLSPEQYRAKWGLSPDYPMV 117

Query: 120 SREYATTRSKLAKNMGLGRGR 140
           +  YA  RS LAK +GLG+ R
Sbjct: 118 APNYAKARSDLAKAIGLGQVR 138


>gi|323138397|ref|ZP_08073467.1| transcriptional regulator, MucR family [Methylocystis sp. ATCC
           49242]
 gi|322396344|gb|EFX98875.1| transcriptional regulator, MucR family [Methylocystis sp. ATCC
           49242]
          Length = 148

 Score =  203 bits (517), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 65/142 (45%), Positives = 90/142 (63%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M DD   + +   +E    IV+AYVSN+ VP +D+ +L+  VH+AL  +   A       
Sbjct: 1   MSDDKQPEHAAN-IEHVAGIVSAYVSNNSVPASDLPALLQSVHAALVGLSRGASVVGEAA 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
             + +PAVPI+KS+    + CLEDG +FKSLKRHL++ ++MTP+EYR KW L  DYPMV+
Sbjct: 60  VAK-EPAVPIKKSVTPDFIICLEDGKKFKSLKRHLRSSYSMTPEEYRAKWGLPPDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LA  MGLG+   K
Sbjct: 119 PNYAQRRSELAMTMGLGKKSGK 140


>gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competitiveness
           determinant [Mesorhizobium loti MAFF303099]
 gi|14021882|dbj|BAB48493.1| transcriptional regulatory protein, nodulation competitiveness
           determinant [Mesorhizobium loti MAFF303099]
          Length = 151

 Score =  203 bits (517), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 63/147 (42%), Positives = 86/147 (58%), Gaps = 4/147 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
            + S   S    E+T DIV+AYVSN+ +P++ +  +I  VH++L  + +  P       E
Sbjct: 2   TNESDTRSAELAELTADIVSAYVSNNPLPVSGLPDVIASVHASLSGLGTPIPPVA----E 57

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
              PAV  +KS+    + CLEDG +FKSLKRHL T   +TPD YR KWNL  DYPM +  
Sbjct: 58  PQTPAVNPKKSVTPDFIICLEDGKKFKSLKRHLSTDFGLTPDAYRAKWNLPHDYPMTAPN 117

Query: 123 YATTRSKLAKNMGLGRGRKKRVLTSKV 149
           YA  RS+LAK++GLGR  +      K 
Sbjct: 118 YAAQRSQLAKSIGLGRKAEPVAPAKKA 144


>gi|209885755|ref|YP_002289612.1| transcriptional regulatory protein MucR [Oligotropha
           carboxidovorans OM5]
 gi|209873951|gb|ACI93747.1| transcriptional regulatory protein MucR [Oligotropha
           carboxidovorans OM5]
          Length = 137

 Score =  203 bits (516), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 69/137 (50%), Positives = 96/137 (70%), Gaps = 4/137 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S  + + F+EM   IV+AYVSN+ VP ++I  LI  VH+AL RV + A        E  +
Sbjct: 2   SEPAGKGFVEMAAGIVSAYVSNNTVPPSEIPGLIAQVHAALLRVATGA----EQPVEATR 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVP++KS+ +  L CLEDG +FKSLKRHL++ +NM+P++YR KW L +DYPMV+  YA 
Sbjct: 58  PAVPVKKSMTSEYLVCLEDGKRFKSLKRHLRSRYNMSPEQYREKWGLPADYPMVAPNYAV 117

Query: 126 TRSKLAKNMGLGRGRKK 142
            RS+LAK MGLG+ R++
Sbjct: 118 ARSQLAKKMGLGQQRRR 134


>gi|295690704|ref|YP_003594397.1| MucR family transcriptional regulator [Caulobacter segnis ATCC
           21756]
 gi|295432607|gb|ADG11779.1| transcriptional regulator, MucR family [Caulobacter segnis ATCC
           21756]
          Length = 139

 Score =  203 bits (516), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 69/142 (48%), Positives = 86/142 (60%), Gaps = 3/142 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            +     +EMT  IV+AYV N+VV  AD+ +LI  VH AL  V S A        E    
Sbjct: 1   MEDQSDLIEMTAGIVSAYVGNNVVATADLPALIKQVHQALATVGSPAAEPPAPPKEPAV- 59

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
             PI++SI    L CLEDG +FKSLKRHL+T ++MTP++YR KW L  DYPMV+  YA  
Sbjct: 60  --PIKRSITPDYLICLEDGRKFKSLKRHLRTKYDMTPEDYRAKWGLPKDYPMVAPNYAEA 117

Query: 127 RSKLAKNMGLGRGRKKRVLTSK 148
           RS LAK MGLG+G +K     K
Sbjct: 118 RSNLAKQMGLGQGGRKPARKGK 139


>gi|288956890|ref|YP_003447231.1| transcriptional regulatory protein [Azospirillum sp. B510]
 gi|288909198|dbj|BAI70687.1| transcriptional regulatory protein [Azospirillum sp. B510]
          Length = 137

 Score =  203 bits (516), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 64/138 (46%), Positives = 88/138 (63%), Gaps = 4/138 (2%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
            +   S   L +T +IVAA+VSN+ V + D+ +LI  V+ +L  V      +  V  ER 
Sbjct: 2   TNGSPSNALLSLTTEIVAAHVSNNTVALTDLPTLIEQVYKSLANVG----VEPVVAEERP 57

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVPI+KS+    + CLEDG + K LKRHLKT +NMTP+EYR +W L +DYPMV+  YA
Sbjct: 58  QPAVPIKKSVTPDYIVCLEDGKKLKMLKRHLKTAYNMTPEEYRDRWGLPTDYPMVAPNYA 117

Query: 125 TTRSKLAKNMGLGRGRKK 142
             RS LAK +GLG   ++
Sbjct: 118 RQRSSLAKQIGLGTRARR 135


>gi|162148931|ref|YP_001603392.1| transcriptional regulator protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209545313|ref|YP_002277542.1| MucR family transcriptional regulator [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787508|emb|CAP57104.1| putative transcriptional regulator protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209532990|gb|ACI52927.1| transcriptional regulator, MucR family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 158

 Score =  203 bits (516), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 61/135 (45%), Positives = 87/135 (64%), Gaps = 5/135 (3%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           +  +    FLE+T  IV+A+VSN+ V    +  LI  V+ AL  +   AP     +PE+L
Sbjct: 2   SEIEQDAPFLELTAQIVSAHVSNNTVVADSVPDLIRQVYQALASLGQVAP-----EPEKL 56

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVPI++S+    + CLEDG + K LKRHL++ + MTP++YR +W L SDYPMV+  YA
Sbjct: 57  QPAVPIKRSVFPDYIVCLEDGKKLKMLKRHLQSAYGMTPEQYRERWGLPSDYPMVAPNYA 116

Query: 125 TTRSKLAKNMGLGRG 139
             RS LA+ +GLGR 
Sbjct: 117 ERRSTLAREIGLGRK 131


>gi|307293139|ref|ZP_07572985.1| transcriptional regulator, MucR family [Sphingobium
           chlorophenolicum L-1]
 gi|306881205|gb|EFN12421.1| transcriptional regulator, MucR family [Sphingobium
           chlorophenolicum L-1]
          Length = 141

 Score =  203 bits (516), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 62/144 (43%), Positives = 90/144 (62%), Gaps = 4/144 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           +     SE  + +T DIVAA+VSN+ V ++D+ +LI +VH+AL  + + A   +     +
Sbjct: 2   EIESAQSELLITLTSDIVAAHVSNNSVAVSDVSTLIQNVHAALSGLTTPAAAPEV----K 57

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            +PAV +R SI+   + CLEDG + K LKRHL TH+ MTP++YR KW L +DYPMV+  Y
Sbjct: 58  PEPAVSVRSSIKPDYIICLEDGKKLKMLKRHLMTHYQMTPEDYRAKWGLPADYPMVAPNY 117

Query: 124 ATTRSKLAKNMGLGRGRKKRVLTS 147
           A  R  LAK +GLG  R++     
Sbjct: 118 AEQRRSLAKKIGLGTKRRRVRAPK 141


>gi|148559703|ref|YP_001258568.1| Ros/MucR family transcriptional regulator [Brucella ovis ATCC
           25840]
 gi|294851940|ref|ZP_06792613.1| ros/MucR family transcriptional regulator [Brucella sp. NVSL
           07-0026]
 gi|148370960|gb|ABQ60939.1| transcriptional regulator, Ros/MucR family [Brucella ovis ATCC
           25840]
 gi|294820529|gb|EFG37528.1| ros/MucR family transcriptional regulator [Brucella sp. NVSL
           07-0026]
          Length = 161

 Score =  203 bits (516), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 69/142 (48%), Positives = 97/142 (68%), Gaps = 3/142 (2%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M++ + + +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R      V
Sbjct: 20  MENLETNDESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVHAAFKRHVEREEAPVVV 79

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E+ KPAV  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV
Sbjct: 80  --EKPKPAVNPKKSVHDDYIVCLEDGKKFKSLKRHLMTHYNMTPEQYREKWDLDPNYPMV 137

Query: 120 SREYATTRSKLAKNMGLGRGRK 141
           +  YA  RS+LAK MGLGR  K
Sbjct: 138 APNYAAARSRLAKKMGLGRKPK 159


>gi|94498007|ref|ZP_01304571.1| predicted transcriptional regulator [Sphingomonas sp. SKA58]
 gi|94422590|gb|EAT07627.1| predicted transcriptional regulator [Sphingomonas sp. SKA58]
          Length = 140

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 65/142 (45%), Positives = 93/142 (65%), Gaps = 6/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+ +++   +E  + +T DIVAA+VSN+ V ++D+ SLI +VH+AL  +       +   
Sbjct: 1   METESA--QNELLITLTSDIVAAHVSNNSVAVSDVSSLIQNVHAALSALNQPVEAPEV-- 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
             R +PAV IR SI+   + CLEDG + K LKRHL TH+ MTP++YR KWNL +DYPMV+
Sbjct: 57  --RPEPAVSIRASIKPDYIVCLEDGKKLKMLKRHLMTHYQMTPEDYRAKWNLPADYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  R  LAK +GLG  R++
Sbjct: 115 PNYAEQRRNLAKKIGLGTKRRR 136


>gi|222147959|ref|YP_002548916.1| transcriptional regulator [Agrobacterium vitis S4]
 gi|221734947|gb|ACM35910.1| transcriptional regulator [Agrobacterium vitis S4]
          Length = 143

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 75/143 (52%), Positives = 98/143 (68%), Gaps = 3/143 (2%)

Query: 1   MDDDA-SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M + A     ++  +E+T DIVAAYVSNHVVP+ DI  LI+DVH+AL    + +P     
Sbjct: 1   MSETAFGSSGNDLLVELTADIVAAYVSNHVVPIGDISHLISDVHTALSN--TSSPVPVVS 58

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E+ KPAV +RKSI+   + CLE G  FKSLKRHL THH ++P+EYR KW+L  DYPMV
Sbjct: 59  VVEKQKPAVAVRKSIQGDQIICLECGGSFKSLKRHLMTHHTLSPEEYREKWDLPVDYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRKK 142
           +  YA  RS+LAK MGLG+ R++
Sbjct: 119 APAYAEARSRLAKEMGLGQRRRR 141


>gi|17987647|ref|NP_540281.1| transcriptional regulatory protein MUCR [Brucella melitensis bv. 1
           str. 16M]
 gi|17983359|gb|AAL52545.1| transcriptional regulatory protein mucr [Brucella melitensis bv. 1
           str. 16M]
          Length = 161

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 69/142 (48%), Positives = 97/142 (68%), Gaps = 3/142 (2%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M++ + + +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R      V
Sbjct: 20  MENLETNDESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVHAAFKRHVEREEAPVVV 79

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E+ KPAV  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV
Sbjct: 80  --EKPKPAVNPKKSVHDDYIVCLEDGKKFKSLKRHLVTHYNMTPEQYREKWDLDPNYPMV 137

Query: 120 SREYATTRSKLAKNMGLGRGRK 141
           +  YA  RS+LAK MGLGR  K
Sbjct: 138 APNYAAARSRLAKKMGLGRKPK 159


>gi|329849902|ref|ZP_08264748.1| transcriptional regulatory protein ros [Asticcacaulis biprosthecum
           C19]
 gi|328841813|gb|EGF91383.1| transcriptional regulatory protein ros [Asticcacaulis biprosthecum
           C19]
          Length = 136

 Score =  202 bits (515), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 63/129 (48%), Positives = 88/129 (68%), Gaps = 3/129 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           ++MT DIV+A+V N+ VP +++ SLI  V+ AL  + S    +     E   PAV ++KS
Sbjct: 1   MDMTADIVSAFVGNNSVPASELPSLIQSVYQALNSISSGEETKVEAPKE---PAVSVKKS 57

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I +  + CLEDG +FKSLKRHL+T + M+P++YR KWNL  DYPMV+  YA  RS LAK 
Sbjct: 58  ISSDYIICLEDGRKFKSLKRHLRTKYGMSPEDYRAKWNLPKDYPMVAPNYAKARSDLAKQ 117

Query: 134 MGLGRGRKK 142
           MGLG+G ++
Sbjct: 118 MGLGQGGRQ 126


>gi|294012039|ref|YP_003545499.1| MucR-family transcriptional regulator [Sphingobium japonicum UT26S]
 gi|292675369|dbj|BAI96887.1| MucR-family transcriptional regulator [Sphingobium japonicum UT26S]
          Length = 141

 Score =  202 bits (514), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 62/144 (43%), Positives = 90/144 (62%), Gaps = 4/144 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           +     SE  + +T DIVAA+VSN+ V ++D+ +LI +VH+AL  + + A   +     +
Sbjct: 2   EIESAQSELLITLTSDIVAAHVSNNSVAVSDVSTLIQNVHAALSGLATPAAAPEV----K 57

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            +PAV +R SI+   + CLEDG + K LKRHL TH+ MTP++YR KW L +DYPMV+  Y
Sbjct: 58  PEPAVSVRSSIKPDYIICLEDGKKLKMLKRHLMTHYQMTPEDYRAKWGLPADYPMVAPNY 117

Query: 124 ATTRSKLAKNMGLGRGRKKRVLTS 147
           A  R  LAK +GLG  R++     
Sbjct: 118 AEQRRSLAKKIGLGTKRRRVRAPK 141


>gi|148550645|ref|YP_001260084.1| MucR family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148503064|gb|ABQ71317.1| transcriptional regulator, MucR family [Sphingomonas wittichii RW1]
          Length = 183

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 65/141 (46%), Positives = 90/141 (63%), Gaps = 6/141 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D +  DS+   + +T DIVAA+V+N+ V +AD+ SLI +VH AL  +       +   
Sbjct: 20  MSDVSENDST--LITLTADIVAAHVTNNSVAVADLPSLIQNVHGALSNLGK----SETAP 73

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
             + +PAV +R S++   + CLEDG + K LKRHL TH+ MTP +YR KWNL +DYPMV+
Sbjct: 74  ETKQEPAVSVRASVKPDYIVCLEDGKKLKMLKRHLMTHYQMTPADYRSKWNLPADYPMVA 133

Query: 121 REYATTRSKLAKNMGLGRGRK 141
             YA  R  LAK++GLGR  K
Sbjct: 134 PNYAEQRRTLAKSIGLGRKPK 154


>gi|23014654|ref|ZP_00054459.1| hypothetical protein Magn03009102 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 151

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 84/140 (60%), Gaps = 4/140 (2%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M D ++   + +  L M VD+VAAYV  + VP   +  LI  V+ +L  +    P     
Sbjct: 1   MSDINSDKTNRDDLLRMAVDVVAAYVGKNPVPAGQLPELINTVYGSLSSLEGGQP---EA 57

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           + E  KPA+ ++KS+    + CLEDG + K LKRHL+T +NMTPDEYR+KW L  DYPMV
Sbjct: 58  KSEAPKPAIAVKKSVTPDYIICLEDGKKLKMLKRHLRTTYNMTPDEYRVKWGLPPDYPMV 117

Query: 120 SREYATTRSKLAKNMGLGRG 139
           +  YA  RS  AK +GLGR 
Sbjct: 118 APNYAAQRSDFAKKIGLGRK 137


>gi|312112925|ref|YP_004010521.1| MucR family transcriptional regulator [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311218054|gb|ADP69422.1| transcriptional regulator, MucR family [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 137

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 71/139 (51%), Positives = 95/139 (68%), Gaps = 4/139 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D  F+++E  ++ T  IV+AYVSN+ V   D+ SLI +VHSAL R  S       V  E 
Sbjct: 3   DEKFENNE-LVDFTTQIVSAYVSNNAVVAGDLPSLIGEVHSALTRASSNVVI---VPKEE 58

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           LKPAV ++KS+    + CLEDG +FKSLKRHL+TH+NM+P+EYR KW L  +YPMV+ +Y
Sbjct: 59  LKPAVAVKKSLTPDYIICLEDGKKFKSLKRHLRTHYNMSPEEYREKWGLEPNYPMVAPKY 118

Query: 124 ATTRSKLAKNMGLGRGRKK 142
           A  RS LAK MGLG+ + +
Sbjct: 119 AEARSNLAKKMGLGQRKGR 137


>gi|23015409|ref|ZP_00055186.1| hypothetical protein Magn03009849 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 139

 Score =  201 bits (513), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 65/139 (46%), Positives = 89/139 (64%), Gaps = 5/139 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
            +S   L +T +IVAA+V+N+ V +AD+  LI +V+  L  V S         PER +PA
Sbjct: 5   SNSGDLLGLTTEIVAAHVANNSVAVADLPHLIQEVYRTLASVGS-----APAAPERPQPA 59

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V ++KS+    + CLEDG + K LKRHLKT +NM+P+EYR +W L +DYPMV+  YA  R
Sbjct: 60  VNVKKSVTPDYIICLEDGKKLKMLKRHLKTAYNMSPEEYRDRWGLPADYPMVAPNYAQHR 119

Query: 128 SKLAKNMGLGRGRKKRVLT 146
           S LAK +GLG   +KR  T
Sbjct: 120 SSLAKKIGLGTKPRKRKRT 138


>gi|209964646|ref|YP_002297561.1| transcriptional regulatory protein MucR [Rhodospirillum centenum
           SW]
 gi|209958112|gb|ACI98748.1| transcriptional regulatory protein MucR [Rhodospirillum centenum
           SW]
          Length = 147

 Score =  201 bits (512), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 63/146 (43%), Positives = 85/146 (58%), Gaps = 4/146 (2%)

Query: 1   MDDDASFDSS-ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M D  + D      L MT +IV+AYV  + +P   I  +I  V+S+L  +          
Sbjct: 1   MTDQQANDIPVSDLLRMTAEIVSAYVGKNTLPTQQIPEVINTVYSSLNGLQG---AGRET 57

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           Q E  +PAVPI+KS+    + CLEDG + K LKRHL++ +NMTPDEYR+KW L  DYPMV
Sbjct: 58  QAEPPRPAVPIKKSVTPEYIVCLEDGKKLKMLKRHLRSTYNMTPDEYRVKWGLPPDYPMV 117

Query: 120 SREYATTRSKLAKNMGLGRGRKKRVL 145
           +  YA  RS  AK +GLGR   ++  
Sbjct: 118 APNYAAQRSDFAKKIGLGRSSTRQAR 143


>gi|220926349|ref|YP_002501651.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219950956|gb|ACL61348.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 166

 Score =  201 bits (512), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 64/149 (42%), Positives = 90/149 (60%), Gaps = 6/149 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +D    S    +E T DIV+AYVSN+ VP +++  LI  VH +L ++V+ A      +
Sbjct: 1   MTND-DPTSPLDLIEFTADIVSAYVSNNSVPASEVAGLIGSVHGSLMQLVAPA----EPE 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+L P VPI+K++    +  LEDG  +K+LKRHL     +TP++YR KW L  DYPMV+
Sbjct: 56  PEKLTPPVPIKKTVTPDHIISLEDGKPYKTLKRHL-AGRGLTPEQYRQKWGLPPDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSKV 149
             YA  RS+LAK  GLG+ R+ R      
Sbjct: 115 ANYAAQRSELAKTSGLGQSRRMRSAARSA 143


>gi|153010016|ref|YP_001371231.1| MucR family transcriptional regulator [Ochrobactrum anthropi ATCC
           49188]
 gi|151561904|gb|ABS15402.1| transcriptional regulator, MucR family [Ochrobactrum anthropi ATCC
           49188]
          Length = 142

 Score =  201 bits (512), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 70/142 (49%), Positives = 96/142 (67%), Gaps = 3/142 (2%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M++ D   +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R      V
Sbjct: 1   MENLDTHDESAELLLSLTADVVAAYVGNNSIRAGELPLLIAEVHAAFKRHVEREEAPVVV 60

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E+ KPAV  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV
Sbjct: 61  --EKPKPAVNPKKSVHDDYIICLEDGKKFKSLKRHLMTHYNMTPEQYREKWDLDPNYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRK 141
           +  YA  RS+LAK MGLGR  K
Sbjct: 119 APNYAAARSRLAKKMGLGRKPK 140


>gi|323136748|ref|ZP_08071829.1| transcriptional regulator, MucR family [Methylocystis sp. ATCC
           49242]
 gi|322398065|gb|EFY00586.1| transcriptional regulator, MucR family [Methylocystis sp. ATCC
           49242]
          Length = 148

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 65/145 (44%), Positives = 95/145 (65%), Gaps = 2/145 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M DD S + +    E   +IV+AYVSN+ +P +++ +L+  VH++L R+ S      +  
Sbjct: 1   MADDNSPEHAASL-EYAAEIVSAYVSNNSLPASELPALLQSVHASLVRLASGQVTAVDTT 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
             + +PAVPI+KS+    + CLEDG +FKSLKRHL++ +++TPD+YR KW L SDYPMV+
Sbjct: 60  TPK-EPAVPIKKSVTPDFIICLEDGKKFKSLKRHLRSAYSLTPDQYRAKWGLPSDYPMVA 118

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA TRS+LA  MGLG+   K   
Sbjct: 119 PNYAKTRSELAVQMGLGQKSSKSGA 143


>gi|239831431|ref|ZP_04679760.1| Transcriptional regulatory protein rosAr [Ochrobactrum intermedium
           LMG 3301]
 gi|239823698|gb|EEQ95266.1| Transcriptional regulatory protein rosAr [Ochrobactrum intermedium
           LMG 3301]
          Length = 142

 Score =  201 bits (512), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 70/143 (48%), Positives = 97/143 (67%), Gaps = 3/143 (2%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M++ D   +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R      V
Sbjct: 1   MENLDTHDESAELLLSLTADVVAAYVGNNSIRAGELPLLIAEVHAAFKRHVEREEAPVVV 60

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E+ KPAV  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV
Sbjct: 61  --EKPKPAVNPKKSVHDDYIICLEDGKKFKSLKRHLMTHYNMTPEQYREKWDLDPNYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRKK 142
           +  YA  RS+LAK MGLGR  K+
Sbjct: 119 APNYAAARSRLAKKMGLGRKPKE 141


>gi|154246181|ref|YP_001417139.1| MucR family transcriptional regulator [Xanthobacter autotrophicus
           Py2]
 gi|154160266|gb|ABS67482.1| transcriptional regulator, MucR family [Xanthobacter autotrophicus
           Py2]
          Length = 154

 Score =  201 bits (511), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 67/149 (44%), Positives = 95/149 (63%), Gaps = 4/149 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+ + +   +   L++ VDIVAA+V N+ VP+ ++ +LI  V + L ++ + A       
Sbjct: 1   MNLEDNETRTSVHLDLVVDIVAAFVGNNTVPVGELPALIASVSTTLGQLDAPAAA----P 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E LKPAVP++KS+    + CLEDG  FKSLKRHL+T ++MTP+ YR KW L  DYPMV+
Sbjct: 57  VEELKPAVPVKKSVTADFIVCLEDGKNFKSLKRHLRTAYDMTPEAYREKWGLPHDYPMVA 116

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSKV 149
             YA  RS+LAK MGLG+ RK+     K 
Sbjct: 117 PSYAAARSELAKTMGLGQARKQAAPEKKA 145


>gi|319408238|emb|CBI81891.1| transcriptional regulator [Bartonella schoenbuchensis R1]
          Length = 145

 Score =  201 bits (511), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 68/144 (47%), Positives = 92/144 (63%), Gaps = 3/144 (2%)

Query: 1   MDDDASFDSSERF-LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M+     ++     + +  DIVAAYVSN+ +   ++  LI DVH+A  +V + A  +  V
Sbjct: 1   MEHHPVLETESNLVITLVADIVAAYVSNNSIRPTEVPGLIADVHAAFLKVGNAASAEAGV 60

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E+ +PAV  ++SI    L CLEDG +FKSLKRHL TH+ M+P+EYR KW L S YPMV
Sbjct: 61  --EKQRPAVNPKRSIFPDYLICLEDGKKFKSLKRHLMTHYKMSPEEYREKWQLDSSYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRKKR 143
           +  YA  RS LAK MGLGR R+K+
Sbjct: 119 APNYAKARSNLAKEMGLGRKRQKK 142


>gi|288957848|ref|YP_003448189.1| transcriptional regulatory protein [Azospirillum sp. B510]
 gi|288910156|dbj|BAI71645.1| transcriptional regulatory protein [Azospirillum sp. B510]
          Length = 147

 Score =  201 bits (511), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 70/150 (46%), Positives = 91/150 (60%), Gaps = 6/150 (4%)

Query: 1   MDDDASFDSSER-FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M D    D  +   L MT DIV+AYVS +V+P   I  +I  V+S+L  +  +      V
Sbjct: 1   MSDQLRADGPDNALLRMTADIVSAYVSKNVLPAQQIPDVINTVYSSLTGLNGQ---PREV 57

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E LKPAVPIRKS+    + CLEDG + K LKRHL++ +NM+PDEYR +W L  DYPMV
Sbjct: 58  AAEPLKPAVPIRKSVTPEYIVCLEDGKKLKMLKRHLRSTYNMSPDEYRARWGLPPDYPMV 117

Query: 120 SREYATTRSKLAKNMGLGR--GRKKRVLTS 147
           +  YA  RS+ AK +GLGR  GR+ R    
Sbjct: 118 APNYAAQRSEFAKRIGLGRSSGRQTRRKAG 147


>gi|296537251|ref|ZP_06899148.1| transcriptional regulator [Roseomonas cervicalis ATCC 49957]
 gi|296262420|gb|EFH09148.1| transcriptional regulator [Roseomonas cervicalis ATCC 49957]
          Length = 147

 Score =  201 bits (511), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 68/141 (48%), Positives = 91/141 (64%), Gaps = 4/141 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++         L +T  IVAA+VSN+ VP+ D+ SLI  VH  L  + S AP   +V 
Sbjct: 1   MSEEQG---GRELLGLTAQIVAAHVSNNSVPLTDVPSLIEQVHRTLSGLGS-APVAASVP 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            ER +PAVP++KS+ +  L CLEDG + K LKRHLKT ++MTP++YR +W L SDYPMV+
Sbjct: 57  AERPQPAVPVKKSVTDEYLVCLEDGKKLKMLKRHLKTAYDMTPEQYRERWGLPSDYPMVA 116

Query: 121 REYATTRSKLAKNMGLGRGRK 141
             YA  RS LAK +GLG   +
Sbjct: 117 PNYAKHRSSLAKRIGLGTKPR 137


>gi|170742543|ref|YP_001771198.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168196817|gb|ACA18764.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 145

 Score =  201 bits (511), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 68/132 (51%), Positives = 91/132 (68%), Gaps = 3/132 (2%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           +  ++S  ++E+  DIV+A+VS + VPMAD+ +LI  VH  L R+          +PE L
Sbjct: 2   SESEASTDYIELAADIVSAFVSKNSVPMADLPALIASVHETLGRLGKD---PAEEKPEPL 58

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
            PAVPI+KSI    L CLEDG +FKSLKRHL++ + +TP+EYR +WNLA DYPMV+  YA
Sbjct: 59  TPAVPIKKSITPDYLICLEDGKKFKSLKRHLRSRYGLTPEEYRARWNLAPDYPMVAPNYA 118

Query: 125 TTRSKLAKNMGL 136
             RS+LAK MGL
Sbjct: 119 AARSELAKTMGL 130


>gi|83313558|ref|YP_423822.1| transcriptional regulatory protein Ros [Magnetospirillum magneticum
           AMB-1]
 gi|82948399|dbj|BAE53263.1| Transcriptional regulatory protein ros [Magnetospirillum magneticum
           AMB-1]
          Length = 139

 Score =  200 bits (510), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 64/139 (46%), Positives = 88/139 (63%), Gaps = 5/139 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
            +S   L +T +IVAA+V+N+ V +AD+  LI +V+  L  V S         PER +PA
Sbjct: 5   SNSGDLLGLTTEIVAAHVANNSVAVADLPHLIQEVYRTLASVGS-----VPAAPERPQPA 59

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V ++KS+    + CLEDG + K LKRHLKT +NM+P+EYR +W L +DYPMV+  YA  R
Sbjct: 60  VNVKKSVTPDYIICLEDGKKLKMLKRHLKTAYNMSPEEYRDRWGLPADYPMVAPNYAQHR 119

Query: 128 SKLAKNMGLGRGRKKRVLT 146
           S LAK +GLG   +KR   
Sbjct: 120 SSLAKKIGLGTKPRKRKRA 138


>gi|306842160|ref|ZP_07474829.1| Ros/MucR family transcriptional regulator [Brucella sp. BO2]
 gi|306287747|gb|EFM59178.1| Ros/MucR family transcriptional regulator [Brucella sp. BO2]
          Length = 142

 Score =  200 bits (510), Expect = 4e-50,   Method: Composition-based stats.
 Identities = 69/142 (48%), Positives = 96/142 (67%), Gaps = 3/142 (2%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M++ + + +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R      V
Sbjct: 1   MENLETNDESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVHAAFKRHVEREEAPVVV 60

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E+ KPAV  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV
Sbjct: 61  --EKPKPAVNPKKSVHDDYIVCLEDGKKFKSLKRHLMTHYNMTPEQYREKWDLDPNYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRK 141
           +  YA  RS LAK MGLGR  K
Sbjct: 119 APNYAAARSHLAKKMGLGRKPK 140


>gi|23501458|ref|NP_697585.1| Ros/MucR family transcriptional regulator [Brucella suis 1330]
 gi|161618545|ref|YP_001592432.1| transcriptional regulatory protein rosAr [Brucella canis ATCC
           23365]
 gi|163842848|ref|YP_001627252.1| transcriptional regulatory protein rosAr [Brucella suis ATCC 23445]
 gi|225627077|ref|ZP_03785115.1| Transcriptional regulatory protein rosAr [Brucella ceti str. Cudo]
 gi|254701365|ref|ZP_05163193.1| transcriptional regulatory protein rosAr [Brucella suis bv. 5 str.
           513]
 gi|254703910|ref|ZP_05165738.1| transcriptional regulatory protein rosAr [Brucella suis bv. 3 str.
           686]
 gi|254707714|ref|ZP_05169542.1| transcriptional regulatory protein rosAr [Brucella pinnipedialis
           M163/99/10]
 gi|254709704|ref|ZP_05171515.1| transcriptional regulatory protein rosAr [Brucella pinnipedialis
           B2/94]
 gi|254712874|ref|ZP_05174685.1| transcriptional regulatory protein rosAr [Brucella ceti M644/93/1]
 gi|254716772|ref|ZP_05178583.1| transcriptional regulatory protein rosAr [Brucella ceti M13/05/1]
 gi|254718721|ref|ZP_05180532.1| transcriptional regulatory protein rosAr [Brucella sp. 83/13]
 gi|256031195|ref|ZP_05444809.1| transcriptional regulatory protein rosAr [Brucella pinnipedialis
           M292/94/1]
 gi|256060702|ref|ZP_05450866.1| transcriptional regulatory protein rosAr [Brucella neotomae 5K33]
 gi|256159292|ref|ZP_05457087.1| transcriptional regulatory protein rosAr [Brucella ceti M490/95/1]
 gi|256254602|ref|ZP_05460138.1| transcriptional regulatory protein rosAr [Brucella ceti B1/94]
 gi|256369009|ref|YP_003106517.1| transcriptional regulator, Ros/MucR family [Brucella microti CCM
           4915]
 gi|260168330|ref|ZP_05755141.1| transcriptional regulator, Ros/MucR family protein [Brucella sp.
           F5/99]
 gi|260566841|ref|ZP_05837311.1| transcriptional regulatory protein MucR [Brucella suis bv. 4 str.
           40]
 gi|261218569|ref|ZP_05932850.1| transcriptional regulator [Brucella ceti M13/05/1]
 gi|261221777|ref|ZP_05936058.1| transcriptional regulator [Brucella ceti B1/94]
 gi|261315208|ref|ZP_05954405.1| transcriptional regulator [Brucella pinnipedialis M163/99/10]
 gi|261317235|ref|ZP_05956432.1| transcriptional regulator [Brucella pinnipedialis B2/94]
 gi|261320582|ref|ZP_05959779.1| transcriptional regulator [Brucella ceti M644/93/1]
 gi|261324693|ref|ZP_05963890.1| transcriptional regulator [Brucella neotomae 5K33]
 gi|261751903|ref|ZP_05995612.1| transcriptional regulator [Brucella suis bv. 5 str. 513]
 gi|261754561|ref|ZP_05998270.1| transcriptional regulator [Brucella suis bv. 3 str. 686]
 gi|261757791|ref|ZP_06001500.1| transcriptional regulatory protein MucR [Brucella sp. F5/99]
 gi|265983697|ref|ZP_06096432.1| transcriptional regulator [Brucella sp. 83/13]
 gi|265988274|ref|ZP_06100831.1| transcriptional regulator [Brucella pinnipedialis M292/94/1]
 gi|265997741|ref|ZP_06110298.1| transcriptional regulator [Brucella ceti M490/95/1]
 gi|306838698|ref|ZP_07471533.1| Ros/MucR family transcriptional regulator [Brucella sp. NF 2653]
 gi|23347361|gb|AAN29500.1| transcriptional regulator, Ros/MucR family [Brucella suis 1330]
 gi|161335356|gb|ABX61661.1| Transcriptional regulatory protein rosAr [Brucella canis ATCC
           23365]
 gi|163673571|gb|ABY37682.1| Transcriptional regulatory protein rosAr [Brucella suis ATCC 23445]
 gi|225617912|gb|EEH14956.1| Transcriptional regulatory protein rosAr [Brucella ceti str. Cudo]
 gi|255999169|gb|ACU47568.1| transcriptional regulator, Ros/MucR family [Brucella microti CCM
           4915]
 gi|260156359|gb|EEW91439.1| transcriptional regulatory protein MucR [Brucella suis bv. 4 str.
           40]
 gi|260920361|gb|EEX87014.1| transcriptional regulator [Brucella ceti B1/94]
 gi|260923658|gb|EEX90226.1| transcriptional regulator [Brucella ceti M13/05/1]
 gi|261293272|gb|EEX96768.1| transcriptional regulator [Brucella ceti M644/93/1]
 gi|261296458|gb|EEX99954.1| transcriptional regulator [Brucella pinnipedialis B2/94]
 gi|261300673|gb|EEY04170.1| transcriptional regulator [Brucella neotomae 5K33]
 gi|261304234|gb|EEY07731.1| transcriptional regulator [Brucella pinnipedialis M163/99/10]
 gi|261737775|gb|EEY25771.1| transcriptional regulatory protein MucR [Brucella sp. F5/99]
 gi|261741656|gb|EEY29582.1| transcriptional regulator [Brucella suis bv. 5 str. 513]
 gi|261744314|gb|EEY32240.1| transcriptional regulator [Brucella suis bv. 3 str. 686]
 gi|262552209|gb|EEZ08199.1| transcriptional regulator [Brucella ceti M490/95/1]
 gi|264660471|gb|EEZ30732.1| transcriptional regulator [Brucella pinnipedialis M292/94/1]
 gi|264662289|gb|EEZ32550.1| transcriptional regulator [Brucella sp. 83/13]
 gi|306406185|gb|EFM62429.1| Ros/MucR family transcriptional regulator [Brucella sp. NF 2653]
          Length = 142

 Score =  200 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 69/142 (48%), Positives = 97/142 (68%), Gaps = 3/142 (2%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M++ + + +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R      V
Sbjct: 1   MENLETNDESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVHAAFKRHVEREEAPVVV 60

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E+ KPAV  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV
Sbjct: 61  --EKPKPAVNPKKSVHDDYIVCLEDGKKFKSLKRHLMTHYNMTPEQYREKWDLDPNYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRK 141
           +  YA  RS+LAK MGLGR  K
Sbjct: 119 APNYAAARSRLAKKMGLGRKPK 140


>gi|329888153|ref|ZP_08266751.1| transcriptional regulatory protein ros [Brevundimonas diminuta ATCC
           11568]
 gi|328846709|gb|EGF96271.1| transcriptional regulatory protein ros [Brevundimonas diminuta ATCC
           11568]
          Length = 142

 Score =  200 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 68/142 (47%), Positives = 86/142 (60%), Gaps = 3/142 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            +     LEMT DIV+AYVSN+ V    +  LI  +H+AL  V       +    E    
Sbjct: 3   MEEKPELLEMTADIVSAYVSNNTVSADAVPGLIAQIHAALSGVSVAPVEPEPEPQEPAV- 61

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
             P+RKSI    L CLEDG +FKSLKRHL+T +NM+P+EYR KW L  DYPMV+  YA  
Sbjct: 62  --PVRKSITPDFLICLEDGRKFKSLKRHLRTKYNMSPEEYRAKWGLPKDYPMVAPNYAKA 119

Query: 127 RSKLAKNMGLGRGRKKRVLTSK 148
           RS+LAK MGLG+G +K    S+
Sbjct: 120 RSELAKQMGLGQGGRKPARASR 141


>gi|209965886|ref|YP_002298801.1| transcriptional regulatory protein MucR [Rhodospirillum centenum
           SW]
 gi|209959352|gb|ACI99988.1| transcriptional regulatory protein MucR [Rhodospirillum centenum
           SW]
          Length = 139

 Score =  200 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 63/141 (44%), Positives = 88/141 (62%), Gaps = 4/141 (2%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
            S   S   L +T +IVAA+VSN+ V ++D+ SLI  V+  L  V      +   Q E+ 
Sbjct: 2   TSASPSNELLSLTTEIVAAHVSNNTVAISDLPSLIEQVYRTLSTVGQ----EPVPQAEKP 57

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAV I+KS+    + CLEDG + K LKRHLKT +NM+P+EYR +W L +DYPMV+  YA
Sbjct: 58  QPAVAIKKSVTPDYIVCLEDGKKLKMLKRHLKTAYNMSPEEYRDRWGLPADYPMVAPNYA 117

Query: 125 TTRSKLAKNMGLGRGRKKRVL 145
             RS+LAK +GLG   ++   
Sbjct: 118 KQRSRLAKQIGLGTRARRSAA 138


>gi|306845184|ref|ZP_07477760.1| Ros/MucR family transcriptional regulator [Brucella sp. BO1]
 gi|306274343|gb|EFM56150.1| Ros/MucR family transcriptional regulator [Brucella sp. BO1]
          Length = 142

 Score =  200 bits (510), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 69/142 (48%), Positives = 97/142 (68%), Gaps = 3/142 (2%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M++ + + +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R      V
Sbjct: 1   MENLETNDESTELLLSLTADVVAAYVGNNSIRTGELPVLIAEVHAAFKRHVEREEAPVVV 60

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E+ KPAV  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV
Sbjct: 61  --EKPKPAVNPKKSVHDDYIVCLEDGKKFKSLKRHLMTHYNMTPEQYREKWDLDPNYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRK 141
           +  YA  RS+LAK MGLGR  K
Sbjct: 119 APNYAAARSRLAKKMGLGRKPK 140


>gi|62289537|ref|YP_221330.1| transcriptional regulator [Brucella abortus bv. 1 str. 9-941]
 gi|82699466|ref|YP_414040.1| transcriptional regulatory protein MucR [Brucella melitensis biovar
           Abortus 2308]
 gi|189023794|ref|YP_001934562.1| MucR family transcriptional regulator [Brucella abortus S19]
 gi|225852099|ref|YP_002732332.1| transcriptional regulator RosAr [Brucella melitensis ATCC 23457]
 gi|237815034|ref|ZP_04594032.1| Transcriptional regulatory protein rosAr [Brucella abortus str.
           2308 A]
 gi|254688855|ref|ZP_05152109.1| transcriptional regulatory protein MUCR [Brucella abortus bv. 6
           str. 870]
 gi|254693337|ref|ZP_05155165.1| transcriptional regulatory protein MUCR [Brucella abortus bv. 3
           str. Tulya]
 gi|254696985|ref|ZP_05158813.1| transcriptional regulatory protein MUCR [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254729887|ref|ZP_05188465.1| transcriptional regulatory protein MUCR [Brucella abortus bv. 4
           str. 292]
 gi|256044279|ref|ZP_05447183.1| transcriptional regulatory protein MUCR [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256113112|ref|ZP_05453989.1| transcriptional regulatory protein MUCR [Brucella melitensis bv. 3
           str. Ether]
 gi|256257103|ref|ZP_05462639.1| transcriptional regulatory protein MUCR [Brucella abortus bv. 9
           str. C68]
 gi|256264391|ref|ZP_05466923.1| transcriptional regulatory protein MucR [Brucella melitensis bv. 2
           str. 63/9]
 gi|260545706|ref|ZP_05821447.1| transcriptional regulatory protein MucR [Brucella abortus NCTC
           8038]
 gi|260563633|ref|ZP_05834119.1| transcriptional regulatory protein MucR [Brucella melitensis bv. 1
           str. 16M]
 gi|260754339|ref|ZP_05866687.1| transcriptional regulator [Brucella abortus bv. 6 str. 870]
 gi|260757558|ref|ZP_05869906.1| transcriptional regulator [Brucella abortus bv. 4 str. 292]
 gi|260761383|ref|ZP_05873726.1| transcriptional regulator [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883364|ref|ZP_05894978.1| transcriptional regulator [Brucella abortus bv. 9 str. C68]
 gi|261213585|ref|ZP_05927866.1| transcriptional regulator [Brucella abortus bv. 3 str. Tulya]
 gi|265990690|ref|ZP_06103247.1| transcriptional regulator [Brucella melitensis bv. 1 str. Rev.1]
 gi|265994522|ref|ZP_06107079.1| transcriptional regulator [Brucella melitensis bv. 3 str. Ether]
 gi|297247950|ref|ZP_06931668.1| transcriptional regulatory protein rosAr [Brucella abortus bv. 5
           str. B3196]
 gi|62195669|gb|AAX73969.1| transcriptional regulator [Brucella abortus bv. 1 str. 9-941]
 gi|82615567|emb|CAJ10550.1| transcriptional regulatory protein MucR [Brucella melitensis biovar
           Abortus 2308]
 gi|189019366|gb|ACD72088.1| transcriptional regulatory protein MucR [Brucella abortus S19]
 gi|225640464|gb|ACO00378.1| Transcriptional regulatory protein rosAr [Brucella melitensis ATCC
           23457]
 gi|237789871|gb|EEP64081.1| Transcriptional regulatory protein rosAr [Brucella abortus str.
           2308 A]
 gi|260097113|gb|EEW80988.1| transcriptional regulatory protein MucR [Brucella abortus NCTC
           8038]
 gi|260153649|gb|EEW88741.1| transcriptional regulatory protein MucR [Brucella melitensis bv. 1
           str. 16M]
 gi|260667876|gb|EEX54816.1| transcriptional regulator [Brucella abortus bv. 4 str. 292]
 gi|260671815|gb|EEX58636.1| transcriptional regulator [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674447|gb|EEX61268.1| transcriptional regulator [Brucella abortus bv. 6 str. 870]
 gi|260872892|gb|EEX79961.1| transcriptional regulator [Brucella abortus bv. 9 str. C68]
 gi|260915192|gb|EEX82053.1| transcriptional regulator [Brucella abortus bv. 3 str. Tulya]
 gi|262765635|gb|EEZ11424.1| transcriptional regulator [Brucella melitensis bv. 3 str. Ether]
 gi|263001474|gb|EEZ14049.1| transcriptional regulator [Brucella melitensis bv. 1 str. Rev.1]
 gi|263094685|gb|EEZ18464.1| transcriptional regulatory protein MucR [Brucella melitensis bv. 2
           str. 63/9]
 gi|297175119|gb|EFH34466.1| transcriptional regulatory protein rosAr [Brucella abortus bv. 5
           str. B3196]
 gi|326408594|gb|ADZ65659.1| transcriptional regulatory protein MucR [Brucella melitensis M28]
 gi|326538314|gb|ADZ86529.1| transcriptional regulatory protein rosAr [Brucella melitensis
           M5-90]
          Length = 142

 Score =  200 bits (509), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 69/142 (48%), Positives = 97/142 (68%), Gaps = 3/142 (2%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M++ + + +S+E  L +T D+VAAYV N+ +   ++  LI +VH+A +R V R      V
Sbjct: 1   MENLETNDESTELLLSLTADVVAAYVGNNSIRAGELPVLIAEVHAAFKRHVEREEAPVVV 60

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             E+ KPAV  +KS+ +  + CLEDG +FKSLKRHL TH+NMTP++YR KW+L  +YPMV
Sbjct: 61  --EKPKPAVNPKKSVHDDYIVCLEDGKKFKSLKRHLVTHYNMTPEQYREKWDLDPNYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRK 141
           +  YA  RS+LAK MGLGR  K
Sbjct: 119 APNYAAARSRLAKKMGLGRKPK 140


>gi|240138488|ref|YP_002962960.1| hypothetical protein MexAM1_META1p1841 [Methylobacterium extorquens
           AM1]
 gi|240008457|gb|ACS39683.1| conserved hypothetical protein [Methylobacterium extorquens AM1]
          Length = 170

 Score =  200 bits (509), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 64/145 (44%), Positives = 93/145 (64%), Gaps = 4/145 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+  A+   S   +E+T ++++AYV+ + VP A +  LI  VH AL+ +  +        
Sbjct: 4   MNQTATL-GSPNLIELTAEVISAYVTQNSVPTAQLPELIAVVHGALKMLGEQ---PSEPA 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            + L+PAVPI+ SI    L CLEDG +FKSL+RHL + + MTPD+YR KW+L  DYPMV+
Sbjct: 60  SQELRPAVPIKTSITPDFLICLEDGRRFKSLRRHLSSKYGMTPDQYRAKWSLPKDYPMVA 119

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA  RS+LA+ MGLG+ R+K+  
Sbjct: 120 PNYAAARSELARRMGLGQIRRKKAP 144


>gi|13488144|ref|NP_085846.1| transcriptional regulatory protein [Mesorhizobium loti MAFF303099]
 gi|14028095|dbj|BAB54687.1| transcriptional regulatory protein [Mesorhizobium loti MAFF303099]
          Length = 156

 Score =  200 bits (509), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 82/139 (58%), Gaps = 5/139 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +++   ++E   E+T +IV+AYVS + +P   +  LI  VH +L  + +         
Sbjct: 1   MTEESDHRAAE-LAELTAEIVSAYVSKNPLPATGLPELIASVHMSLSGLGTPTAPV---- 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E   PAV  +KS+    + CLEDG +FKSLKRHL T   +TPD YR KW L  DYPM +
Sbjct: 56  VEPQTPAVNPKKSVTPDFIICLEDGKKFKSLKRHLSTDFGLTPDAYREKWGLPRDYPMTA 115

Query: 121 REYATTRSKLAKNMGLGRG 139
             YA  RS+LAK++GLGR 
Sbjct: 116 PNYAAQRSQLAKSIGLGRK 134


>gi|188584498|ref|YP_001927943.1| MucR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179347996|gb|ACB83408.1| transcriptional regulator, MucR family [Methylobacterium populi
           BJ001]
          Length = 171

 Score =  199 bits (507), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 94/135 (69%), Gaps = 3/135 (2%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           DS+   + + VDIV+AYV N+ + + ++  LIT VH AL ++ ++       +   L PA
Sbjct: 6   DSAGDHVGLVVDIVSAYVGNNSLAVGELPGLITAVHGALAQLSNK---PAEPEEPPLVPA 62

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V IR+SI+   L CLEDG +FKSLKRHL+T +N++PDEYR +WNL  DYPMV+  YA TR
Sbjct: 63  VSIRRSIQQDFLICLEDGKKFKSLKRHLRTRYNLSPDEYRARWNLPDDYPMVAPSYAATR 122

Query: 128 SKLAKNMGLGRGRKK 142
           S+LA+ MGLG+ R+K
Sbjct: 123 SELARTMGLGQQRRK 137


>gi|83311436|ref|YP_421700.1| transcriptional regulator [Magnetospirillum magneticum AMB-1]
 gi|82946277|dbj|BAE51141.1| Predicted transcriptional regulator [Magnetospirillum magneticum
           AMB-1]
          Length = 151

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 61/140 (43%), Positives = 84/140 (60%), Gaps = 4/140 (2%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M D ++   + +  L M VD+VAAYV  + VP   +  LI  V+ +L  +    P     
Sbjct: 1   MSDINSDKTNRDDLLRMAVDVVAAYVGKNPVPAGQLPELINTVYGSLSSLEGGQP---EA 57

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           + E  KPA+ +++S+    + CLEDG + K LKRHL+T +NMTPDEYR+KW L  DYPMV
Sbjct: 58  KSEAPKPAIAVKRSVTPDYIICLEDGKKLKMLKRHLRTTYNMTPDEYRMKWGLPPDYPMV 117

Query: 120 SREYATTRSKLAKNMGLGRG 139
           +  YA  RS  AK +GLGR 
Sbjct: 118 APNYAAQRSDFAKKIGLGRK 137


>gi|299133488|ref|ZP_07026682.1| transcriptional regulator, MucR family [Afipia sp. 1NLS2]
 gi|298591324|gb|EFI51525.1| transcriptional regulator, MucR family [Afipia sp. 1NLS2]
          Length = 137

 Score =  199 bits (506), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 67/137 (48%), Positives = 94/137 (68%), Gaps = 4/137 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S  + + F+EM   IV+AYVSN+ V  +DI +LI  VH+AL RV +      +   E  +
Sbjct: 2   SEPAGKNFVEMAAGIVSAYVSNNTVQPSDIPALIAQVHAALLRVATGG----DAPVEAAR 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAV ++KS+ +  L CLEDG +FKSLKRHL++ +NM+P++YR KW L  DYPMV+  YA 
Sbjct: 58  PAVSVKKSMTSEYLVCLEDGKRFKSLKRHLRSQYNMSPEQYRKKWGLPPDYPMVAPNYAV 117

Query: 126 TRSKLAKNMGLGRGRKK 142
            RS+LAK MGLG+ R++
Sbjct: 118 ARSQLAKKMGLGQQRRR 134


>gi|315500765|ref|YP_004089566.1| transcriptional regulator, MucR family [Asticcacaulis excentricus
           CB 48]
 gi|315418777|gb|ADU15415.1| transcriptional regulator, MucR family [Asticcacaulis excentricus
           CB 48]
          Length = 146

 Score =  198 bits (505), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 65/143 (45%), Positives = 91/143 (63%), Gaps = 4/143 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            + +     +TV+IV+A+V N+ +P +++  LI  V+++L  + S  P    V+PE   P
Sbjct: 1   MEQNSTTTNLTVEIVSAFVGNNPLPASELPQLIQSVYTSLNSLSSAPP----VEPEARVP 56

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AV I+KS+    + CLEDG +FKSLKRHL + +N+TPDEYR KWNL  DYPMV+  YA  
Sbjct: 57  AVSIKKSVGADYIICLEDGRKFKSLKRHLASKYNLTPDEYRAKWNLPKDYPMVAPAYAEA 116

Query: 127 RSKLAKNMGLGRGRKKRVLTSKV 149
           RS LAK +GLG G +K      V
Sbjct: 117 RSHLAKQIGLGTGGRKAAPAKPV 139


>gi|296116411|ref|ZP_06835025.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295977004|gb|EFG83768.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 154

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 63/139 (45%), Positives = 88/139 (63%), Gaps = 8/139 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D    +    FLE+T  IV+A+VSN+ V    +  LI  V+ AL  +      Q  V+
Sbjct: 1   MSD---AEQDFSFLELTTQIVSAHVSNNAVGADTVPDLIKQVYQALTSLD-----QPQVE 52

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+L+PAVPI++S+    + CLEDG + K LKRHL++ + MTP++YR +W L SDYPMV+
Sbjct: 53  PEKLQPAVPIKRSVFPDYIVCLEDGKKLKMLKRHLQSAYGMTPEQYRERWGLPSDYPMVA 112

Query: 121 REYATTRSKLAKNMGLGRG 139
             YA  RS LA+ +GLGR 
Sbjct: 113 PNYAERRSTLAREIGLGRK 131


>gi|315499459|ref|YP_004088262.1| transcriptional regulator, mucr family [Asticcacaulis excentricus
           CB 48]
 gi|315417471|gb|ADU14111.1| transcriptional regulator, MucR family [Asticcacaulis excentricus
           CB 48]
          Length = 147

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 67/142 (47%), Positives = 87/142 (61%), Gaps = 4/142 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            +       + V+IV AYVSN+ VP A++  LI  V  AL  + S       V+PE   P
Sbjct: 1   MEQKTDTTNLVVEIVTAYVSNNSVPAAELPQLIQSVSGALNSLASG----PVVEPENKTP 56

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AV I+KS+    + CLEDG +FKSLKRHL + +N+TPDEYR +WNL  DYPMV+  YA  
Sbjct: 57  AVSIKKSVGTDYIICLEDGRRFKSLKRHLASKYNLTPDEYRARWNLPKDYPMVAPAYAEA 116

Query: 127 RSKLAKNMGLGRGRKKRVLTSK 148
           RS LAK MGLG+G +K    + 
Sbjct: 117 RSNLAKQMGLGQGGRKSTSQAA 138


>gi|144897819|emb|CAM74683.1| Transcriptional regulatory protein [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 181

 Score =  198 bits (505), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 85/140 (60%), Gaps = 4/140 (2%)

Query: 1   MDDDASFD-SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M D+ S   S +  L M VD+V+AYVSN+ +P   I  +I  V+++L  +          
Sbjct: 26  MTDNISDKISHDDILRMAVDVVSAYVSNNPLPAGQIPEIINTVYNSLAALDG---APVET 82

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           + E  KPA+ ++KS+    + CLEDG + K LKRHL+T ++MTPDEYR KW L  DYPMV
Sbjct: 83  KSEAPKPAISVKKSVHPDYIVCLEDGKKLKMLKRHLRTTYSMTPDEYRAKWGLPPDYPMV 142

Query: 120 SREYATTRSKLAKNMGLGRG 139
           +  YA  RS  AK +GLGR 
Sbjct: 143 APNYAAQRSDFAKKIGLGRK 162


>gi|115523885|ref|YP_780796.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           BisA53]
 gi|115517832|gb|ABJ05816.1| transcriptional regulator, MucR family [Rhodopseudomonas palustris
           BisA53]
          Length = 138

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 66/145 (45%), Positives = 92/145 (63%), Gaps = 7/145 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D A     + F+++T  IVAAYV N+  P A++  LI+ +H+AL R+ +         
Sbjct: 1   MTDSAG----KTFIDLTATIVAAYVGNNPTPAAELPGLISQIHAALVRISAGRAEPPPEP 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            +     V ++KS+ +  L CLEDG +FKSLKRHL+T +NMTP++YR KW L  DYPMV+
Sbjct: 57  AKPA---VSLKKSVTSDYLVCLEDGKRFKSLKRHLRTQYNMTPEQYREKWGLPPDYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA  RS+LAK MGLG+ RK+R  
Sbjct: 114 PNYAVARSQLAKKMGLGQQRKRRGK 138


>gi|167645322|ref|YP_001682985.1| MucR family transcriptional regulator [Caulobacter sp. K31]
 gi|167347752|gb|ABZ70487.1| transcriptional regulator, MucR family [Caulobacter sp. K31]
          Length = 141

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 61/142 (42%), Positives = 85/142 (59%), Gaps = 3/142 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            D     +E+T  +VAAYV  + +   DI  LI  VH +L  +  RA        E   P
Sbjct: 1   MDEQSDLIEVTASLVAAYVGGNTIAATDIPGLIRSVHKSLANLDGRAEASAEANRE---P 57

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AV +++SI    L CLEDG +FKSLKRHL+T ++++P++YR +W+L  DYPMV+  YA  
Sbjct: 58  AVSVKRSITPDYLICLEDGRKFKSLKRHLRTKYDLSPEQYRTRWDLPKDYPMVAPNYALA 117

Query: 127 RSKLAKNMGLGRGRKKRVLTSK 148
           RS LAK MGLG+G +K     +
Sbjct: 118 RSNLAKQMGLGQGGRKPARKPR 139


>gi|220924036|ref|YP_002499338.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948643|gb|ACL59035.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 141

 Score =  198 bits (504), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 61/132 (46%), Positives = 88/132 (66%), Gaps = 3/132 (2%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           +  ++   ++E+  DIV+A+VS + VP+ ++  LI  VH  L R+    P +   +P   
Sbjct: 2   SESEALAGYIELAADIVSAFVSKNPVPVGELPGLIASVHETLGRLGKD-PVEQKSEP--P 58

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
            PAVPIRKS+    L CLEDG +FKSLKRHL++ + ++P+EYR +WNL +DYPMV+  YA
Sbjct: 59  TPAVPIRKSVMPDYLVCLEDGKKFKSLKRHLRSRYGLSPEEYRERWNLPTDYPMVAPNYA 118

Query: 125 TTRSKLAKNMGL 136
             RS+LAK MGL
Sbjct: 119 AARSELAKTMGL 130


>gi|114327053|ref|YP_744210.1| transcriptional regulator [Granulibacter bethesdensis CGDNIH1]
 gi|114315227|gb|ABI61287.1| transcriptional regulator [Granulibacter bethesdensis CGDNIH1]
          Length = 138

 Score =  198 bits (503), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 58/139 (41%), Positives = 89/139 (64%), Gaps = 4/139 (2%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           ++ ++S   L +T  IV+A++SN+ +    +   I +V+ A+  +      ++ V  E+ 
Sbjct: 3   SNSEASADLLALTAQIVSAHISNNAIQTESLPGFIQEVYRAISNLGH----EEQVPVEKP 58

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVP+RKS+    + CLEDG + K LKRHLK+ +NMTP++YR +W L  DYPMV+ EYA
Sbjct: 59  QPAVPVRKSVFPNYIVCLEDGKKLKMLKRHLKSVYNMTPEQYRERWGLPPDYPMVAPEYA 118

Query: 125 TTRSKLAKNMGLGRGRKKR 143
           T RS LAK +GLG   + R
Sbjct: 119 THRSSLAKKIGLGTKPRVR 137


>gi|114799831|ref|YP_759467.1| Ros/MucR family transcriptional regulator [Hyphomonas neptunium
           ATCC 15444]
 gi|114740005|gb|ABI78130.1| transcriptional regulator, Ros/MucR family [Hyphomonas neptunium
           ATCC 15444]
          Length = 137

 Score =  197 bits (502), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 65/142 (45%), Positives = 93/142 (65%), Gaps = 6/142 (4%)

Query: 1   MDDDASFD-SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M ++ +    S  F+    +IVAAYV N+ V  +++  LI +VH +L  +    P     
Sbjct: 1   MSEEENASVRSSDFVVYATEIVAAYVRNNAVQTSELPDLIRNVHRSLLDLGGPVP----- 55

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           + E+ KPAV ++KSI +  L CLEDG++FKSLKRHL++ ++M+PDEYR KW L +DYPMV
Sbjct: 56  EAEKQKPAVTVKKSIHHDYLICLEDGLKFKSLKRHLRSKYDMSPDEYREKWGLPADYPMV 115

Query: 120 SREYATTRSKLAKNMGLGRGRK 141
           +  Y+  RSKLAK MGLGR  +
Sbjct: 116 APGYSAQRSKLAKKMGLGRQER 137


>gi|218533114|ref|YP_002423930.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218525417|gb|ACK86002.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 175

 Score =  197 bits (501), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 92/134 (68%), Gaps = 3/134 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+   + + VDIV+AYV N+ + + ++  LIT VH AL  + ++    +   P    PAV
Sbjct: 7   SAGDHVALVVDIVSAYVGNNSLAVGELPGLITSVHGALAHLSNKPSEPEEPAP---TPAV 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            IR+SI+   L CLEDG +FKSLKRHL+T +N++PDEYR +WNL  DYPMV+  YA TRS
Sbjct: 64  SIRRSIQQDFLICLEDGKKFKSLKRHLRTRYNLSPDEYRARWNLPDDYPMVAPSYAATRS 123

Query: 129 KLAKNMGLGRGRKK 142
           +LA+ MGLG+ R+K
Sbjct: 124 ELARTMGLGQQRRK 137


>gi|240141629|ref|YP_002966109.1| putative transcriptional regulator MucR [Methylobacterium
           extorquens AM1]
 gi|240011606|gb|ACS42832.1| Putative transcriptional regulator MucR [Methylobacterium
           extorquens AM1]
          Length = 175

 Score =  197 bits (501), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 92/134 (68%), Gaps = 3/134 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+   + + VDIV+AYV N+ + + ++  LIT VH AL  + ++    +   P    PAV
Sbjct: 7   SAGDHVALVVDIVSAYVGNNSLAVGELPGLITSVHGALAHLSNKPSEPEEPAP---TPAV 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            IR+SI+   L CLEDG +FKSLKRHL+T +N++PDEYR +WNL  DYPMV+  YA TRS
Sbjct: 64  SIRRSIQQDFLICLEDGKKFKSLKRHLRTRYNLSPDEYRARWNLPDDYPMVAPSYAATRS 123

Query: 129 KLAKNMGLGRGRKK 142
           +LA+ MGLG+ R+K
Sbjct: 124 ELARTMGLGQQRRK 137


>gi|254564137|ref|YP_003071232.1| RosR/MucR family transcriptional regulator [Methylobacterium
           extorquens DM4]
 gi|254271415|emb|CAX27428.1| transcriptional regulator (RosR/MucR family) [Methylobacterium
           extorquens DM4]
          Length = 175

 Score =  197 bits (501), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 92/134 (68%), Gaps = 3/134 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+   + + VDIV+AYV N+ + + ++  LIT VH AL  + ++    +   P    PAV
Sbjct: 7   SAGDHVALVVDIVSAYVGNNSLAVGELPGLITSVHGALAHLSNKPSEPEEPAP---TPAV 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            IR+SI+   L CLEDG +FKSLKRHL+T +N++PDEYR +WNL  DYPMV+  YA TRS
Sbjct: 64  SIRRSIQQDFLICLEDGKKFKSLKRHLRTRYNLSPDEYRARWNLPDDYPMVAPSYAATRS 123

Query: 129 KLAKNMGLGRGRKK 142
           +LA+ MGLG+ R+K
Sbjct: 124 ELARTMGLGQQRRK 137


>gi|13476567|ref|NP_108137.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14027329|dbj|BAB53598.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 150

 Score =  197 bits (501), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 58/135 (42%), Positives = 86/135 (63%), Gaps = 4/135 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           + S    +  +E+T DIV+AYV N+ +P + +  LI  V ++++++         V+   
Sbjct: 3   ELSNIEDKTVIELTADIVSAYVGNNPLPASGLPDLIASVSASVRKLAGAV----VVESPS 58

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           L PAV  +KS+    + CLEDG +FKSLKRHL+T + ++PD+YR KW L  DYPMV+  Y
Sbjct: 59  LVPAVNPKKSVFPDYIICLEDGKKFKSLKRHLRTDYGLSPDDYRAKWGLPPDYPMVAPNY 118

Query: 124 ATTRSKLAKNMGLGR 138
           + TRS LAK+ GLGR
Sbjct: 119 SATRSALAKSTGLGR 133


>gi|163796263|ref|ZP_02190224.1| Predicted transcriptional regulator [alpha proteobacterium BAL199]
 gi|159178405|gb|EDP62947.1| Predicted transcriptional regulator [alpha proteobacterium BAL199]
          Length = 141

 Score =  196 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 66/143 (46%), Positives = 87/143 (60%), Gaps = 9/143 (6%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
            S   L MT ++VAAY+ N+ V  A I  +I  VH AL+ + +          E LKPAV
Sbjct: 2   GSSDLLRMTTEVVAAYLGNNSVSAAQISEVIGTVHDALKNLSTGG---SEPDAEPLKPAV 58

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI+KSI    + CLEDG Q K LKRHL+T +++TP+EYR KW L + YPMV+  YA  RS
Sbjct: 59  PIKKSITPDYIVCLEDGKQLKMLKRHLRTTYDLTPEEYRAKWGLPASYPMVAPNYAKQRS 118

Query: 129 KLAKNMGLGR------GRKKRVL 145
           + AK +GLGR      GR+K+  
Sbjct: 119 EFAKKIGLGRVSAKPAGRRKKSA 141


>gi|170744638|ref|YP_001773293.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168198912|gb|ACA20859.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 171

 Score =  196 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 59/141 (41%), Positives = 86/141 (60%), Gaps = 6/141 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M  D +  S    + +T DIV+AYVSN+ VP +++  LI+ +H +L ++V         +
Sbjct: 1   MTTDDAA-SPLDLIGLTADIVSAYVSNNSVPASEVAGLISSIHHSLGQLV----APPEPE 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+  P +PIRK++    +  LEDG  +K+LKRHL     +TPD+YR KW L  DYPMV+
Sbjct: 56  AEKPVPPIPIRKTVTPDHIISLEDGKPYKTLKRHL-AGRGLTPDQYRQKWGLPPDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRK 141
             YA  RS+LAK  GLG+ R+
Sbjct: 115 ANYAAQRSELAKTSGLGQSRR 135


>gi|83595095|ref|YP_428847.1| MucR family transcriptional regulator [Rhodospirillum rubrum ATCC
           11170]
 gi|83578009|gb|ABC24560.1| transcriptional regulator, MucR family [Rhodospirillum rubrum ATCC
           11170]
          Length = 140

 Score =  196 bits (500), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 59/143 (41%), Positives = 93/143 (65%), Gaps = 4/143 (2%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           +S  + +  +E+T  IVAA+V+N+ VP++++  LI +V+ +L  + ++         E+ 
Sbjct: 2   SSSLTEKELVELTSTIVAAHVANNSVPVSELPDLIANVYKSLTDLGNK----PVEVEEKP 57

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVP++KS+    + CLEDG + K LKRHLKT ++MTP++YR KW LA+DYPMV+  YA
Sbjct: 58  QPAVPVKKSVTPDYIICLEDGKKLKMLKRHLKTAYDMTPEDYREKWGLAADYPMVAPNYA 117

Query: 125 TTRSKLAKNMGLGRGRKKRVLTS 147
             RS LAK +GLG   ++     
Sbjct: 118 DHRSSLAKKIGLGTRSRRSNAAE 140


>gi|240850108|ref|YP_002971501.1| transcriptional regulator, Ros/MucR family [Bartonella grahamii
           as4aup]
 gi|240267231|gb|ACS50819.1| transcriptional regulator, Ros/MucR family [Bartonella grahamii
           as4aup]
          Length = 145

 Score =  196 bits (499), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 67/144 (46%), Positives = 93/144 (64%), Gaps = 3/144 (2%)

Query: 1   MDDDASFDSSERF-LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M+  A  ++     + +  DIVAAYVSN+ +   ++ SLI DVH+A ++  +    +  V
Sbjct: 1   MEHRAVLETESNLVITLVADIVAAYVSNNSIRPTEVPSLIADVHAAFRKAGNLELTE--V 58

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           + E+ +PAV  ++S+    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV
Sbjct: 59  EVEKQRPAVNPKRSVFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRKKR 143
           +  YA TRS LAK MGLGR  K++
Sbjct: 119 APNYAKTRSALAKEMGLGRKSKRK 142


>gi|170744615|ref|YP_001773270.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168198889|gb|ACA20836.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 133

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 71/140 (50%), Positives = 92/140 (65%), Gaps = 8/140 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D    D     +E   DIVAAYVSN+ VP+AD+ SLI+ VH++L R+ + AP     +
Sbjct: 1   MQDQ---DQEIGLIEQATDIVAAYVSNNSVPVADLPSLISAVHTSLVRLRNPAPA----E 53

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+  P +PI+K+I    L  LEDG Q+KSLKRHL T   +TP++YR KW L  DYPMV+
Sbjct: 54  PEKPVPLMPIKKTITPDFLISLEDGRQYKSLKRHLSTR-GLTPEQYRQKWGLPPDYPMVA 112

Query: 121 REYATTRSKLAKNMGLGRGR 140
             YA  RS+LAK+ GLGR R
Sbjct: 113 ANYAAQRSELAKSSGLGRRR 132


>gi|49474020|ref|YP_032062.1| Ros/MucR family transcriptional regulator [Bartonella quintana str.
           Toulouse]
 gi|49239523|emb|CAF25880.1| Transcriptional regulatory protein, ros/mucR family [Bartonella
           quintana str. Toulouse]
          Length = 145

 Score =  196 bits (499), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 67/144 (46%), Positives = 92/144 (63%), Gaps = 3/144 (2%)

Query: 1   MDDDASFDSSERF-LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M+     ++     + +  DIVAAYVSN+ +   ++ SLITDVH+A ++  +    +  V
Sbjct: 1   MEHRPVLETESNLVITLVADIVAAYVSNNSIRPTEVPSLITDVHAAFRKAGNVELTE--V 58

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           + E+ +PAV  ++SI    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV
Sbjct: 59  EVEKQRPAVNPKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRKKR 143
           +  YA  RS LAK MGLGR  K++
Sbjct: 119 APNYAKARSALAKEMGLGRKSKRK 142


>gi|13473566|ref|NP_105134.1| MUCR family transcriptional regulatory protein [Mesorhizobium loti
           MAFF303099]
 gi|14024316|dbj|BAB50920.1| MucR family transcriptional regulatory protein [Mesorhizobium loti
           MAFF303099]
          Length = 152

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 63/139 (45%), Positives = 84/139 (60%), Gaps = 5/139 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M DD S D+    LE+T  IV+AYV  + +P + +  LI  V +++  +   A       
Sbjct: 1   MTDD-SNDARIDLLELTAHIVSAYVEKNRLPASGLADLIASVATSIGGLGKPAVPVAAP- 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
              L PAV  +KS+    + CLEDG +FKSLKRHL  H  +TPD YR KW L SDYPMV+
Sbjct: 59  ---LVPAVNPKKSVTPDFIICLEDGKKFKSLKRHLGVHFGLTPDAYRAKWGLPSDYPMVA 115

Query: 121 REYATTRSKLAKNMGLGRG 139
             YA +RS+LAK++GLGR 
Sbjct: 116 PNYAASRSQLAKSIGLGRK 134


>gi|329114633|ref|ZP_08243392.1| Putative mucR family transcriptional regulatory protein Y4pD
           [Acetobacter pomorum DM001]
 gi|326696113|gb|EGE47795.1| Putative mucR family transcriptional regulatory protein Y4pD
           [Acetobacter pomorum DM001]
          Length = 167

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 58/161 (36%), Positives = 93/161 (57%), Gaps = 22/161 (13%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++  +      L++  +IV+A+VSN+    A I  +I D++ AL+            +
Sbjct: 15  MSENQDYSP---LLDLVSEIVSAHVSNNQTDPALIPGMIRDIYQALKTAEH-----PQNE 66

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+L+PAVP+++S+    + CLEDG + K LKRHL++ + MTP++YR +W L +DYPMV+
Sbjct: 67  PEKLQPAVPVKRSVFPDYIICLEDGKKLKMLKRHLQSAYGMTPEQYRERWGLPADYPMVA 126

Query: 121 REYATTRSKLAKNMGLGRG--------------RKKRVLTS 147
             YA  RS LA+ +GLGR               R+K+  T+
Sbjct: 127 PNYAERRSTLAREIGLGRKIHAAGDEEEQGGRGRRKKSPTA 167


>gi|163867901|ref|YP_001609105.1| transcriptional regulator [Bartonella tribocorum CIP 105476]
 gi|161017552|emb|CAK01110.1| transcriptional regulator [Bartonella tribocorum CIP 105476]
          Length = 145

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 67/144 (46%), Positives = 93/144 (64%), Gaps = 3/144 (2%)

Query: 1   MDDDASFDSSERF-LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M+  A  ++     + +  DIVAAYVSN+ +   ++ SLI DVH+A ++  +    +  V
Sbjct: 1   MEHRAVLETESNLVITLVADIVAAYVSNNSIRPTEVPSLIADVHAAFRKAGNLELTE--V 58

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           + E+ +PAV  ++S+    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV
Sbjct: 59  EVEKQRPAVNPKRSVFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRKKR 143
           +  YA TRS LAK MGLGR  K++
Sbjct: 119 APNYAKTRSALAKEMGLGRKSKRK 142


>gi|330994448|ref|ZP_08318373.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329758448|gb|EGG74967.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 156

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 85/139 (61%), Gaps = 8/139 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D    +     LE+T  IV+A+VSN+ V    +  LI  V+ AL  V          +
Sbjct: 1   MSDT---EQDFSCLELTTQIVSAHVSNNSVAADVLPDLIRQVYQALANVSRPVE-----E 52

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+L+PAVPI++S+    + CLEDG + K LKRHL++ + MTP++YR +W L ++YPMV+
Sbjct: 53  PEKLQPAVPIKRSVFPDYIVCLEDGKKLKMLKRHLQSAYGMTPEQYRERWGLPAEYPMVA 112

Query: 121 REYATTRSKLAKNMGLGRG 139
             YA  RS LA+ +GLGR 
Sbjct: 113 PNYAERRSSLAREIGLGRK 131


>gi|319898550|ref|YP_004158643.1| transcriptional regulator [Bartonella clarridgeiae 73]
 gi|319402514|emb|CBI76057.1| transcriptional regulator [Bartonella clarridgeiae 73]
          Length = 145

 Score =  196 bits (498), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 66/144 (45%), Positives = 91/144 (63%), Gaps = 3/144 (2%)

Query: 1   MDDDASFDSSERF-LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M+     ++     + +  DIVAAYVSN+ +  A++ +LI DVH+A  +  +    +  V
Sbjct: 1   MEHPPVLETESNLVITLVADIVAAYVSNNSIRPAEVPNLIADVHAAFLKAGNMTLAE--V 58

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           + E+ +PAV  ++SI    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV
Sbjct: 59  EVEKQRPAVNPKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRKKR 143
           +  YA  RS LAK MGLGR  +K+
Sbjct: 119 APNYAKARSALAKEMGLGRKSEKK 142


>gi|163854169|ref|YP_001642212.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|163665774|gb|ABY33141.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
          Length = 175

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 66/134 (49%), Positives = 92/134 (68%), Gaps = 3/134 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           S+   + + VDIV+AYV N+ + + ++  LIT VH AL  + ++    +   P    PAV
Sbjct: 7   SAGDHVALVVDIVSAYVRNNSLAVGELPGLITSVHGALAHLSNKPSEPEEPAP---TPAV 63

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            IR+SI+   L CLEDG +FKSLKRHL+T +N++PDEYR +WNL  DYPMV+  YA TRS
Sbjct: 64  SIRRSIQQDFLICLEDGKKFKSLKRHLRTRYNLSPDEYRARWNLPDDYPMVAPSYAATRS 123

Query: 129 KLAKNMGLGRGRKK 142
           +LA+ MGLG+ R+K
Sbjct: 124 ELARTMGLGQQRRK 137


>gi|49475258|ref|YP_033299.1| Ros/MucR family transcriptional regulator [Bartonella henselae str.
           Houston-1]
 gi|49238063|emb|CAF27270.1| Transcriptional regulatory protein, ros/mucR family [Bartonella
           henselae str. Houston-1]
          Length = 145

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 66/144 (45%), Positives = 91/144 (63%), Gaps = 3/144 (2%)

Query: 1   MDDDASFDSSERF-LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M+     ++     + +  DIVAAYVSN+ +   ++ SLI DVH+A ++  +    +  V
Sbjct: 1   MEHRPVLETESNLVITLVADIVAAYVSNNSIRPTEVPSLIADVHAAFRKAGNADLTE--V 58

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           + E+ +PAV  ++SI    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV
Sbjct: 59  EVEKQRPAVNPKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRKKR 143
           +  YA  RS LAK MGLGR  K++
Sbjct: 119 APNYAKARSALAKEMGLGRKSKRK 142


>gi|118593320|ref|ZP_01550704.1| transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118593403|ref|ZP_01550787.1| transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118433998|gb|EAV40655.1| transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118434081|gb|EAV40738.1| transcriptional regulator [Stappia aggregata IAM 12614]
          Length = 144

 Score =  195 bits (497), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 68/142 (47%), Positives = 90/142 (63%), Gaps = 6/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D     S    + +T DIV AYVSN++V   ++  LI  VH AL    + A   +  +
Sbjct: 1   MSDSPVETS---LINLTSDIVTAYVSNNMVTTTELTDLIGSVHQALH---AAAAVAEEPE 54

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            ERL PAVPI+KS++   + CLEDG +FKSLKRHL+  +N+TP+EYR KW L  DYPMV+
Sbjct: 55  EERLIPAVPIKKSVQPDYIVCLEDGKRFKSLKRHLRAAYNLTPEEYRGKWGLKEDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LA  +GLGR  K+
Sbjct: 115 PNYAAARSELAIELGLGRKYKR 136


>gi|144899557|emb|CAM76421.1| transcriptional regulator, ROS/MUCR family [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 140

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 88/136 (64%), Gaps = 5/136 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
            ++   L +T +IVAA+V+N+ V +AD+  LI +V+  L  V S         PER +PA
Sbjct: 5   SNTSDLLSLTTEIVAAHVANNSVAVADLPQLINEVYRTLASVGSAPSA-----PERPQPA 59

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V ++KS+    + CLEDG + K LKRHLKT +NM+P+EYR +W L +DYPMV+  YA  R
Sbjct: 60  VAVKKSVNPDYIICLEDGKKLKMLKRHLKTAYNMSPEEYRDRWGLPADYPMVAPNYAAHR 119

Query: 128 SKLAKNMGLGRGRKKR 143
           S LAK +GLG   +KR
Sbjct: 120 SSLAKKIGLGTKPRKR 135


>gi|220927359|ref|YP_002502661.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219951966|gb|ACL62358.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 166

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 60/134 (44%), Positives = 88/134 (65%), Gaps = 5/134 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S +++ R +E+  DIV+AYVSN+ VP A++ +LI  V+ +L  +   A      +P +L 
Sbjct: 2   SEEAASRHIELVSDIVSAYVSNNNVPPAELPALIQGVYQSLGSLGKPA----EPEPVKLT 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           P VPI+KS+    +  LEDG  +KSLKRHL +   +TP++YR KW L  DYPMV+  YA 
Sbjct: 58  PPVPIKKSVTPDHIISLEDGKPYKSLKRHL-SGRGLTPEQYREKWGLPRDYPMVAPNYAA 116

Query: 126 TRSKLAKNMGLGRG 139
            RS+LAK++GLG+ 
Sbjct: 117 QRSELAKSLGLGQS 130


>gi|149186792|ref|ZP_01865103.1| predicted transcriptional regulator [Erythrobacter sp. SD-21]
 gi|148829700|gb|EDL48140.1| predicted transcriptional regulator [Erythrobacter sp. SD-21]
          Length = 146

 Score =  195 bits (496), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 65/147 (44%), Positives = 94/147 (63%), Gaps = 5/147 (3%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           ++   D +E  + +T DIVAA+VSN+ V + D+ +LI++V+SAL  +      +++    
Sbjct: 2   EEFETDMTETLITLTSDIVAAHVSNNSVAVDDVPTLISNVYSALSGLGGTGVAEES---- 57

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
           R  PAV +R S++   + CL+ G + K LKRHL T H+MTPD+YR +W L SDYPMV+ E
Sbjct: 58  RPDPAVSVRASVKKDHIICLDCGKKMKMLKRHLSTEHDMTPDDYRQRWELPSDYPMVAPE 117

Query: 123 YATTRSKLAKNMGLGRGR-KKRVLTSK 148
           YA TR  LAK +GLGR   +KR    K
Sbjct: 118 YADTRRDLAKKIGLGRKPGQKRGRKKK 144


>gi|103487548|ref|YP_617109.1| MucR family transcriptional regulator [Sphingopyxis alaskensis
           RB2256]
 gi|98977625|gb|ABF53776.1| transcriptional regulator, MucR family [Sphingopyxis alaskensis
           RB2256]
          Length = 144

 Score =  195 bits (495), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 61/136 (44%), Positives = 88/136 (64%), Gaps = 7/136 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M + A  D++E  + +T DIVAA+VSN+ V ++D+  LI +V++AL  +      +    
Sbjct: 1   MSEQA--DTNEMLVTLTADIVAAHVSNNSVAISDLSLLINNVYAALSGLGGAPVVE---- 54

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+  PAV +R S++   + CLEDG + K L+RHL TH+ MTPD+YR KW LA+DYPMV+
Sbjct: 55  -EKPVPAVSVRASVKPDYIVCLEDGKKLKMLRRHLMTHYGMTPDDYRAKWGLAADYPMVA 113

Query: 121 REYATTRSKLAKNMGL 136
             YA  R  LAK +GL
Sbjct: 114 PNYAEKRRALAKEIGL 129


>gi|258542768|ref|YP_003188201.1| MucR family transcriptional regulator [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633846|dbj|BAH99821.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636905|dbj|BAI02874.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639958|dbj|BAI05920.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643014|dbj|BAI08969.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646069|dbj|BAI12017.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649122|dbj|BAI15063.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652109|dbj|BAI18043.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655166|dbj|BAI21093.1| transcriptional regulator Ros/MucR [Acetobacter pasteurianus IFO
           3283-12]
          Length = 168

 Score =  195 bits (495), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 55/139 (39%), Positives = 87/139 (62%), Gaps = 8/139 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++  +      L++  +IV+A+VSN+    A I  +I D++ AL+            +
Sbjct: 15  MSENQDYSP---LLDLVSEIVSAHVSNNQTDPALIPGMIRDIYQALKTAEH-----PQNE 66

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+L+PAVP+++S+    + CLEDG + K LKRHL++ + MTP++YR +W L +DYPMV+
Sbjct: 67  PEKLQPAVPVKRSVFPDYIICLEDGKKLKMLKRHLQSAYGMTPEQYRERWGLPADYPMVA 126

Query: 121 REYATTRSKLAKNMGLGRG 139
             YA  RS LA+ +GLGR 
Sbjct: 127 PNYAERRSTLAREIGLGRK 145


>gi|319403876|emb|CBI77462.1| transcriptional regulator [Bartonella rochalimae ATCC BAA-1498]
          Length = 145

 Score =  195 bits (495), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 67/144 (46%), Positives = 90/144 (62%), Gaps = 3/144 (2%)

Query: 1   MDDDASFDSSERF-LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M+     ++     + +  DIVAAYVSN+ +   ++ SLI DVH+A  +  S    +  V
Sbjct: 1   MEHRPVLETESNLVITLVADIVAAYVSNNSIRPVEVPSLIADVHAAFLKAGSMTLAE--V 58

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           + E+ +PAV  ++SI    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV
Sbjct: 59  EVEKQRPAVNPKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRKKR 143
           +  YA  RS LAK MGLGR  +K+
Sbjct: 119 APNYAKARSALAKEMGLGRKSEKK 142


>gi|148550705|ref|YP_001260144.1| transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148503124|gb|ABQ71377.1| transcriptional regulator [Sphingomonas wittichii RW1]
          Length = 159

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 68/141 (48%), Positives = 90/141 (63%), Gaps = 3/141 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + +  + +TVDIVAA+VSN+ +P  D+ +LI  V+SAL + V+ AP     QPE L+PAV
Sbjct: 2   AQDLLVTLTVDIVAAHVSNNALPATDLPALIEGVYSALNQAVAPAP---EPQPEELRPAV 58

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            IR S++   L CLEDG + K LKRHL TH+ ++PD YR KW L  DYPMV+  Y   RS
Sbjct: 59  SIRHSVKPDYLVCLEDGKKMKMLKRHLATHYGLSPDAYRAKWGLPKDYPMVAPSYRERRS 118

Query: 129 KLAKNMGLGRGRKKRVLTSKV 149
            LAK  GLGR   +    +K 
Sbjct: 119 TLAKENGLGRKPGEPAPAAKA 139


>gi|319406886|emb|CBI80521.1| transcriptional regulator [Bartonella sp. 1-1C]
          Length = 145

 Score =  194 bits (494), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 65/144 (45%), Positives = 89/144 (61%), Gaps = 3/144 (2%)

Query: 1   MDDDASFDSSERF-LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M+     ++     + +  DIVAAYVSN+ +   ++  LI DVH+A  +  S    +  +
Sbjct: 1   MEHRPVLETESNLVITLVADIVAAYVSNNSIRPVEVPGLIADVHAAFLKAGSMTLAE--I 58

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           + E+ +PAV  ++SI    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV
Sbjct: 59  EVEKQRPAVNPKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRKKR 143
           +  YA  RS LAK MGLGR  +K+
Sbjct: 119 APNYAKARSALAKEMGLGRKSEKK 142


>gi|170743992|ref|YP_001772647.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168198266|gb|ACA20213.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 145

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 63/151 (41%), Positives = 95/151 (62%), Gaps = 9/151 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MD D   +  +  +E+  DIV+AYVSN+ VP+ ++ +LI  VH A+ ++ + A      Q
Sbjct: 1   MDSDNQTEFPQS-IELVSDIVSAYVSNNSVPVGELAALIRSVHEAVAQLGAPAA----PQ 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+L P VPI+K++    L  LEDG ++++LKRHL     +TP++YR KW L  DYPMV+
Sbjct: 56  PEKLVPPVPIKKTVTPDYLISLEDGRRYRTLKRHL-AGRGLTPEQYRAKWGLPPDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRG---RKKRVLTSK 148
             YA  RS+LAK++GLG+    R+ R   + 
Sbjct: 115 ANYAAQRSELAKSIGLGQKPVARRPRATQAA 145


>gi|319784384|ref|YP_004143860.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317170272|gb|ADV13810.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 149

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 57/133 (42%), Positives = 84/133 (63%), Gaps = 4/133 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S    +  +E+T DIV+AYV N+ +P + +  LI  V ++++++      +       L 
Sbjct: 2   SNIDDKTVIELTADIVSAYVGNNPLPASGLPELIASVSASVRKLAGAVVAETP----NLV 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAV  +KS+    + CLEDG +FKSLKRHL+T + ++PD+YR KW L  DYPMV+  Y+ 
Sbjct: 58  PAVNPKKSVFPDYIICLEDGKKFKSLKRHLRTDYGLSPDDYRAKWGLPPDYPMVAPNYSA 117

Query: 126 TRSKLAKNMGLGR 138
           TRS LAK+ GLGR
Sbjct: 118 TRSALAKSTGLGR 130


>gi|50593434|gb|AAT79465.1| C2H2-type putative transcriptional regulator [Agrobacterium luteum]
          Length = 138

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 59/134 (44%), Positives = 85/134 (63%), Gaps = 6/134 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++     +E  + +T DIVAA+VSN+ V ++D+  +I+ VH AL  +  +A      +
Sbjct: 1   MTEEE-IALNETLITLTSDIVAAHVSNNSVAVSDLPLIISSVHGALAGLSGKA-----AE 54

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
             R  PAVPI+ SI+   + CLEDG + K LKRHL TH+ MTP++YR KW L +DYPMV+
Sbjct: 55  QARPDPAVPIKSSIKPDYVVCLEDGKKLKMLKRHLMTHYGMTPEDYRAKWGLPNDYPMVA 114

Query: 121 REYATTRSKLAKNM 134
             YA  R +LAK +
Sbjct: 115 PNYAEKRRQLAKAI 128


>gi|170744343|ref|YP_001772998.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168198617|gb|ACA20564.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 142

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 5/145 (3%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D      E  + +T DIV+AY+S + VP AD+  L+T +H  LQ +V   P +       
Sbjct: 2   DGQDADPEDLVALTADIVSAYISKNSVPAADLPGLLTSIHGTLQALVLPPPPEPAKPVPP 61

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
               +PIRK++    +  LEDG  +KSLKRHL T   +TP++YR KW L  DYPMV+  Y
Sbjct: 62  ----IPIRKTVTPDAIISLEDGKPYKSLKRHLTTR-GLTPEQYREKWGLPPDYPMVAANY 116

Query: 124 ATTRSKLAKNMGLGRGRKKRVLTSK 148
           A  RS+LAK++GLG+ RK RV   K
Sbjct: 117 AAQRSELAKSIGLGQQRKNRVPPRK 141


>gi|295689066|ref|YP_003592759.1| MucR family transcriptional regulator [Caulobacter segnis ATCC
           21756]
 gi|295430969|gb|ADG10141.1| transcriptional regulator, MucR family [Caulobacter segnis ATCC
           21756]
          Length = 148

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 59/141 (41%), Positives = 88/141 (62%), Gaps = 2/141 (1%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
             D +  +S   L ++ +IVAAYV  + V  A I  LI  VH AL  + +    +     
Sbjct: 8   TSDTASSNSLDILGLSAEIVAAYVGQNTVSQAAIPELIRTVHEALSTLNNGG--EPPRPA 65

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           E+ KPAVP+ +S+++  + CLEDG + K LKR+L++H++M+P+EYR KW L  DYPMV+ 
Sbjct: 66  EKAKPAVPVGRSVQHDYIVCLEDGKKLKMLKRYLRSHYDMSPEEYRRKWGLPPDYPMVAP 125

Query: 122 EYATTRSKLAKNMGLGRGRKK 142
            YA  RS  AK +GLG+G ++
Sbjct: 126 AYAARRSDFAKKIGLGKGVRR 146


>gi|197105139|ref|YP_002130516.1| transcriptional regulator [Phenylobacterium zucineum HLK1]
 gi|196478559|gb|ACG78087.1| transcriptional regulator [Phenylobacterium zucineum HLK1]
          Length = 150

 Score =  194 bits (493), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 61/140 (43%), Positives = 85/140 (60%), Gaps = 2/140 (1%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D+   S E  L +   IVAAYVS + V    +  +I  VH  L+++            ER
Sbjct: 12  DSGAPSGEDILRLGAGIVAAYVSRNAVSAEQVPDIIRTVHQTLEQLTRGPSAP--TPEER 69

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            KPAVPI +S+++  + CLEDG + K LKR+L++ +NM+PDEYR +W L  DYPMV+  Y
Sbjct: 70  PKPAVPIGRSVQHDYIVCLEDGKKLKMLKRYLRSRYNMSPDEYRRRWGLPPDYPMVAPAY 129

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           A  RS  AK +GLGRG ++R
Sbjct: 130 AARRSDFAKKIGLGRGVRRR 149


>gi|170744916|ref|YP_001773571.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168199190|gb|ACA21137.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 164

 Score =  194 bits (493), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 60/134 (44%), Positives = 88/134 (65%), Gaps = 5/134 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S +++   +E+  DIV+A+VS++ VP+A++ +LI  V+ +L  +          +P +L 
Sbjct: 2   SEEAANSHIELVSDIVSAFVSHNNVPVAELPNLIRGVYESLGSLGKPV----EPEPVKLT 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           P VPI+KSI    +  LEDG  +KSLKRHL+T   +TPDEYR KW L  DYPMV+  YA 
Sbjct: 58  PPVPIKKSITPDAIISLEDGRSYKSLKRHLRTR-GLTPDEYRKKWGLPPDYPMVAPNYAA 116

Query: 126 TRSKLAKNMGLGRG 139
            RS+LAK++GLG+ 
Sbjct: 117 QRSELAKSLGLGQN 130


>gi|319405313|emb|CBI78927.1| transcriptional regulator [Bartonella sp. AR 15-3]
          Length = 145

 Score =  193 bits (492), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 65/144 (45%), Positives = 90/144 (62%), Gaps = 3/144 (2%)

Query: 1   MDDDASFDSSERF-LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M+     ++     + +  DIVAAYVSN+ +  A++ SLI DVH+A  +  +    +  V
Sbjct: 1   MEHRPVLETESNLVITLVADIVAAYVSNNSIRPAEVPSLIADVHAAFLKAGNMTLAE--V 58

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
           + E+ +PAV  ++SI    L CLEDG +FKSLKRHL TH+ M P+EYR KW L S YPMV
Sbjct: 59  EVEKQRPAVNPKRSIFPDYLICLEDGKKFKSLKRHLMTHYGMLPEEYREKWQLDSSYPMV 118

Query: 120 SREYATTRSKLAKNMGLGRGRKKR 143
           +  YA  RS LAK MGLG   +++
Sbjct: 119 APNYAKARSALAKEMGLGHKSERK 142


>gi|7388546|sp|O33682|Y4338_RHIME RecName: Full=Putative mucR family transcriptional regulatory
           protein RA0938
 gi|2270982|gb|AAB63671.1| orf2 [Sinorhizobium meliloti]
          Length = 163

 Score =  193 bits (492), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 87/136 (63%), Gaps = 2/136 (1%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
               S+ R LE+T  IV+AY+S +V+   ++  LI   + +L    +  P +     E  
Sbjct: 27  TETRSNGRRLELTSRIVSAYLSRNVIAPDELPYLIQQTYGSLNE--TSGPGETPPAVEEQ 84

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVPI+KS+ +  + CLEDG +FKSLKRHL T + MTPD+YR KW L S+YPM +R YA
Sbjct: 85  RPAVPIKKSVTDDFIVCLEDGKKFKSLKRHLTTKYGMTPDQYREKWKLPSEYPMTARNYA 144

Query: 125 TTRSKLAKNMGLGRGR 140
             RSKLA+ MGLG+ R
Sbjct: 145 LQRSKLARAMGLGKSR 160


>gi|220919996|ref|YP_002495299.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952416|gb|ACL62807.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 143

 Score =  193 bits (492), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 59/143 (41%), Positives = 91/143 (63%), Gaps = 5/143 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S +++   +E+  DIV+AYVS + VP +++ +LI  V+ +L  +   A      +P +L 
Sbjct: 2   SEETAAGHIELVSDIVSAYVSKNSVPPSELPALIQSVYQSLGALGRPA----EPEPVKLT 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           P VPI+K++    +  LEDG  +KSLKRHL T   +TP +YR+KW+L  DYPMV+  YA 
Sbjct: 58  PPVPIKKTVTPDHIISLEDGKPYKSLKRHLTTR-GLTPQQYRVKWSLPPDYPMVAANYAA 116

Query: 126 TRSKLAKNMGLGRGRKKRVLTSK 148
            RS+LAK++GLGR R++     +
Sbjct: 117 QRSELAKSIGLGRSRQQAARPRR 139


>gi|121602360|ref|YP_988741.1| Ros/MucR family transcriptional regulator [Bartonella bacilliformis
           KC583]
 gi|120614537|gb|ABM45138.1| transcriptional regulatory protein, ros/MucR family [Bartonella
           bacilliformis KC583]
          Length = 143

 Score =  193 bits (492), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 67/135 (49%), Positives = 89/135 (65%), Gaps = 4/135 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
            S   + +  D+VAAYVSN+ +  A++ SLI DVH+A  +  + A    +V+ E+ +PAV
Sbjct: 10  ESSLIITLVADVVAAYVSNNSIQPAEVPSLIADVHAAFLKAGNTA----SVEVEKQRPAV 65

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
             R+SI    L CLEDG +FKSLKRHL TH+ M+P+EYR KW L S YPMV+  Y   RS
Sbjct: 66  NPRRSIFPDYLICLEDGKKFKSLKRHLMTHYQMSPEEYREKWQLESSYPMVAPNYTKARS 125

Query: 129 KLAKNMGLGRGRKKR 143
            LAK MGLG  R+K+
Sbjct: 126 ALAKEMGLGHNRQKK 140


>gi|254293594|ref|YP_003059617.1| MucR family transcriptional regulator [Hirschia baltica ATCC 49814]
 gi|254042125|gb|ACT58920.1| transcriptional regulator, MucR family [Hirschia baltica ATCC
           49814]
          Length = 143

 Score =  193 bits (491), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 59/133 (44%), Positives = 86/133 (64%), Gaps = 3/133 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           +    + +  +IV+AYV N+ VP++D+  LI + ++ +  +  R   +        KPAV
Sbjct: 14  NDSTLIGVVSEIVSAYVGNNPVPVSDLPGLIENTYNVVSELNGRIVKETKAD---QKPAV 70

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +RKS+    + CLEDG +FKSLKRHL+T +NM+P+EYR KW L+ DYPMV+  YA  RS
Sbjct: 71  SVRKSLSEDYVICLEDGKKFKSLKRHLRTRYNMSPEEYREKWGLSPDYPMVAPNYAKQRS 130

Query: 129 KLAKNMGLGRGRK 141
            LAK MGLG+ +K
Sbjct: 131 DLAKRMGLGQAKK 143


>gi|58039238|ref|YP_191202.1| transcriptional regulator [Gluconobacter oxydans 621H]
 gi|58001652|gb|AAW60546.1| Transcriptional regulator [Gluconobacter oxydans 621H]
          Length = 135

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 80/136 (58%), Gaps = 4/136 (2%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           +   ++    ++T  IV AYVSN+ +P   + +LI  VH +L  V       +    E+ 
Sbjct: 2   SQETNAPELHQLTAQIVTAYVSNNDIPADALPALIRSVHDSLATVN----VPEEAPVEKP 57

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
            PAV  RKS+    + CLEDG + K L+RHLKT +NMTP EYR +W L  +YPMV+  YA
Sbjct: 58  VPAVSPRKSVFPDYIICLEDGKKLKLLRRHLKTAYNMTPQEYRERWGLPPEYPMVAPNYA 117

Query: 125 TTRSKLAKNMGLGRGR 140
             RS LA+ +GLGR R
Sbjct: 118 NHRSSLARKIGLGRRR 133


>gi|163793209|ref|ZP_02187185.1| Predicted transcriptional regulator [alpha proteobacterium BAL199]
 gi|159181855|gb|EDP66367.1| Predicted transcriptional regulator [alpha proteobacterium BAL199]
          Length = 132

 Score =  193 bits (491), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 62/134 (46%), Positives = 79/134 (58%), Gaps = 3/134 (2%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           MT  +VAAY+ N+ V    I  +I  VH AL+ +           PE L+PAV ++KSI 
Sbjct: 1   MTTTVVAAYLGNNSVASNQISEVINAVHGALKGLSGD---DREPAPEPLRPAVSVKKSIT 57

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
              + CLEDG Q K LKRHL+T + MTPDEYR KW L +DYPMV+  YA  RS+ AK +G
Sbjct: 58  PDYIVCLEDGKQLKMLKRHLRTAYGMTPDEYRAKWGLPADYPMVAPNYAQQRSEFAKKIG 117

Query: 136 LGRGRKKRVLTSKV 149
           LG    +R    K 
Sbjct: 118 LGSQTTRRTRKRKA 131


>gi|220926311|ref|YP_002501613.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219950918|gb|ACL61310.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 144

 Score =  193 bits (491), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 63/149 (42%), Positives = 94/149 (63%), Gaps = 6/149 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+ +   ++ +  +E+  DIV+AYVSN+ VP+ ++  LI  VH A+ R+ + A      Q
Sbjct: 1   MNSENQTEAPQT-IELVSDIVSAYVSNNSVPVGELAGLIRSVHDAVARLGAPAA----PQ 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+L P VPI+K+I    L  LEDG ++++LKRHL     +TP++YR KW L  DYPMV+
Sbjct: 56  PEKLVPPVPIKKTITPDYLISLEDGRRYRTLKRHL-AGRGLTPEQYRAKWGLPPDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSKV 149
             YA  RS+LAK++GLG+    R   S+ 
Sbjct: 115 ANYAAQRSELAKSIGLGQKPVARRARSQA 143


>gi|158423605|ref|YP_001524897.1| putative transcriptional regulator [Azorhizobium caulinodans ORS
           571]
 gi|158330494|dbj|BAF87979.1| putative transcriptional regulator [Azorhizobium caulinodans ORS
           571]
          Length = 151

 Score =  193 bits (490), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 65/145 (44%), Positives = 90/145 (62%), Gaps = 6/145 (4%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
             +   LE+  DIV AYV N+ V  +D+  LI  VH+AL+ +       +    E LKPA
Sbjct: 5   PQNSATLELVADIVTAYVGNNTVAQSDLSDLIVKVHAALRGLSGN--TAEAAPVEELKPA 62

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VP++KS+    + CLEDG QFKSLKRHL++ + +TPD YR KWNL  DYPMV+  YA  R
Sbjct: 63  VPVKKSVTPDYIICLEDGRQFKSLKRHLQSAYGLTPDAYRAKWNLPRDYPMVAPNYAAAR 122

Query: 128 SKLAKNMGLGRG----RKKRVLTSK 148
           S+LA+++GLGR       K+   ++
Sbjct: 123 SELARSLGLGRKPAPEPAKKAAPAR 147


>gi|158421862|ref|YP_001523154.1| putative transcriptional regulator [Azorhizobium caulinodans ORS
           571]
 gi|158328751|dbj|BAF86236.1| putative transcriptional regulator [Azorhizobium caulinodans ORS
           571]
          Length = 157

 Score =  193 bits (490), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 62/149 (41%), Positives = 94/149 (63%), Gaps = 5/149 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MDD    DS++   E    IV+A+V+++ +  A++ +LI  VH+ L  +  + P +    
Sbjct: 1   MDDQ---DSNDFLAENAAQIVSAFVAHNSISAAELPNLIQTVHATLAALTGQKPVE--AA 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P++L PAV +++SI    + CLEDG++FKSLKRHL + + +TPDEYR KW+L  DYPMV+
Sbjct: 56  PKQLVPAVSVKRSITPDYIICLEDGLKFKSLKRHLMSKYGLTPDEYRKKWDLPYDYPMVA 115

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSKV 149
             YA TRS +AK +GLGR +       + 
Sbjct: 116 PNYALTRSAMAKEIGLGRAKSTPAKAPEA 144


>gi|83593164|ref|YP_426916.1| MucR family transcriptional regulator [Rhodospirillum rubrum ATCC
           11170]
 gi|83576078|gb|ABC22629.1| transcriptional regulator, MucR family [Rhodospirillum rubrum ATCC
           11170]
          Length = 139

 Score =  193 bits (490), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 68/139 (48%), Positives = 88/139 (63%), Gaps = 3/139 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MDD     + +  L+MTV +V+AYVS + +P   I  LI     AL  +    P    ++
Sbjct: 1   MDDKQEALTRDDVLKMTVSVVSAYVSKNPMPATQIPDLIQTTFQALSTL---EPQAIEIK 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E  KPAVP++KSI    L CLEDG + K LKRHL+T++NMTP+EYR KWNLA+DYPMV+
Sbjct: 58  VEAAKPAVPVKKSIHAEYLVCLEDGKKLKMLKRHLRTNYNMTPEEYRAKWNLAADYPMVA 117

Query: 121 REYATTRSKLAKNMGLGRG 139
             YA  RS  AK +GLGR 
Sbjct: 118 PNYAQQRSDFAKKIGLGRK 136


>gi|90423282|ref|YP_531652.1| MucR family transcriptional regulator [Rhodopseudomonas palustris
           BisB18]
 gi|90105296|gb|ABD87333.1| transcriptional regulator, MucR family [Rhodopseudomonas palustris
           BisB18]
          Length = 138

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 66/145 (45%), Positives = 90/145 (62%), Gaps = 7/145 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D       + F+++T  IV+AYVSN+  P AD+  LI  +H+AL RV +         
Sbjct: 1   MTDSTG----KSFIDLTATIVSAYVSNNPTPAADLPGLIGQIHAALVRVSAGRVEPPPEP 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            +       ++KS+    L CLEDG +FKSLKRHL+T +NMTP++YR KW LA DYPMV+
Sbjct: 57  AKPAV---SLKKSMTADYLVCLEDGKRFKSLKRHLRTQYNMTPEQYRDKWGLAPDYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA  RS+LAK MGLG+ R++R  
Sbjct: 114 PNYAVARSQLAKKMGLGQQRRRRGK 138


>gi|16263391|ref|NP_436184.1| MUCR family transcriptional regulatory protein IN SYRB 5'region
           [Sinorhizobium meliloti 1021]
 gi|307308344|ref|ZP_07588049.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
 gi|307320903|ref|ZP_07600312.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           AK83]
 gi|14524078|gb|AAK65596.1| Transcriptional regulator, MucR family [Sinorhizobium meliloti
           1021]
 gi|306893501|gb|EFN24278.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           AK83]
 gi|306901145|gb|EFN31752.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
          Length = 138

 Score =  192 bits (489), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 63/136 (46%), Positives = 87/136 (63%), Gaps = 2/136 (1%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
               S+ R LE+T  IV+AY+S +V+   ++  LI   + +L    +  P +     E  
Sbjct: 2   TETRSNGRRLELTSRIVSAYLSRNVIAPDELPYLIQQTYGSLNE--TSGPGETPPAVEEQ 59

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVPI+KS+ +  + CLEDG +FKSLKRHL T + MTPD+YR KW L S+YPM +R YA
Sbjct: 60  RPAVPIKKSVTDDFIVCLEDGKKFKSLKRHLTTKYGMTPDQYREKWKLPSEYPMTARNYA 119

Query: 125 TTRSKLAKNMGLGRGR 140
             RSKLA+ MGLG+ R
Sbjct: 120 LQRSKLARAMGLGKSR 135


>gi|16125605|ref|NP_420169.1| transcriptional regulator [Caulobacter crescentus CB15]
 gi|221234355|ref|YP_002516791.1| transcriptional regulator [Caulobacter crescentus NA1000]
 gi|13422707|gb|AAK23337.1| transcriptional regulator [Caulobacter crescentus CB15]
 gi|220963527|gb|ACL94883.1| transcriptional regulator [Caulobacter crescentus NA1000]
          Length = 171

 Score =  192 bits (488), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 56/142 (39%), Positives = 88/142 (61%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           ++ D + ++    L ++ +IVAAYV  + V  A I  LI  VH AL  +           
Sbjct: 30  VNTDTTIENDVDILGLSAEIVAAYVGQNTVAQAAIPDLIRTVHGALATLNDGVEAPRPA- 88

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+ KPAVP+ +S+++  + CLEDG + K LKR+L++H++M+P++YR KW L  +YPMV+
Sbjct: 89  -EKAKPAVPVSRSVQHDYIVCLEDGKRLKMLKRYLRSHYDMSPEDYRRKWGLPPEYPMVA 147

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS  AK +GLG+G ++
Sbjct: 148 PAYAARRSDFAKQIGLGKGVRR 169


>gi|254499989|ref|ZP_05112142.1| ROS/MUCR transcriptional regulator protein [Labrenzia alexandrii
           DFL-11]
 gi|222441456|gb|EEE48133.1| ROS/MUCR transcriptional regulator protein [Labrenzia alexandrii
           DFL-11]
          Length = 148

 Score =  192 bits (488), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 70/149 (46%), Positives = 98/149 (65%), Gaps = 6/149 (4%)

Query: 1   MDDDASFDSSER--FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           M +   ++++    ++++T DIV+AYVS + +   D+ +LI  VHSAL   VS A     
Sbjct: 1   MSEAPEYNTTIEPVYVDLTADIVSAYVS-NKIASGDLATLIATVHSAL---VSAAQTVQE 56

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
              E L PAVP++KSI    + CLEDG +FKSLKRHL+TH +MTP++YR KWNL  DYPM
Sbjct: 57  PAVEELVPAVPVKKSILGDYIICLEDGKKFKSLKRHLRTHFDMTPEDYRAKWNLPVDYPM 116

Query: 119 VSREYATTRSKLAKNMGLGRGRKKRVLTS 147
           V+  YA  RS LA+ MGLGR + +R  ++
Sbjct: 117 VAPNYAAARSDLARKMGLGRKQGRRSKSA 145


>gi|307314607|ref|ZP_07594208.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
 gi|306899024|gb|EFN29668.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
          Length = 148

 Score =  192 bits (488), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 87/139 (62%), Gaps = 2/139 (1%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
               S+E  LE+T  IV+AY+S +V+  +++  LI   + +L +  +  P +     E  
Sbjct: 2   TESRSNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGK--TSEPAKTPATVEEQ 59

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVPI+KS+ +  + CLEDG  FKSLKRHL   + +TP++YR KW L  DYPMV+  YA
Sbjct: 60  RPAVPIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYREKWKLPPDYPMVAPNYA 119

Query: 125 TTRSKLAKNMGLGRGRKKR 143
             RS+LA+  GLGR R++ 
Sbjct: 120 RKRSELARATGLGRNRRQS 138


>gi|326386710|ref|ZP_08208331.1| MucR family transcriptional regulator [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208763|gb|EGD59559.1| MucR family transcriptional regulator [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 146

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 65/146 (44%), Positives = 93/146 (63%), Gaps = 4/146 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           +   D  E  + +T DIVAA+VSN+ V + D+  LI++V++AL  +    P +  V+P  
Sbjct: 3   ETENDLRETLITLTSDIVAAHVSNNSVSVGDLPLLISNVYTALAGL---KPAEAAVEP-T 58

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            +PAV IR S++N  + CLEDG + K LKRHL T +NMTP++YR +WNL +DYPMV+  Y
Sbjct: 59  PEPAVSIRASVKNDHIICLEDGKKLKMLKRHLATRYNMTPEQYRARWNLPADYPMVAPAY 118

Query: 124 ATTRSKLAKNMGLGRGRKKRVLTSKV 149
           A  R +LAK +GLGR    +    K 
Sbjct: 119 AEKRRELAKKIGLGRKPAPKRGRGKA 144


>gi|150378298|ref|YP_001314892.1| MucR family transcriptional regulator [Sinorhizobium medicae
           WSM419]
 gi|150032845|gb|ABR64959.1| transcriptional regulator, MucR family [Sinorhizobium medicae
           WSM419]
          Length = 137

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 59/137 (43%), Positives = 87/137 (63%), Gaps = 2/137 (1%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           ++   ++ER LE+T  IVAAY+S + VP  D+  LI   +S+L     R   +  V  E 
Sbjct: 3   ESGLSNAERKLELTSRIVAAYLSRNAVPAGDLPDLIQQTYSSLSGTSPRHQAEPAV--EE 60

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
            +PA+P++KS+    + CLEDG +FKSL+RHL   + +TP++YR KW L  DYPM++  Y
Sbjct: 61  QRPAIPLKKSVTVDFIICLEDGEKFKSLRRHLMAKYGLTPEQYREKWGLPDDYPMIAPSY 120

Query: 124 ATTRSKLAKNMGLGRGR 140
           A  RS+LA+  GLG+ R
Sbjct: 121 ARQRSELARASGLGKKR 137


>gi|220927140|ref|YP_002502442.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219951747|gb|ACL62139.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 133

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 68/140 (48%), Positives = 90/140 (64%), Gaps = 8/140 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D    D     +E   DIVAAYVSN+ VP+A++  LI+ VH++L R+ + A      +
Sbjct: 1   MQDQ---DQEIDLIERATDIVAAYVSNNSVPVAELPGLISAVHTSLMRLRTPAAA----E 53

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+  P +PI+K+I    L  LEDG Q+KSLKRHL T   +TP++YR KW L  DYPMV+
Sbjct: 54  PEKPVPLMPIKKTITPDYLISLEDGRQYKSLKRHLSTR-GLTPEQYRQKWGLPHDYPMVA 112

Query: 121 REYATTRSKLAKNMGLGRGR 140
             YA  RS+LAK+ GLGR R
Sbjct: 113 ANYAAQRSELAKSSGLGRRR 132


>gi|220922078|ref|YP_002497379.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219946684|gb|ACL57076.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 162

 Score =  192 bits (488), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 60/139 (43%), Positives = 86/139 (61%), Gaps = 7/139 (5%)

Query: 1   MDDDA--SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           M +D   + + S   + MT DIV+AYV+++ +P A++  L+  VH++L  + + A     
Sbjct: 1   MSNDTVTAANDSPDLISMTADIVSAYVAHNSIPAAELPGLVAGVHASLAGLTTPA----E 56

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
             PE L P VPIRK++    +  LEDG  +K+LKRHL     MTP++YR KW L  +YPM
Sbjct: 57  ATPEPLVPPVPIRKTVTPDAIISLEDGRPYKTLKRHL-AGRGMTPEQYRAKWGLPPNYPM 115

Query: 119 VSREYATTRSKLAKNMGLG 137
           V+  YA  RS+LAKN GLG
Sbjct: 116 VAANYAAQRSELAKNTGLG 134


>gi|150378028|ref|YP_001314623.1| MucR family transcriptional regulator [Sinorhizobium medicae
           WSM419]
 gi|150032575|gb|ABR64690.1| transcriptional regulator, MucR family [Sinorhizobium medicae
           WSM419]
          Length = 148

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 59/138 (42%), Positives = 88/138 (63%), Gaps = 2/138 (1%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
               S+E  LE+T  IV+AY+S +V+  +++  LI   + +L +  +  P +     E  
Sbjct: 2   TESRSNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGK--TSEPAKTAATVEEQ 59

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVPI+KS+ +  + CLEDG  FKSLKRHL   + +TP++YR KW L +DYPMV+  YA
Sbjct: 60  RPAVPIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYREKWKLPADYPMVAPNYA 119

Query: 125 TTRSKLAKNMGLGRGRKK 142
             RS+LA+  GLGR R++
Sbjct: 120 RKRSELARATGLGRNRRQ 137


>gi|260469585|ref|ZP_05813750.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259028611|gb|EEW29922.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 150

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 59/133 (44%), Positives = 87/133 (65%), Gaps = 4/133 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S    +  +E+T DIV+AYV N+ +P + +  LI  V ++++++   A     V+   L 
Sbjct: 2   SNIEDKTVIELTADIVSAYVGNNPLPASGLPDLIASVSASVRKLAGAA----VVESPSLV 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAV  +KS+    + CLEDG +FKSLKRHL+T + ++PD+YR KW+L  DYPMV+  Y+ 
Sbjct: 58  PAVNPKKSVFPDYIVCLEDGKKFKSLKRHLRTDYGLSPDDYRAKWSLPPDYPMVAPNYSA 117

Query: 126 TRSKLAKNMGLGR 138
           TRS LAK+ GLGR
Sbjct: 118 TRSALAKSTGLGR 130


>gi|170744767|ref|YP_001773422.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168199041|gb|ACA20988.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 164

 Score =  191 bits (487), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 58/136 (42%), Positives = 85/136 (62%), Gaps = 5/136 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S  ++   +++  DIV+A+VS++ VP  ++ +LI  V+ +L  +   A      +  +L 
Sbjct: 2   SEQAASDHIQLVSDIVSAFVSHNNVPAVELPNLIRGVYESLGSLGKPA----EPELVKLT 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVPIRKS+    +  LEDG  +KSLKRHL T   +TP +YR KW L  DYPMV+  YA 
Sbjct: 58  PAVPIRKSVTPDAIISLEDGKPYKSLKRHL-TGRGLTPQQYREKWGLPPDYPMVAANYAA 116

Query: 126 TRSKLAKNMGLGRGRK 141
            RS+LAK +GLG+ R+
Sbjct: 117 ARSELAKQIGLGQNRQ 132


>gi|163852252|ref|YP_001640295.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|218531010|ref|YP_002421826.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|240139585|ref|YP_002964061.1| putative transcriptional regulator, MucR family [Methylobacterium
           extorquens AM1]
 gi|254561999|ref|YP_003069094.1| MucR family transcriptional regulator [Methylobacterium extorquens
           DM4]
 gi|163663857|gb|ABY31224.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|218523313|gb|ACK83898.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
 gi|240009558|gb|ACS40784.1| putative transcriptional regulator, MucR family [Methylobacterium
           extorquens AM1]
 gi|254269277|emb|CAX25243.1| putative transcriptional regulator, MucR family [Methylobacterium
           extorquens DM4]
          Length = 162

 Score =  191 bits (486), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 54/139 (38%), Positives = 81/139 (58%), Gaps = 3/139 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++     +  F+E+  DIV++YVSN+ VP +++  LI  VH+AL  + S        +
Sbjct: 1   MTEENQKSFN-DFVELASDIVSSYVSNNSVPASELPGLIISVHTALTTLSSPEAVAAPAE 59

Query: 61  PERLKPAV-PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
               KP+   +RKS+    +    DG  +K+LKRHL T H + P  YR ++ L +DYPMV
Sbjct: 60  EVIEKPSSGQVRKSVTPDAIISFIDGKPYKTLKRHLGT-HGLDPYSYRQRYGLPNDYPMV 118

Query: 120 SREYATTRSKLAKNMGLGR 138
           +  YA  RS LAK++GLGR
Sbjct: 119 APNYAAQRSALAKSIGLGR 137


>gi|85374523|ref|YP_458585.1| transcriptional regulator [Erythrobacter litoralis HTCC2594]
 gi|84787606|gb|ABC63788.1| predicted transcriptional regulator [Erythrobacter litoralis
           HTCC2594]
          Length = 146

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 65/147 (44%), Positives = 89/147 (60%), Gaps = 5/147 (3%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           +    D SE  + +T DIVAA+VSN+ V + D+ +LIT V+ AL  +      ++     
Sbjct: 2   ETLESDMSEALITLTSDIVAAHVSNNNVTVEDVPALITSVYGALSGLGKDEAAEEV---- 57

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
           R  PAV IR S++   + CL+ G + K LKRHL T H MT DEY+ +WNL +DYPMV+ +
Sbjct: 58  RPDPAVSIRASVKKDHIVCLDCGKKMKMLKRHLMTEHGMTIDEYKARWNLGADYPMVAPD 117

Query: 123 YATTRSKLAKNMGLGRGR-KKRVLTSK 148
           YA TR  LAK +GLGR   +KR    K
Sbjct: 118 YAETRRTLAKKIGLGRKPGQKRGRKKK 144


>gi|296114428|ref|ZP_06833082.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295979189|gb|EFG85913.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 134

 Score =  191 bits (486), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 57/142 (40%), Positives = 84/142 (59%), Gaps = 8/142 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D+    +     E+T +IV+AYV+ + +    +  LI  V+  +  +           
Sbjct: 1   MADET---ADIELRELTAEIVSAYVARNTLDAETLPDLIHQVYETISSLGK-----VEAA 52

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+  PAVP++KS+    + CLEDG + K LKRHLKT +NMTP+EYR +W L  DYPMV+
Sbjct: 53  PEKPVPAVPLKKSVFPDYIVCLEDGKKLKMLKRHLKTAYNMTPEEYRERWGLPHDYPMVA 112

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA+ RS LA+ +GLG  R++
Sbjct: 113 PSYASHRSSLARKIGLGTKREE 134


>gi|300022617|ref|YP_003755228.1| MucR family transcriptional regulator [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524438|gb|ADJ22907.1| transcriptional regulator, MucR family [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 133

 Score =  191 bits (485), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 64/134 (47%), Positives = 86/134 (64%), Gaps = 3/134 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
             S    + +T  IVAAYVSN+ +   D+  LI + H+AL R   R+      + E  KP
Sbjct: 3   SPSQPELVTITATIVAAYVSNNSISSTDLPGLIAETHAALSRAAGRSAP---AEREEAKP 59

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
            + ++KS+    L CLEDG +FKSLKRHL+TH+N++P+EYR KW+L  DYPMV+  YA  
Sbjct: 60  KIAVKKSVMPDYLICLEDGKKFKSLKRHLRTHYNLSPEEYREKWSLPPDYPMVAPNYANA 119

Query: 127 RSKLAKNMGLGRGR 140
           RS+LAK MGLG  R
Sbjct: 120 RSQLAKKMGLGTRR 133


>gi|188582197|ref|YP_001925642.1| MucR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179345695|gb|ACB81107.1| transcriptional regulator, MucR family [Methylobacterium populi
           BJ001]
          Length = 160

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 55/139 (39%), Positives = 82/139 (58%), Gaps = 3/139 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++     +  F+E+  DIV++YVSN+ VP +++  LI +VH+AL  + S        +
Sbjct: 1   MTEENQKSFN-DFVELASDIVSSYVSNNSVPASELPGLIINVHAALTGLSSPETAAAPAE 59

Query: 61  PERLKPAV-PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
               KP+   IRKS+    +    DG  +K+LKRHL T H + P  YR ++ L +DYPMV
Sbjct: 60  EVIEKPSSGQIRKSVTPDAIISFIDGKPYKTLKRHLGT-HGLDPYSYRQRYGLPNDYPMV 118

Query: 120 SREYATTRSKLAKNMGLGR 138
           +  YA  RS LAK++GLGR
Sbjct: 119 APNYAAQRSALAKSIGLGR 137


>gi|114800329|ref|YP_760759.1| transcriptional regulator [Hyphomonas neptunium ATCC 15444]
 gi|114740503|gb|ABI78628.1| transcriptional regulator [Hyphomonas neptunium ATCC 15444]
          Length = 192

 Score =  191 bits (485), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 63/140 (45%), Positives = 89/140 (63%), Gaps = 8/140 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D    D+    L+MTV+IV++YV+N+ +    + +LI  VH+ L  + +  P    V 
Sbjct: 61  MTDPEDLDA----LDMTVEIVSSYVANNAIQSDQLPALIKSVHATLSDLTNTVP----VP 112

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+L+PAV I KS+    L CLEDG + K LKR+L+T  +MTP++YR KW L +DYPMV+
Sbjct: 113 AEKLEPAVAINKSVTPEFLICLEDGAKLKMLKRYLRTRFDMTPEDYRAKWGLPADYPMVA 172

Query: 121 REYATTRSKLAKNMGLGRGR 140
             YA  RSK AK +GLG+ R
Sbjct: 173 PNYAKLRSKHAKQIGLGKKR 192


>gi|304393560|ref|ZP_07375488.1| transcriptional regulatory protein MucR [Ahrensia sp. R2A130]
 gi|303294567|gb|EFL88939.1| transcriptional regulatory protein MucR [Ahrensia sp. R2A130]
          Length = 137

 Score =  190 bits (484), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 63/137 (45%), Positives = 90/137 (65%), Gaps = 3/137 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           ++   +     L +T ++V AYV N+ +  +D+  LI +VH AL  + + AP  +  +P 
Sbjct: 2   ENYEVEDDSVMLGLTTEVVCAYVGNNPIAASDLAGLIKEVHGALHGLQAPAPEPEPEKPV 61

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
                V IRKS+++  L CLEDG +FKSLKRHLKTH++++P++YR KW L SDYPMV+  
Sbjct: 62  PA---VSIRKSLKDDYLICLEDGKKFKSLKRHLKTHYDLSPEQYREKWGLPSDYPMVAPN 118

Query: 123 YATTRSKLAKNMGLGRG 139
           YA  RS+LAK MGLGR 
Sbjct: 119 YAAERSRLAKKMGLGRK 135


>gi|296282495|ref|ZP_06860493.1| transcriptional regulator [Citromicrobium bathyomarinum JL354]
          Length = 142

 Score =  190 bits (483), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 61/146 (41%), Positives = 94/146 (64%), Gaps = 8/146 (5%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            + ++  +  T +IV AYVSN+   + ++  LI +V+SAL  +   A  ++    ER +P
Sbjct: 1   MEMTQTLIAFTSNIVEAYVSNNSAELDEVPVLINNVYSALSSLGGGATQEE----ERPEP 56

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AV +R S++   L CLEDG + K LKR+L+T+++M+P+EYR +WNL SDYPMV+  YA  
Sbjct: 57  AVSVRASVKPDYLVCLEDGKKLKMLKRYLRTNYDMSPEEYRERWNLPSDYPMVAPNYAEK 116

Query: 127 RSKLAKNMGLGR----GRKKRVLTSK 148
           R +LAK +GLGR     R +R  T++
Sbjct: 117 RRELAKKIGLGRTPGQKRGRRKKTAE 142


>gi|220924831|ref|YP_002500133.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219949438|gb|ACL59830.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 160

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 65/138 (47%), Positives = 88/138 (63%), Gaps = 6/138 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M  D S   +   + ++ DIV+AYVS + VP+ D+  LI  VHS+L +VVS  P      
Sbjct: 1   MTSDTSAVQT-DLINLSADIVSAYVSKNSVPLGDLAGLIESVHSSLVKVVSPPPAA---- 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+  P +PIRK++    +  LEDG  +KSLKRHL +   +TPDEYR KW L  DYPMV+
Sbjct: 56  PEKPVPPIPIRKTVTPDAIISLEDGKPYKSLKRHL-SGRGLTPDEYRQKWGLPPDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGR 138
             YA  RS+LAK++GLG+
Sbjct: 115 ANYAAQRSELAKSLGLGQ 132


>gi|312114879|ref|YP_004012475.1| MucR family transcriptional regulator [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311220008|gb|ADP71376.1| transcriptional regulator, MucR family [Rhodomicrobium vannielii
           ATCC 17100]
          Length = 163

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 61/134 (45%), Positives = 87/134 (64%), Gaps = 4/134 (2%)

Query: 7   FDSSE-RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
            DS+E      T D+VAAYV+N+V+    +   I  V+ AL +  +++      +   L 
Sbjct: 2   VDSNEIELTSFTADVVAAYVANNVISADKLPDFIVSVYGALSKAATQSVEPAKPE---LT 58

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PAVP++KS+    + CLEDG +FKSLKRHLKTH++++P++YR KW L  DYPMV+  YA 
Sbjct: 59  PAVPVKKSVTQDFIICLEDGKKFKSLKRHLKTHYDLSPEDYREKWGLPHDYPMVAPAYAA 118

Query: 126 TRSKLAKNMGLGRG 139
            RS LAK+MGLG+ 
Sbjct: 119 ARSNLAKSMGLGQR 132


>gi|154253347|ref|YP_001414171.1| MucR family transcriptional regulator [Parvibaculum lavamentivorans
           DS-1]
 gi|154157297|gb|ABS64514.1| transcriptional regulator, MucR family [Parvibaculum
           lavamentivorans DS-1]
          Length = 168

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 65/152 (42%), Positives = 91/152 (59%), Gaps = 13/152 (8%)

Query: 1   MDDDASFDSSE--RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           M++  S  S +    L +  +IVAAYVSN+ +   DI  +I  VHS L  +      ++ 
Sbjct: 21  MNETRSSVSGDTTEILRLATEIVAAYVSNNAIAANDIAGMIRAVHSTLSDLGQGVSAKEA 80

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
                L PAVP++KS+ +  + CLEDG + K LKR+L++   +TP+EYR +WNL  DYPM
Sbjct: 81  ----DLAPAVPVKKSVTSDYIVCLEDGKKLKMLKRYLRSQFGLTPEEYRARWNLPHDYPM 136

Query: 119 VSREYATTRSKLAKNMGLG-------RGRKKR 143
           V+  YA  RSKLAK +GLG       RGRKK+
Sbjct: 137 VAPNYAAQRSKLAKQIGLGRVGTAPARGRKKK 168


>gi|289609743|emb|CBI60393.1| unnamed protein product [Sordaria macrospora]
          Length = 137

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 59/140 (42%), Positives = 82/140 (58%), Gaps = 4/140 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D   +  +  + +T DIVAA+V N+ V + DI  LI  VH AL  + + A          
Sbjct: 2   DIHAERDDTLIALTADIVAAHVGNNHVDVGDIAVLIRSVHDALNDLGAPAEPVAPPAEPA 61

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           +     +R S++   + CLEDG + K LKRHL TH+N+TP++YR KWNL +DYPMV+  Y
Sbjct: 62  VP----VRASVKPDFIVCLEDGRKLKMLKRHLMTHYNLTPEQYRAKWNLPADYPMVAPNY 117

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           A  R  LAK +GLG  R+ R
Sbjct: 118 AEQRRTLAKKIGLGTQRRTR 137


>gi|296114159|ref|ZP_06832814.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295979235|gb|EFG85958.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 163

 Score =  190 bits (483), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 82/139 (58%), Gaps = 6/139 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D+ +   +   + +T DIVA+++S++ +P   I  LI  V++AL  V  +        
Sbjct: 1   MSDNETKGINTLHV-LTTDIVASFLSSNSLPTEQIPELIHQVYNALTSVEDKQEVSSV-- 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
              L PAVPI+KS+    + CLEDG + K LKRHL T   MTP +YR KW L S+YPMV+
Sbjct: 58  ---LTPAVPIKKSVFPDYIICLEDGKKLKMLKRHLMTAFGMTPADYRTKWGLPSNYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRG 139
             Y   RSKLAK +GLG+ 
Sbjct: 115 PAYGEQRSKLAKEIGLGKK 133


>gi|330992345|ref|ZP_08316293.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329760544|gb|EGG77040.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 193

 Score =  190 bits (482), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 84/136 (61%), Gaps = 4/136 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D         + MT +IVAA+ +++ V +  I  L+  V+++L+ +      +  V+P  
Sbjct: 28  DNKDIPHTELVSMTTEIVAAHANHNTVAIDQIPLLVETVYASLKGLG----AEKAVEPAP 83

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           L+PAVPI+KS+    + CLEDG + K LKRHL+T + MTP++YR KW L ++YPM +  Y
Sbjct: 84  LQPAVPIKKSVFPDYVICLEDGKKLKMLKRHLQTAYGMTPEQYREKWGLPANYPMTAPNY 143

Query: 124 ATTRSKLAKNMGLGRG 139
           A  RS LA+ +GLGR 
Sbjct: 144 AAHRSSLAQKIGLGRK 159


>gi|150378046|ref|YP_001314641.1| MucR family transcriptional regulator [Sinorhizobium medicae
           WSM419]
 gi|150032593|gb|ABR64708.1| transcriptional regulator, MucR family [Sinorhizobium medicae
           WSM419]
          Length = 151

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 57/145 (39%), Positives = 88/145 (60%), Gaps = 2/145 (1%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
               S+E  LE+T  IV+AY+S +V+  +++  LI   + +L +  +  P +     E  
Sbjct: 2   TESRSNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGK--TSEPAKTAATVEEQ 59

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVPI+KS+ +  + CLEDG  FKSLKRHL   + +TP++YR KW L +DYPMV+  YA
Sbjct: 60  RPAVPIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYREKWKLPADYPMVAPNYA 119

Query: 125 TTRSKLAKNMGLGRGRKKRVLTSKV 149
             RS+LA+  GLG+    ++  +  
Sbjct: 120 RKRSELARATGLGKKSAAKLSQASA 144


>gi|16125185|ref|NP_419749.1| transcriptional regulator [Caulobacter crescentus CB15]
 gi|13422205|gb|AAK22917.1| transcriptional regulator [Caulobacter crescentus CB15]
          Length = 191

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 55/137 (40%), Positives = 80/137 (58%), Gaps = 3/137 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           + +     +E+T +IVA YV+N+  P++++ +LI   H AL  + S  P        +  
Sbjct: 49  NVEDKATLIELTAEIVANYVANNSTPVSELPALIRATHDALAGIGSP-PAPTVEVVTKAT 107

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PA  IRKSI    L   EDG  +K+LKRHL T H MT  EY+ KW L +DYP  +  Y+ 
Sbjct: 108 PA-QIRKSITPEALISFEDGKPYKTLKRHLTT-HGMTVAEYKAKWGLPNDYPTTAPAYSE 165

Query: 126 TRSKLAKNMGLGRGRKK 142
            RS++AK +GLG+G +K
Sbjct: 166 ARSQMAKALGLGQGGRK 182


>gi|170743649|ref|YP_001772304.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197923|gb|ACA19870.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 143

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 63/147 (42%), Positives = 85/147 (57%), Gaps = 5/147 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +          +E+T  I+AAYVS +  P+ D+  LI  VH AL ++          +
Sbjct: 1   MAEMRENAPETDTVELTAAIIAAYVSKNATPVGDLPGLIASVHDALNQLS----APPAEE 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P  L P +PI+K++    +  LEDG Q+KSLKRHL T   +TPDEYR KW L  DYPMV+
Sbjct: 57  PAPLTPLMPIKKTVTPDYIVSLEDGRQYKSLKRHLGTR-GLTPDEYRRKWGLPPDYPMVA 115

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTS 147
             YA  RS+LAK  GLG+GR  +  T+
Sbjct: 116 ANYAAKRSELAKASGLGQGRGGKARTA 142


>gi|220915063|ref|YP_002490371.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952814|gb|ACL63204.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 150

 Score =  189 bits (481), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 60/140 (42%), Positives = 84/140 (60%), Gaps = 6/140 (4%)

Query: 1   MDDDASFD-SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M D  +    ++  + +T  IV AYV++  VP A++  LI  VH AL  +   +  +  V
Sbjct: 1   MSDTTTSPLPTQDLVSLTAGIVGAYVAHTAVPPAELPDLIASVHGALASLGQPSEPETPV 60

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
               L P+VPI++++    +  LEDG  +KSLKRHL+T H +TP+ YR KW L  DYPMV
Sbjct: 61  ----LVPSVPIKRTVTPDAIISLEDGKPYKSLKRHLRT-HGLTPERYRAKWGLPLDYPMV 115

Query: 120 SREYATTRSKLAKNMGLGRG 139
           +  YA  RS+LAKN GLGR 
Sbjct: 116 AANYAAQRSELAKNSGLGRK 135


>gi|304320995|ref|YP_003854638.1| ROSMUCR transcriptional regulator [Parvularcula bermudensis
           HTCC2503]
 gi|303299897|gb|ADM09496.1| ROSMUCR transcriptional regulator [Parvularcula bermudensis
           HTCC2503]
          Length = 155

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 58/140 (41%), Positives = 87/140 (62%), Gaps = 7/140 (5%)

Query: 1   MDDDASFDSS---ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQD 57
           MD+  + D S      L +T +IV+A+VSN+ VP   +  L+    + L  +  +     
Sbjct: 1   MDEIQAPDESLSKSETLNLTTEIVSAFVSNNSVPADQLQELLQSTFNTLNNLGGQIELPQ 60

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
           + Q    KPAVP++KSI +  + CLEDG + K LKR+L+T ++M+P++YR KWNL +DYP
Sbjct: 61  SSQ----KPAVPVKKSITDDYIICLEDGKKLKMLKRYLRTQYDMSPEDYRRKWNLPADYP 116

Query: 118 MVSREYATTRSKLAKNMGLG 137
           MV+  YA  RS+ AK +GLG
Sbjct: 117 MVAPSYAKRRSEFAKKIGLG 136


>gi|162147192|ref|YP_001601653.1| ROS/MUCR transcriptional regulator protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209544245|ref|YP_002276474.1| MucR family transcriptional regulator [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161785769|emb|CAP55340.1| ROS/MUCR transcriptional regulator protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531922|gb|ACI51859.1| transcriptional regulator, MucR family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 134

 Score =  189 bits (480), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 59/138 (42%), Positives = 80/138 (57%), Gaps = 5/138 (3%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           A+        ++T  I AAYVS + V  A +  LI  ++  L  +          +PER 
Sbjct: 2   ANETGKGDLRDLTAQITAAYVSGNSVETAALPELIQKIYVTLDGLGRVV-----AEPERP 56

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
            PAV  +KSI    + CLEDG + K LKRHLKT +N+TPDEYR +W L  DYPMV+  YA
Sbjct: 57  VPAVSPKKSIFPDYIVCLEDGKKLKMLKRHLKTAYNLTPDEYRERWGLPHDYPMVAPNYA 116

Query: 125 TTRSKLAKNMGLGRGRKK 142
           + RS LA+ +GLG  R++
Sbjct: 117 SHRSSLARKIGLGTKREE 134


>gi|319780796|ref|YP_004140272.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166684|gb|ADV10222.1| ROSMUCR transcriptional regulator [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 153

 Score =  188 bits (479), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 62/149 (41%), Positives = 84/149 (56%), Gaps = 5/149 (3%)

Query: 1   MDDDA-SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M DD+ S       LE+T  IV+AYV  + +P + +  LI  V +++  +   A      
Sbjct: 1   MTDDSNSARKDIDLLELTAHIVSAYVEKNRLPASGLADLIASVSASISGLGKPAVPVAAP 60

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
               L PAV  +KS+    + CLEDG +FKSLKRH+  H  +TPD YR KW L SDYPMV
Sbjct: 61  ----LVPAVNPKKSVTPDFIICLEDGKKFKSLKRHIGVHFGLTPDAYRAKWGLPSDYPMV 116

Query: 120 SREYATTRSKLAKNMGLGRGRKKRVLTSK 148
           +  YA +RS LAK++GLGR        +K
Sbjct: 117 APNYAASRSLLAKSIGLGRKAAPVKAPAK 145


>gi|328544572|ref|YP_004304681.1| ROS/MUCR transcriptional regulator protein [polymorphum gilvum
           SL003B-26A1]
 gi|326414314|gb|ADZ71377.1| ROS/MUCR transcriptional regulator protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 117

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 65/118 (55%), Positives = 86/118 (72%), Gaps = 3/118 (2%)

Query: 26  SNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDG 85
           SN+ V   D+ +LI DV++ALQR       Q   +PE LKPAVP++KS+    + CLEDG
Sbjct: 2   SNNTVASTDLPALINDVYTALQRTSG---AQAEPEPEPLKPAVPVKKSVMPDYIICLEDG 58

Query: 86  MQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKKR 143
            +FKSLKRHL+TH++MTP+EYR KW+L +DYPMV+  YA  RS+LAK MGLG+ RK+ 
Sbjct: 59  KKFKSLKRHLRTHYDMTPEEYREKWDLPADYPMVAPNYAAARSELAKKMGLGQQRKRS 116


>gi|170738431|ref|YP_001767086.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168192705|gb|ACA14652.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 133

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 60/140 (42%), Positives = 86/140 (61%), Gaps = 7/140 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D+ + +     + M  DI+AAYVS++ VP+A++ +LI  V+  L R+          +
Sbjct: 1   MSDEYATE--LDPITMAADIIAAYVSHNSVPVAELPALIQAVYDQLGRLGQP----PAPE 54

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PER  P +PI++++    +  LEDG  +KSLKRHL T   +TP++YR KW L  DYPMV+
Sbjct: 55  PERPVPPIPIKRTVTPDAIISLEDGRPYKSLKRHLSTR-GLTPEQYRDKWGLPPDYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGR 140
             YA  RS+LAK  GLGR R
Sbjct: 114 ANYAAQRSELAKASGLGRRR 133


>gi|16519897|ref|NP_444017.1| conserved transcriptional regulator, MucR-family [Sinorhizobium
           fredii NGR234]
 gi|2497994|sp|P55613|Y4PD_RHISN RecName: Full=Putative mucR family transcriptional regulatory
           protein y4pD
 gi|2182573|gb|AAB91814.1| conserved transcriptional regulator, MucR-family [Sinorhizobium
           fredii NGR234]
          Length = 171

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 62/138 (44%), Positives = 89/138 (64%), Gaps = 1/138 (0%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           +     S +R LE+T  +V+AY+S ++VP AD+ SLI   + +L    S+A   +    E
Sbjct: 2   NQPRLASGQRNLELTSRVVSAYLSRNIVPAADLASLIQQTYLSLCS-TSQADKAEEAAVE 60

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
             +PAVPI+KS+    + CLEDG +FKSLKRHL   + +TP +YR KW L +DYPMV+  
Sbjct: 61  EQRPAVPIKKSVTADFIICLEDGKKFKSLKRHLMAKYGLTPQQYREKWGLPADYPMVASS 120

Query: 123 YATTRSKLAKNMGLGRGR 140
           YA  RS+LA+ +GLG+ R
Sbjct: 121 YAQKRSELARALGLGKKR 138


>gi|220922944|ref|YP_002498246.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219947551|gb|ACL57943.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 134

 Score =  188 bits (478), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 58/134 (43%), Positives = 81/134 (60%), Gaps = 5/134 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
             +   + + +  DIV+AYVS++ VPM+++ +LI  V   L  +   A      + E L 
Sbjct: 4   GTEPDSKLITLVTDIVSAYVSHNSVPMSELPTLIQSVSDQLGSLGQPA----EPESEPLV 59

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           P VPI+K++    +  LEDG  +KSLKRHL T   +TP+EYR KW L  DYPMV+  YA 
Sbjct: 60  PPVPIKKTVMPDAIISLEDGRPYKSLKRHLSTR-GLTPEEYRKKWGLPPDYPMVAANYAA 118

Query: 126 TRSKLAKNMGLGRG 139
            RS+LAK +GLGR 
Sbjct: 119 QRSELAKRIGLGRK 132


>gi|307315968|ref|ZP_07595458.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
 gi|306898384|gb|EFN29081.1| transcriptional regulator, MucR family [Sinorhizobium meliloti
           BL225C]
          Length = 149

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 59/143 (41%), Positives = 87/143 (60%), Gaps = 2/143 (1%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
               S+E  LE+T  IV+AY+S +V+  +++  LI   + +L    + AP +     E+ 
Sbjct: 2   TESRSNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGN--TSAPAKTPATVEKQ 59

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVPI+KS+ +  + CLEDG  FKSLKRHL     +TP++YR KW L  DYPMV+  YA
Sbjct: 60  RPAVPIKKSVTDDFIVCLEDGKSFKSLKRHLMAKFALTPEQYREKWKLPPDYPMVAPNYA 119

Query: 125 TTRSKLAKNMGLGRGRKKRVLTS 147
             RS+LA+  GLG+    ++  S
Sbjct: 120 RKRSELARATGLGKKSAAKLPPS 142


>gi|58038621|ref|YP_190585.1| transcriptional regulator [Gluconobacter oxydans 621H]
 gi|58001035|gb|AAW59929.1| Transcriptional regulator [Gluconobacter oxydans 621H]
          Length = 155

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 58/139 (41%), Positives = 85/139 (61%), Gaps = 6/139 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++ S   S   LE+T  IVAA  S   +    + +LI  V+ AL +       ++  Q
Sbjct: 1   MSENTS---STGLLELTAKIVAAQASRGTLEAEALPALIRQVYDALAKAGVP---EEEPQ 54

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            ER +PAVPI++S+    + CLEDG + K LKRHL++ ++MTP++YR +W L SDYP+V+
Sbjct: 55  SERPQPAVPIKRSVFPDYIICLEDGKKLKMLKRHLQSAYDMTPEQYRERWGLPSDYPLVA 114

Query: 121 REYATTRSKLAKNMGLGRG 139
             YA  RS LA+ +GLGR 
Sbjct: 115 PNYAQRRSALAREIGLGRK 133


>gi|330991166|ref|ZP_08315119.1| Putative mucR family transcriptional regulatory protein y4pD
           [Gluconacetobacter sp. SXCC-1]
 gi|329761752|gb|EGG78243.1| Putative mucR family transcriptional regulatory protein y4pD
           [Gluconacetobacter sp. SXCC-1]
          Length = 136

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 59/142 (41%), Positives = 85/142 (59%), Gaps = 8/142 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D+    +     E+  +IV+AYVS + +    +  LI  V+ A+  +    P      
Sbjct: 2   MADET---AEVEVRELAAEIVSAYVSRNELEAEMLPDLIHRVYDAVASLGRTEPV----- 53

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+  PAVP++KS+    + CLEDG + K LKRHLKT +NMTPDEYR +W L  DYPMV+
Sbjct: 54  PEKPVPAVPLKKSVFPDYIVCLEDGKKLKMLKRHLKTAYNMTPDEYRERWGLPHDYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA+ RS LA+ +GLG  +++
Sbjct: 114 PSYASHRSTLARKIGLGTKQRE 135


>gi|170740146|ref|YP_001768801.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168194420|gb|ACA16367.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 143

 Score =  187 bits (476), Expect = 4e-46,   Method: Composition-based stats.
 Identities = 61/148 (41%), Positives = 88/148 (59%), Gaps = 5/148 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +     S    +E+T  I+AAYVS +  PM D+  +I  VH AL ++   +      +
Sbjct: 1   MAEMRENASETDAIELTAAIIAAYVSKNATPMGDLPGVIASVHDALIQLSKPSAA----E 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P  L P VPI++++    +  LEDG Q+KSLKRHL+T   +TP++YR KW L  DYPMV+
Sbjct: 57  PAPLVPPVPIKRTVTPDFIISLEDGRQYKSLKRHLRTR-GLTPEQYRQKWGLPPDYPMVA 115

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSK 148
             YA  RS+LAK++GLG+ R+      K
Sbjct: 116 ANYAAQRSELAKSIGLGQSRRAAGQKGK 143


>gi|220923967|ref|YP_002499269.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948574|gb|ACL58966.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 141

 Score =  187 bits (475), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 59/146 (40%), Positives = 82/146 (56%), Gaps = 5/146 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D  +   ++    +T  IV AYV+++ VP A++  LI  VH AL  +   A  +    
Sbjct: 1   MNDSTTTPPAQDLAGLTARIVGAYVAHNAVPTAELPVLIASVHGALAALGRPAEHEAPA- 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
              L P VPIRK++    +  LEDG  +KSLKRHL T   +TP++YR KW L   YPMV+
Sbjct: 60  ---LVPPVPIRKTVTPDAIISLEDGRPYKSLKRHLATR-GLTPEQYREKWGLPPTYPMVA 115

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLT 146
             YA  RS+LAK  GLGR  + +   
Sbjct: 116 ESYAERRSELAKQFGLGRRAEAKAAA 141


>gi|222084376|ref|YP_002542905.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Agrobacterium radiobacter K84]
 gi|221721824|gb|ACM24980.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Agrobacterium radiobacter K84]
          Length = 172

 Score =  186 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 65/140 (46%), Positives = 90/140 (64%), Gaps = 3/140 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D +   +    +  V IV+AYVS++ VP+  +  LITDVH ALQ +    P   +V+  +
Sbjct: 32  DLTQLQASSLSDGCVKIVSAYVSHNTVPIGSLSKLITDVHEALQTLDGTTP---SVERSK 88

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             PAV ++KS+ N  + CLEDG +FK+LKRHL+ H+ MTP+EYR KW LA  YPMV++ Y
Sbjct: 89  PVPAVDLKKSVTNDYIICLEDGKRFKTLKRHLRVHYGMTPEEYRQKWGLAPTYPMVAQNY 148

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           A  RS+LAK  GLG    K+
Sbjct: 149 ANRRSELAKLSGLGANGNKK 168


>gi|288958413|ref|YP_003448754.1| transcriptional regulatory protein [Azospirillum sp. B510]
 gi|288910721|dbj|BAI72210.1| transcriptional regulatory protein [Azospirillum sp. B510]
          Length = 136

 Score =  186 bits (474), Expect = 6e-46,   Method: Composition-based stats.
 Identities = 58/132 (43%), Positives = 79/132 (59%), Gaps = 3/132 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
                  +T  +VAAYV N+ VP+ D+ +LI  V  A + +    P     +   L PAV
Sbjct: 4   DQTELQSLTAKVVAAYVGNNSVPVQDLPTLINSVQVAFRSLGDDKPVPAKAE---LVPAV 60

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            I+KS+    + CLEDG + K LKRHLKT ++MTPD+YR KW L  +YPMV+  YA  RS
Sbjct: 61  AIKKSVTPEYIVCLEDGKKLKMLKRHLKTVYDMTPDDYRAKWGLPPEYPMVAPNYAKARS 120

Query: 129 KLAKNMGLGRGR 140
           ++A  +GLGR R
Sbjct: 121 EMATKLGLGRKR 132


>gi|170744770|ref|YP_001773425.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168199044|gb|ACA20991.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 143

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 62/148 (41%), Positives = 83/148 (56%), Gaps = 5/148 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +          +E+T  I AAYVS + +P+ D+  +I  VH AL ++          +
Sbjct: 1   MAEMRENAPEIDTIELTAAITAAYVSKNAIPVGDLPGVIASVHDALIQLSKP----PAAE 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P  L P VPI+K+I    L  LEDG Q+KSLKRHL T   +TP++YR KW L  DYPMV+
Sbjct: 57  PAPLVPPVPIKKTITPDFLISLEDGRQYKSLKRHLSTR-GLTPEQYRQKWGLPPDYPMVA 115

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSK 148
             YA  RS+LAK  GLG+ R+      K
Sbjct: 116 ANYAAQRSELAKASGLGQSRRAAGQKGK 143


>gi|170746525|ref|YP_001752785.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170653047|gb|ACB22102.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 166

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 56/142 (39%), Positives = 89/142 (62%), Gaps = 4/142 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++A  +     + + VDIVAAYVSN+ VP++++  LI  +H+AL  + ++    ++  
Sbjct: 1   MSENAGSEHGPA-IGLAVDIVAAYVSNNSVPVSELPGLIGGIHAALNGLTTQGRAANSA- 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+L P+  IRKS+    +   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM +
Sbjct: 59  VEKLSPS-QIRKSVTTDHIVSFEDGKPYKTLRRHL-TLRGLTPEAYREKWGLPRDYPMTA 116

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+  RS+LA+ +GLG+ R+K
Sbjct: 117 ASYSAQRSELARALGLGQQRRK 138


>gi|254293738|ref|YP_003059761.1| MucR family transcriptional regulator [Hirschia baltica ATCC 49814]
 gi|254042269|gb|ACT59064.1| transcriptional regulator, MucR family [Hirschia baltica ATCC
           49814]
          Length = 142

 Score =  186 bits (474), Expect = 7e-46,   Method: Composition-based stats.
 Identities = 61/145 (42%), Positives = 88/145 (60%), Gaps = 5/145 (3%)

Query: 1   MDDDASFD--SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           M D+      S    + MT  IV+++VSN+ VP  ++  +I  VH  +  +   A  Q++
Sbjct: 1   MTDEIENKLLSQNEIMRMTSAIVSSFVSNNPVPTDNLPDVIRSVHKTVTNL---AQPQES 57

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
              ER KPAVP  KSI    + CLEDG + K LKR+L++ ++M+PDEYR +W L SDYPM
Sbjct: 58  KSDERPKPAVPASKSITEEYIVCLEDGKKLKMLKRYLRSRYDMSPDEYRRRWGLPSDYPM 117

Query: 119 VSREYATTRSKLAKNMGLGRGRKKR 143
           V+  Y   RS+ AK +GLG+G +K 
Sbjct: 118 VAPSYTARRSEFAKKIGLGKGGRKS 142


>gi|85709116|ref|ZP_01040182.1| predicted transcriptional regulator [Erythrobacter sp. NAP1]
 gi|85690650|gb|EAQ30653.1| predicted transcriptional regulator [Erythrobacter sp. NAP1]
          Length = 161

 Score =  186 bits (473), Expect = 8e-46,   Method: Composition-based stats.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 4/138 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
            D   +  E  + +T DIVAA++SN+ V +  +  LIT+V+ AL  +   +  ++     
Sbjct: 18  QDLDMEMKETLITLTSDIVAAHLSNNNVEVDAVPGLITNVYGALSGLGDESEPEEERPEP 77

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
               AV IR S++   + CLEDG + K LKR+L+T+ +MTP+EYR +W L SDYPMV+  
Sbjct: 78  ----AVSIRASVKPDYIVCLEDGKKLKMLKRYLRTNFDMTPEEYRARWGLPSDYPMVAPN 133

Query: 123 YATTRSKLAKNMGLGRGR 140
           YA  R  LAK +GLGR  
Sbjct: 134 YAEKRRDLAKKIGLGRKP 151


>gi|260464245|ref|ZP_05812438.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259030048|gb|EEW31331.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 154

 Score =  186 bits (473), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 60/140 (42%), Positives = 83/140 (59%), Gaps = 5/140 (3%)

Query: 1   MDDDASFDSSE-RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M DD++    +   LE+T  IV+AYV  + +P + +  LI  V +++  +   A      
Sbjct: 1   MTDDSNDARKDIDLLELTAHIVSAYVEKNRLPASGLADLIASVATSISSLGKPAVPVAAP 60

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
               L PAV  +KS+    + CLEDG +FKSLKRHL  H  ++PD YR KW L SDYPMV
Sbjct: 61  ----LVPAVNPKKSVMPDFIICLEDGKKFKSLKRHLGVHFGLSPDAYRAKWGLPSDYPMV 116

Query: 120 SREYATTRSKLAKNMGLGRG 139
           +  YA +RS LAK++GLGR 
Sbjct: 117 APNYAASRSLLAKSIGLGRK 136


>gi|220922955|ref|YP_002498257.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219947562|gb|ACL57954.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 173

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 58/153 (37%), Positives = 91/153 (59%), Gaps = 10/153 (6%)

Query: 1   MDDDASFDS-----SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPC 55
           M DD +  +     S   + +TV IV+A+++++ +P   + + IT VH++L R++  A  
Sbjct: 1   MPDDITITAANDTGSSDLIPVTVGIVSAFITHNQIPAGGLPAFITSVHASLTRLIKPA-- 58

Query: 56  QDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASD 115
                PE L P VPI+K+I+   +  LEDG  +K+L+RHL     +TP++YR KW L  D
Sbjct: 59  --EPTPEPLVPPVPIKKTIKPDAIISLEDGKPYKTLRRHL-AGRGLTPEQYRQKWGLPPD 115

Query: 116 YPMVSREYATTRSKLAKNMGLGRGRKKRVLTSK 148
           YPM +  YA  RS+LAK  GLG+ R++R    +
Sbjct: 116 YPMTAANYAAQRSELAKASGLGQSRRQRAAEKR 148


>gi|220927437|ref|YP_002502738.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952911|gb|ACL63299.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 162

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 59/145 (40%), Positives = 87/145 (60%), Gaps = 5/145 (3%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           + +  S      +T DIV+AYVS + VP+ ++ +++  VH AL+ + +        +PE+
Sbjct: 2   NETATSGSDLTALTADIVSAYVSKNPVPVGELANVLNTVHDALRSLGNP----PAAEPEK 57

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           L P VPI+K+     L  LEDG  +KSLKRHL T   +TPD+YR KW L  DYPM++  Y
Sbjct: 58  LTPPVPIKKTAMPDYLISLEDGKPYKSLKRHLTTR-GLTPDQYRQKWGLPPDYPMMAANY 116

Query: 124 ATTRSKLAKNMGLGRGRKKRVLTSK 148
           A  RS+LAK  GLG+ R++     +
Sbjct: 117 AAQRSELAKTSGLGQRRQQAAAAKR 141


>gi|163853189|ref|YP_001641232.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|163664794|gb|ABY32161.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
          Length = 140

 Score =  186 bits (472), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 61/142 (42%), Positives = 85/142 (59%), Gaps = 3/142 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +D S  +   ++E++  +V+AYVSN+ V  AD+  LI  VHS L  + S A      Q
Sbjct: 1   MSEDTSS-TQLDYVEISAGLVSAYVSNNSVRAADLPELIRTVHSTLAALKSGAGQGGENQ 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+  PA  I+KSI    L   EDG  +K+LKRHL     +TP  YR K+ LA+DYPM +
Sbjct: 60  IEKPTPA-QIKKSITPDALISFEDGKPYKTLKRHLANR-GLTPGAYREKYGLAADYPMTA 117

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+  RS+LA+ +GLG+ RKK
Sbjct: 118 PGYSARRSELARALGLGQLRKK 139


>gi|193782601|ref|NP_435644.2| Transcriptional regulator, MucR family [Sinorhizobium meliloti
           1021]
 gi|193073057|gb|AAK65056.2| Transcriptional regulator, MucR family [Sinorhizobium meliloti
           1021]
          Length = 149

 Score =  185 bits (471), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 57/135 (42%), Positives = 85/135 (62%), Gaps = 2/135 (1%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
               S+E  LE+T  IV+AY+S +V+  +++  LI   + +L +  +  P +     E  
Sbjct: 2   TESHSNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGK--TSEPTKTPATVEEQ 59

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVPI+KS+ +  + CLEDG  FKSLKRHL   + +TP++YR KW L +DYPMV+  YA
Sbjct: 60  RPAVPIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYREKWKLPADYPMVAPNYA 119

Query: 125 TTRSKLAKNMGLGRG 139
             RS+LA+  GLG+ 
Sbjct: 120 RKRSELARATGLGKK 134


>gi|220921553|ref|YP_002496854.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219946159|gb|ACL56551.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 164

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 59/134 (44%), Positives = 85/134 (63%), Gaps = 5/134 (3%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           A+ ++     E+T DIVAAYVSN+ V  A++ +++  V+  L  ++S         PE+ 
Sbjct: 4   ATEETPTGLTELTSDIVAAYVSNNRVSSAELPAVLRTVYETLNALLSP----PAPAPEKP 59

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
            P +PIRK++    +  LEDG  +KSLKRHL +   +TPDEYR KW L  DYPMV+  YA
Sbjct: 60  VPPIPIRKTVTPDAIISLEDGKPYKSLKRHL-SGRGLTPDEYRQKWGLPPDYPMVAANYA 118

Query: 125 TTRSKLAKNMGLGR 138
             RS+LAK++GLG+
Sbjct: 119 AQRSELAKSLGLGQ 132


>gi|83858222|ref|ZP_00951744.1| transcriptional regulator [Oceanicaulis alexandrii HTCC2633]
 gi|83853045|gb|EAP90897.1| transcriptional regulator [Oceanicaulis alexandrii HTCC2633]
          Length = 140

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 51/144 (35%), Positives = 91/144 (63%), Gaps = 5/144 (3%)

Query: 1   MDDDASFD-SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M ++      +E  + MT DIVA++++++ VP   +  +I  V++ ++ +      +   
Sbjct: 1   MTEETLLPVDNEELMRMTTDIVASFLTHNSVPAESVPDMIKSVYATMKEISG----EPAK 56

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
              + KPAVP+ +S+ +  + CLEDG + K LKR+L++ ++M+P++YR KW L +DYPMV
Sbjct: 57  PEPKAKPAVPVSRSVSDDYIVCLEDGKKLKMLKRYLRSQYDMSPEDYRRKWGLPADYPMV 116

Query: 120 SREYATTRSKLAKNMGLGRGRKKR 143
           +  Y+  RS+ AK +GLGRG +K+
Sbjct: 117 APNYSKRRSEFAKEIGLGRGARKK 140


>gi|170739316|ref|YP_001767971.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193590|gb|ACA15537.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 144

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 56/144 (38%), Positives = 82/144 (56%), Gaps = 5/144 (3%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
             +  S+ R +E+  D+VAA++S + VP   +  LI  VH A+  +   A     V P +
Sbjct: 2   SEAEGSAARNVELVADLVAAFLSYNTVPAGQLPGLIRSVHEAVSGLGKLA----EVVPAK 57

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             P +PIRK++    +  LEDG  +KSLKRHL T   +TP++YR KW L  +YPMV+  Y
Sbjct: 58  PVPPIPIRKTVTPDAIISLEDGKPYKSLKRHL-TGRGLTPEQYREKWGLPPNYPMVAPNY 116

Query: 124 ATTRSKLAKNMGLGRGRKKRVLTS 147
           A  RS+ AK +  G+ R+K    S
Sbjct: 117 AAQRSEFAKALSFGQHRRKGAPPS 140


>gi|150378006|ref|YP_001314601.1| MucR family transcriptional regulator [Sinorhizobium medicae
           WSM419]
 gi|150032553|gb|ABR64668.1| transcriptional regulator, MucR family [Sinorhizobium medicae
           WSM419]
          Length = 149

 Score =  185 bits (470), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 58/143 (40%), Positives = 88/143 (61%), Gaps = 2/143 (1%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
               S+E  LE+T  IV+AY+S +V+  +++  LI   + +L +  +  P +     E  
Sbjct: 2   TESRSNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLGK--TSEPAKTAATVEEQ 59

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           +PAVPI+KS+ +  + CLEDG  FKSLKRHL   + +TP++YR KW L +DYPMV+  YA
Sbjct: 60  RPAVPIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYREKWKLPADYPMVAPNYA 119

Query: 125 TTRSKLAKNMGLGRGRKKRVLTS 147
             RS+LA+  GLG+    ++  S
Sbjct: 120 RKRSELARATGLGKKSAAKLSPS 142


>gi|220922455|ref|YP_002497757.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219947062|gb|ACL57454.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 134

 Score =  185 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 56/133 (42%), Positives = 76/133 (57%), Gaps = 5/133 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
             S     +T  IV+AYV+++ VP A++  LI  +H AL  +   A      +   L P 
Sbjct: 6   TQSPDLAGLTGRIVSAYVAHNAVPAAELPVLIASLHGALAGLGQPA----EPEVPALVPP 61

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VPIRK++    +  LEDG  +K+LKRHL     +TP++YR KW L  DYPM +  YA  R
Sbjct: 62  VPIRKTVTPDAIISLEDGKPYKTLKRHL-AGRGLTPEQYRAKWGLPPDYPMTAANYAAQR 120

Query: 128 SKLAKNMGLGRGR 140
           S+LAK  GLGR R
Sbjct: 121 SELAKKTGLGRLR 133


>gi|220922584|ref|YP_002497886.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219947191|gb|ACL57583.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 140

 Score =  185 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 57/145 (39%), Positives = 82/145 (56%), Gaps = 5/145 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D  +   +     +T  IVA YV+++ VP A++ +LI  VH AL  +          +
Sbjct: 1   MNDTPTTPPALDLAGLTSRIVAGYVTHNAVPAAELPALIVSVHGALAALGKP----SEPE 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
              L P VPIRK++    +  LEDG  +KS+KRHL T   +TP++YR KW L  DYP+V+
Sbjct: 57  APALVPPVPIRKTVTPDAIISLEDGRPYKSMKRHLSTR-GLTPEQYRAKWGLPIDYPIVA 115

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA  RS+LAK  GLGR  + +  
Sbjct: 116 ANYAAQRSELAKQFGLGRRAEAKAA 140


>gi|13473935|ref|NP_105503.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
 gi|14024686|dbj|BAB51289.1| transcriptional regulator [Mesorhizobium loti MAFF303099]
          Length = 151

 Score =  185 bits (469), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 65/133 (48%), Positives = 84/133 (63%), Gaps = 5/133 (3%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            D +   +E+T DIV+AYVSN+ VP+A +  LI  V+ +L +V   A  ++ V    L P
Sbjct: 9   TDENINLIELTADIVSAYVSNNPVPVASLPDLIHSVNLSLSKVGRPAEPENPV----LTP 64

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AV  +KS+    +  LEDG +FKS+KRHL     MTPDEYR KW+L  DYPMV+  YA T
Sbjct: 65  AVNPKKSVFPDYIVSLEDGRKFKSMKRHLG-LLGMTPDEYRTKWDLPRDYPMVAPNYAAT 123

Query: 127 RSKLAKNMGLGRG 139
           RS LAK  GLGR 
Sbjct: 124 RSALAKASGLGRK 136


>gi|296116951|ref|ZP_06835553.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295976517|gb|EFG83293.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 164

 Score =  184 bits (468), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 55/130 (42%), Positives = 76/130 (58%), Gaps = 4/130 (3%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
            +   + +T DIV+AY+ N+ +P   +  LI +V +AL             + E L+PAV
Sbjct: 7   QTPELMSLTTDIVSAYMINNSLPPERVPDLIRNVFAALGATGGDG----QEKAEPLQPAV 62

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PI+KS+    + CLEDG + K LKRHL   + MTP++YR KW L S YPM +  YA  RS
Sbjct: 63  PIKKSVFPDYIICLEDGKKLKMLKRHLDRAYGMTPEQYREKWGLPSHYPMTAPNYAAKRS 122

Query: 129 KLAKNMGLGR 138
            LA+  GLGR
Sbjct: 123 ALAQQSGLGR 132


>gi|220922445|ref|YP_002497747.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219947052|gb|ACL57444.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 168

 Score =  184 bits (468), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 62/142 (43%), Positives = 87/142 (61%), Gaps = 7/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D  S +S    +E+  DIV+AY+SN+ VP +++ +LI  VH+AL  +   A       
Sbjct: 1   MTDSVSTNS----VELATDIVSAYISNNNVPASELPALIQSVHAALGALGKPAAPAVEEA 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P +  PA  IRKSI    +    DG  +KSLKRHL T H MTP++YR K+ L   YPMV+
Sbjct: 57  P-KATPA-QIRKSITPDHMISFIDGKPYKSLKRHL-TKHGMTPEDYRAKFGLPVTYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YA  RS+LAK++GLG+ R++
Sbjct: 114 ESYAAQRSELAKSIGLGQKRQE 135


>gi|170748335|ref|YP_001754595.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654857|gb|ACB23912.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 155

 Score =  184 bits (467), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 63/157 (40%), Positives = 91/157 (57%), Gaps = 11/157 (7%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR---APCQD 57
           M ++ +  +S  F+E+  DIVAAYVSN+ VP A++ +LI  VH A+  +V+    A    
Sbjct: 1   MTEETTGPNS-NFIELAGDIVAAYVSNNPVPAAELPALIARVHGAISGLVTGTLTAEIGA 59

Query: 58  NVQPERLKP-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116
             Q E  KP A  IRKS+ +  +    DG  +K+LKRHL T H + P  YR ++ L +DY
Sbjct: 60  APQAEVEKPSAAQIRKSVRHDGIVSFIDGKTYKTLKRHL-TSHGLDPRSYRDRYGLPADY 118

Query: 117 PMVSREYATTRSKLAKNMGLGR-----GRKKRVLTSK 148
           PMV+  YA  RS LAK +GLG+      R++R   + 
Sbjct: 119 PMVAPSYAEQRSALAKAIGLGQPGAMAERERRGRKAA 155


>gi|240141323|ref|YP_002965803.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens AM1]
 gi|240011300|gb|ACS42526.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens AM1]
          Length = 176

 Score =  184 bits (467), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 55/142 (38%), Positives = 84/142 (59%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MD       + R + +T D+V+AYVSN+ V  A++  L+ +VH A++ V           
Sbjct: 1   MDTSEQDAETARLVTLTADVVSAYVSNNHVQSAELPKLLGEVHEAIRSVSLSGRPTAETG 60

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P +  P   IRKSI +  L   EDG  +K+L+RHL T   ++P++YR KW L +DYPM S
Sbjct: 61  PPKATP-QEIRKSISHDFLVSFEDGKPYKTLRRHL-TLRGLSPEQYRAKWGLPNDYPMTS 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+  RS+LA+ +GLG+ R++
Sbjct: 119 ASYSEQRSELARALGLGQQRRR 140


>gi|163853870|ref|YP_001641913.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|218532815|ref|YP_002423631.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|254563833|ref|YP_003070928.1| RosR/MucR family transcriptional regulator [Methylobacterium
           extorquens DM4]
 gi|163665475|gb|ABY32842.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|218525118|gb|ACK85703.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
 gi|254271111|emb|CAX27118.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens DM4]
          Length = 176

 Score =  184 bits (467), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 55/142 (38%), Positives = 84/142 (59%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MD       + R + +T D+V+AYVSN+ V  A++  L+ +VH A++ V           
Sbjct: 1   MDTSEQDAETARLVTLTADVVSAYVSNNHVQSAELPKLLGEVHEAIRSVSLSGRPTAETG 60

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P +  P   IRKSI +  L   EDG  +K+L+RHL T   ++P++YR KW L +DYPM S
Sbjct: 61  PPKATP-QEIRKSISHDFLVSFEDGKPYKTLRRHL-TLRGLSPEQYRAKWGLPNDYPMTS 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+  RS+LA+ +GLG+ R++
Sbjct: 119 ASYSEQRSELARALGLGQQRRR 140


>gi|170739339|ref|YP_001767994.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193613|gb|ACA15560.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 146

 Score =  184 bits (467), Expect = 4e-45,   Method: Composition-based stats.
 Identities = 57/146 (39%), Positives = 84/146 (57%), Gaps = 4/146 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           D + D  E  + +T D+++AYVSN+ V   ++  LI +VHSAL  +   A      +P +
Sbjct: 2   DGTSDKRESAITLTADVISAYVSNNHVQTGELVRLIREVHSALVGI---AEGVRPAEPPQ 58

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
              A  IR+SI +  L   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM S  Y
Sbjct: 59  KATAAEIRRSINHDFLISFEDGKPYKTLRRHL-TMRGLTPESYRRKWGLPPDYPMTSASY 117

Query: 124 ATTRSKLAKNMGLGRGRKKRVLTSKV 149
           +  RS+LA+ +GLG+ R++R      
Sbjct: 118 SEQRSQLARTLGLGQQRRRRGQAEAA 143


>gi|87199007|ref|YP_496264.1| MucR family transcriptional regulator [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134688|gb|ABD25430.1| transcriptional regulator, MucR family [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 145

 Score =  183 bits (466), Expect = 6e-45,   Method: Composition-based stats.
 Identities = 63/147 (42%), Positives = 90/147 (61%), Gaps = 4/147 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
            +   D  E  + +T DIVAA+VSN+ V ++D+ +LIT+V+SAL  +   AP ++     
Sbjct: 2   TEIQNDMRETLITLTSDIVAAHVSNNSVAVSDLPTLITNVYSALAGLDQPAPAEEPAPEP 61

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
                V IR S++N  + CLEDG + K LKRHL T +NMTP++YR +WNL +DYPMV+  
Sbjct: 62  A----VSIRSSVKNDHIVCLEDGKKLKMLKRHLATRYNMTPEQYRARWNLPADYPMVAPA 117

Query: 123 YATTRSKLAKNMGLGRGRKKRVLTSKV 149
           YA  R +LAK +GLGR    +      
Sbjct: 118 YAEKRRELAKKIGLGRKPAPKRARKAA 144


>gi|220920031|ref|YP_002495333.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952861|gb|ACL63250.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 147

 Score =  183 bits (465), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 56/144 (38%), Positives = 85/144 (59%), Gaps = 10/144 (6%)

Query: 1   MDDDASFDSSER-----FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPC 55
           M +D +  ++        +  T DIV+A+++++ VP+ D+  L+T VH++L  +   A  
Sbjct: 1   MPNDITITAANDVESLYLIATTADIVSAFLAHNPVPVTDLPPLLTAVHASLTGLTKPA-- 58

Query: 56  QDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASD 115
               +PE L P VPIRK+I    +  LEDG  +K+L RHL     +TP++YR KW L ++
Sbjct: 59  --EPKPEPLVPPVPIRKTITPDAIISLEDGQPYKTLARHLG-RLGLTPEQYRAKWGLPTN 115

Query: 116 YPMVSREYATTRSKLAKNMGLGRG 139
           YPM +  YA  RS+LAK  GLGR 
Sbjct: 116 YPMTAPNYAAQRSELAKKHGLGRK 139


>gi|170743583|ref|YP_001772238.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197857|gb|ACA19804.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 158

 Score =  183 bits (464), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 60/137 (43%), Positives = 85/137 (62%), Gaps = 6/137 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M  + + D     + +  DIV+AYV+ + VP   +  L++ VH+AL+ +          +
Sbjct: 1   MTAEKTGDGGND-VALASDIVSAYVTRNAVPPTALPELLSSVHAALRGLRHGVAA----E 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+L P V IRKS+    +  LEDG Q+KSLKRHL T   +TP++YR KWNL  DYPMV+
Sbjct: 56  PEKLVPPVSIRKSVTPDYIISLEDGRQYKSLKRHLATR-GLTPEQYRRKWNLPPDYPMVA 114

Query: 121 REYATTRSKLAKNMGLG 137
             YA  RS+LAK++GLG
Sbjct: 115 ANYAAQRSELAKSIGLG 131


>gi|118588427|ref|ZP_01545836.1| transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118439133|gb|EAV45765.1| transcriptional regulator [Stappia aggregata IAM 12614]
          Length = 140

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 59/140 (42%), Positives = 84/140 (60%), Gaps = 3/140 (2%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
            ++ +   S   + +T  IV+ YV+N+ VP  D+  LI DVH AL+   +  P       
Sbjct: 4   SEEGATYDSPNLMALTAGIVSNYVTNNPVPQQDLIELILDVHVALETATNNTPTVFRAP- 62

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
             L PAVPI++S+    + CLEDG +FK L RHLKT  N+TP EYR KW L++DYPMV+ 
Sbjct: 63  --LVPAVPIKQSVTPEFIVCLEDGKKFKFLTRHLKTKFNLTPAEYRRKWGLSADYPMVAP 120

Query: 122 EYATTRSKLAKNMGLGRGRK 141
            YA  R+++AK   LG  ++
Sbjct: 121 NYAQKRAEMAKAAKLGHRKR 140


>gi|220921800|ref|YP_002497101.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219946406|gb|ACL56798.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 160

 Score =  183 bits (464), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 63/138 (45%), Positives = 91/138 (65%), Gaps = 6/138 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M  + + D++  ++ +  DIV+AYV+ + VP + +  L+T VH+AL+ +   A      +
Sbjct: 1   MTAETNLDAA-DYIALASDIVSAYVTRNAVPASSLPELLTSVHAALRDLQKAAA----PE 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE+L P V IRKS+    +  LEDG Q+KSLKRHL T   +TP+EYR KWNL  DYPMV+
Sbjct: 56  PEKLVPPVSIRKSVTPDYIISLEDGRQYKSLKRHLATR-GLTPEEYRRKWNLPPDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGR 138
             YA  RS+LAK++GLG+
Sbjct: 115 ANYAAQRSELAKSIGLGQ 132


>gi|220922341|ref|YP_002497643.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219946948|gb|ACL57340.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 176

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 62/151 (41%), Positives = 89/151 (58%), Gaps = 6/151 (3%)

Query: 1   MDDDA---SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQD 57
           M D+A   +  S    +++   IV+AYVSNHVV  AD+  LI  V   L  +   +    
Sbjct: 1   MSDEAGTVTLQSEMNTIDLVAAIVSAYVSNHVVRPADLPDLIAAVSQTLGGLGKPSEPAV 60

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
              P +L PA  IRKSI    +    DG  +KS+KRHL T + +TP EYR+K+ L +DYP
Sbjct: 61  EETP-KLTPA-QIRKSITPDHIVSFIDGKLYKSMKRHL-TKNGLTPAEYRMKFGLPTDYP 117

Query: 118 MVSREYATTRSKLAKNMGLGRGRKKRVLTSK 148
           MV+  YA  RS+LAK +GLG+ R++R + ++
Sbjct: 118 MVAPSYAAQRSELAKKLGLGQLRRERAVQNR 148


>gi|218532693|ref|YP_002423509.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218524996|gb|ACK85581.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 166

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 62/142 (43%), Positives = 85/142 (59%), Gaps = 6/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D+ S D     L MT DIVAA+VSN+ VP +++ +L+  VH A   + +        +
Sbjct: 1   MEDNTSPD----LLTMTADIVAAFVSNNSVPASELPNLLVQVHGAFASLSAAPWANAGNE 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+  PA  I+KSI    L    DG  +++LKRHL T H ++ DEYR ++ L SDYP VS
Sbjct: 57  IEKPTPA-QIKKSITPDALISFVDGKPYRTLKRHL-TVHGLSVDEYRSRYGLPSDYPSVS 114

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+ TRS LAK +GLG  RKK
Sbjct: 115 ANYSATRSALAKQLGLGNQRKK 136


>gi|209542180|ref|YP_002278361.1| transcriptional regulator, MucR family [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533360|gb|ACI53296.1| transcriptional regulator, MucR family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 185

 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 54/135 (40%), Positives = 75/135 (55%), Gaps = 3/135 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           D  S       L +T  IV+AY + + +P  ++  LI  V+ AL  +          +P 
Sbjct: 10  DQKSAADQTGLLALTAAIVSAYAARNPLPAIELPGLIRTVYDALSSLGQVTTSPAAPEP- 68

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
              PAVP +KS+    + CLEDG  FK+LKRHL+  + MTP++YR KW L  DYPMV+  
Sbjct: 69  --IPAVPPKKSVFPDHIICLEDGKPFKALKRHLRAAYGMTPEDYRAKWKLPPDYPMVAPN 126

Query: 123 YATTRSKLAKNMGLG 137
           YA  RS  A+ +GLG
Sbjct: 127 YAAYRSSQARAIGLG 141


>gi|220925469|ref|YP_002500771.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219950076|gb|ACL60468.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 174

 Score =  182 bits (462), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 59/148 (39%), Positives = 85/148 (57%), Gaps = 6/148 (4%)

Query: 1   MDDDASFDSSER---FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQD 57
           M+D+A   +S+     +E+  DIV+AYVSN+VV  AD+  LI  V   L  +   +    
Sbjct: 1   MNDEAGAPTSQSEAGTIELVADIVSAYVSNNVVRPADLPDLIAAVSRTLGELGKPSVPAA 60

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
              P+    A  IRKSI    +    DG  +KS+KRHL T + +TP EYR ++ L + YP
Sbjct: 61  EETPKPT--AAQIRKSITPDHIVSFIDGKPYKSMKRHL-TKNGLTPAEYRQQYGLPASYP 117

Query: 118 MVSREYATTRSKLAKNMGLGRGRKKRVL 145
           MV+  YA  RS+LAK++GLG+ R+K   
Sbjct: 118 MVAPNYAAQRSELAKSLGLGQLRRKAAE 145


>gi|220924130|ref|YP_002499432.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948737|gb|ACL59129.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 147

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 60/148 (40%), Positives = 82/148 (55%), Gaps = 7/148 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D  +   S     +   IV AYV+++ VP A++  LI   H+ALQ +           
Sbjct: 1   MPDIDT--QSPGLAGLAARIVGAYVAHNAVPAAELPGLIASTHAALQDLGK----APEPA 54

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE L P VPIRK++    +  LE G  +K+LKRHL     +TP++YR KW L  DYPMV+
Sbjct: 55  PEPLVPPVPIRKTVTPDAIISLEVGKPYKTLKRHL-AGRGLTPEQYRTKWGLPPDYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSK 148
             YA  RS+LAK+ GLGRG  +  L  +
Sbjct: 114 ANYAAHRSELAKSSGLGRGSAQAHLGGR 141


>gi|220924920|ref|YP_002500222.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219949527|gb|ACL59919.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 139

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 59/139 (42%), Positives = 78/139 (56%), Gaps = 5/139 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
             S     +T  IV AYV+++ VP A++  LI  VH AL  +   A  +       L P 
Sbjct: 6   PQSPDLAGLTGRIVGAYVAHNAVPTAELPGLIAAVHGALAALGRPAEPEAPA----LVPP 61

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VPIRK++    +  LEDG  +KSLKRHL T   +TP++YR KW L  DYPMV+  YA  R
Sbjct: 62  VPIRKTVTPDAIISLEDGKPYKSLKRHLTTR-GLTPEQYRAKWGLPVDYPMVAANYAAHR 120

Query: 128 SKLAKNMGLGRGRKKRVLT 146
           S+LAK  GLGR  +   + 
Sbjct: 121 SELAKAAGLGRKPQLAAVA 139


>gi|170751058|ref|YP_001757318.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657580|gb|ACB26635.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 169

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 54/143 (37%), Positives = 90/143 (62%), Gaps = 4/143 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MDD+A+ +  + F+E   DIV+AYVSN+ VP++++  L+  VH+AL ++ + A       
Sbjct: 1   MDDNAT-EQQQTFIEQASDIVSAYVSNNSVPISELPGLLAGVHAALTKLSAPAAAVTE-T 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            ++  PA  IRKS+    L    DG  +K+LKRHL + + +T ++YR ++ L  DYP  +
Sbjct: 59  ADKPTPA-QIRKSVTPDALISFIDGKPYKTLKRHL-SRNGLTIEQYRERFGLPRDYPSTA 116

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
             Y+  RS+LA+++GLG+ R+K 
Sbjct: 117 ASYSAQRSELARSLGLGQQRRKS 139


>gi|220923417|ref|YP_002498719.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948024|gb|ACL58416.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 174

 Score =  182 bits (462), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 59/148 (39%), Positives = 86/148 (58%), Gaps = 6/148 (4%)

Query: 1   MDDDASFDSSER---FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQD 57
           M+D+A   +S+     +E+  DIVAAYVSN+VV  AD+  LI  V   L  +   +    
Sbjct: 1   MNDEAGAPTSQSEAGTIELVADIVAAYVSNNVVRPADLPDLIAAVSRTLGELGKPSAPAA 60

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
              P+    A  IRKS+    +    DG  +KS+KRHL T + +TP EYR ++ L ++YP
Sbjct: 61  EETPKPT--AAQIRKSVTPDHIVSFIDGKPYKSMKRHL-TKNGLTPAEYRQQYGLPANYP 117

Query: 118 MVSREYATTRSKLAKNMGLGRGRKKRVL 145
           MV+  YA  RS+LAK++GLG+ R+K   
Sbjct: 118 MVAPNYAAQRSELAKSLGLGQLRRKAAE 145


>gi|254563099|ref|YP_003070194.1| RosR/MucR family transcriptional regulator [Methylobacterium
           extorquens DM4]
 gi|254270377|emb|CAX26373.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens DM4]
          Length = 140

 Score =  181 bits (461), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 59/142 (41%), Positives = 84/142 (59%), Gaps = 3/142 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +D S  +   ++E++  +V+AY SN+ V  AD+  LI  VHS L  + S A      Q
Sbjct: 1   MSEDTSS-TQLDYVEISAGLVSAYASNNSVRAADLPELIRTVHSTLAALKSGAGQGGENQ 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+  PA  I+KSI    L   EDG  +K+LKRHL     +TP+ YR K+ L +DYPM +
Sbjct: 60  IEKPTPA-QIKKSITPDALISFEDGKPYKTLKRHLANR-GLTPEAYREKYVLPADYPMTA 117

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+  RS+LA+ +GLG+ RKK
Sbjct: 118 SGYSARRSELARALGLGQLRKK 139


>gi|58038297|ref|YP_190266.1| transcriptional regulator protein [Gluconobacter oxydans 621H]
 gi|58000711|gb|AAW59610.1| Transcriptional regulator protein [Gluconobacter oxydans 621H]
          Length = 165

 Score =  181 bits (460), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 55/150 (36%), Positives = 79/150 (52%), Gaps = 6/150 (4%)

Query: 1   MDD--DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           M D   A+         +T +IVAAY+S + V    +  LI  VHSAL    +     + 
Sbjct: 1   MTDLTPATESPHSDLRSLTAEIVAAYLSRNDVAPDVLPGLIRSVHSAL----TVPTAPEA 56

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
              +   P V  +KS+    + CLEDG + K L+RHLKT +NMTPDEYR +W L  +YPM
Sbjct: 57  AVEDAPVPVVNPKKSVFPDYIICLEDGKKLKMLRRHLKTAYNMTPDEYRARWGLPPEYPM 116

Query: 119 VSREYATTRSKLAKNMGLGRGRKKRVLTSK 148
           V+  Y+  R+ LA+ +GLG   +      +
Sbjct: 117 VAPGYSAQRAALAREIGLGSRTRASAPQEE 146


>gi|10956903|ref|NP_049123.1| regulator [Novosphingobium aromaticivorans]
 gi|146275574|ref|YP_001165735.1| MucR family transcriptional regulator [Novosphingobium
           aromaticivorans DSM 12444]
 gi|3378336|gb|AAD03919.1| regulator [Novosphingobium aromaticivorans]
 gi|145322265|gb|ABP64209.1| transcriptional regulator, MucR family [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 159

 Score =  181 bits (459), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 56/140 (40%), Positives = 81/140 (57%), Gaps = 4/140 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + +  L+   DIV+A+VSN+ V   D+  LI  V+++L  +            E+L PAV
Sbjct: 2   ADDTLLDHVADIVSAHVSNNSVSANDLPGLIQSVYTSLATLGQ----APEPLEEKLTPAV 57

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +R S++   + CL+ G + K LKRHL T H MTP EYR +WNL +DYPMV+ EYA  R 
Sbjct: 58  SVRASVKPDAVTCLDCGAKMKMLKRHLGTDHGMTPAEYRTRWNLPADYPMVAPEYAAKRK 117

Query: 129 KLAKNMGLGRGRKKRVLTSK 148
           +LA  +GLGR   ++     
Sbjct: 118 ELAVRIGLGRKPGQKPKAKA 137


>gi|170742841|ref|YP_001771496.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197115|gb|ACA19062.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 145

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 59/144 (40%), Positives = 89/144 (61%), Gaps = 5/144 (3%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
            +   S   +E+T  +VAAYV+++ V  + + +L++ VH+AL  +  R P Q+  +P   
Sbjct: 7   NALAGSADLIEVTSGLVAAYVAHNSVAPSQVPTLLSQVHAALVGL-HRPPAQELAKP--- 62

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
            P VPI+K++    +  LEDG  +KSLKRHL +   +TPD+YR KW L  DYPMV+  YA
Sbjct: 63  VPPVPIKKTVTPDAIISLEDGRPYKSLKRHLSSR-GITPDQYRQKWGLPPDYPMVAANYA 121

Query: 125 TTRSKLAKNMGLGRGRKKRVLTSK 148
             RS+LAK++GLG+ R+      K
Sbjct: 122 AQRSELAKSIGLGQSRRAAGQKGK 145


>gi|220923592|ref|YP_002498894.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948199|gb|ACL58591.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 162

 Score =  181 bits (459), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 63/145 (43%), Positives = 88/145 (60%), Gaps = 6/145 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M ++     + + + +  D+V+AYV+N+ VP A +  LI+ VH +L  +   A      +
Sbjct: 1   MSEENRGRQT-KLITLAADLVSAYVANNSVPAAGLPDLISVVHGSLAALGQPAA----PK 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           PE L P VPI+K++    L  LEDG Q+KSLKRHL T   +TP+EYR KW L  DYPMV+
Sbjct: 56  PEPLVPPVPIKKTVTPDYLISLEDGRQYKSLKRHLSTR-GLTPEEYRRKWGLPYDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA  RS+LAK++GLGR R     
Sbjct: 115 ANYAAQRSELAKSIGLGRNRAAAAK 139


>gi|220926132|ref|YP_002501434.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219950739|gb|ACL61131.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 189

 Score =  180 bits (458), Expect = 5e-44,   Method: Composition-based stats.
 Identities = 59/140 (42%), Positives = 85/140 (60%), Gaps = 3/140 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
             +  ++     +T DIV+AYVS + VP A++ +LI  V+ AL+ +   A    +  P +
Sbjct: 2   SETEAAAVDLSGLTSDIVSAYVSKNNVPSAELPTLIRSVYDALRTIGKPATPAADETP-K 60

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             PA  IRKSI    L    DG  +KSLKRHL T H +TP+ YR K+ L  DYPMV+  Y
Sbjct: 61  ATPA-QIRKSITVDHLVSFIDGKPYKSLKRHL-TKHGLTPEAYRAKFGLPRDYPMVAESY 118

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           A  RS+LA+++GLG+ R++R
Sbjct: 119 ARQRSELARSLGLGQIRRER 138


>gi|148260765|ref|YP_001234892.1| MucR family transcriptional regulator [Acidiphilium cryptum JF-5]
 gi|326403964|ref|YP_004284046.1| MucR family transcriptional regulator [Acidiphilium multivorum
           AIU301]
 gi|146402446|gb|ABQ30973.1| transcriptional regulator [Acidiphilium cryptum JF-5]
 gi|325050826|dbj|BAJ81164.1| MucR family transcriptional regulator [Acidiphilium multivorum
           AIU301]
          Length = 149

 Score =  180 bits (457), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 81/142 (57%), Gaps = 4/142 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
               +++ L++T  IV+A+VS++ V    + +LI DV+ +L                   
Sbjct: 3   ESQDNQQLLQLTAQIVSAHVSHNSVSAEMLPALIRDVYQSLSGTEQPVEEPPPPLEP--- 59

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
            AV  +KS+ N  + CLEDG + K L+RHLK+ +N+TP++YR +W LA+DYPMV+  YA 
Sbjct: 60  -AVNPKKSVFNDYIICLEDGKKLKMLRRHLKSAYNLTPEQYRERWGLANDYPMVAPAYAK 118

Query: 126 TRSKLAKNMGLGRGRKKRVLTS 147
            RS LAK +GLG     +   S
Sbjct: 119 QRSNLAKKIGLGTKPASQAPAS 140


>gi|254562856|ref|YP_003069951.1| Ros/MucR family transcriptional regulator [Methylobacterium
           extorquens DM4]
 gi|254270134|emb|CAX26126.1| transcriptional regulator, Ros/MucR family [Methylobacterium
           extorquens DM4]
          Length = 174

 Score =  180 bits (457), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 60/142 (42%), Positives = 84/142 (59%), Gaps = 6/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D+   D     L MT DIVAA+VSN+ VP +++ SL+  VHSA   + S    +   +
Sbjct: 11  MEDNTLPD----LLMMTADIVAAFVSNNSVPASELPSLLVQVHSAFVSLPSTPVAEAGSE 66

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+  PA  I+KSI    L    DG  +++LKRHL   H ++ DEYR ++ L  DYP V+
Sbjct: 67  IEKPTPA-QIKKSITPDALISFVDGKPYRTLKRHLNV-HGLSVDEYRTRYGLPGDYPSVA 124

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+ +RS LAK +GLG  RKK
Sbjct: 125 ANYSASRSALAKQLGLGNQRKK 146


>gi|114570088|ref|YP_756768.1| MucR family transcriptional regulator [Maricaulis maris MCS10]
 gi|114340550|gb|ABI65830.1| transcriptional regulator, MucR family [Maricaulis maris MCS10]
          Length = 140

 Score =  180 bits (457), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 61/142 (42%), Positives = 92/142 (64%), Gaps = 5/142 (3%)

Query: 1   MDDDASFD-SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M +D   D   E  L MT D+VA+Y+S++ +P  ++  LI  VH+ ++ V       +  
Sbjct: 1   MAEDMLPDIDKEELLRMTTDVVASYLSHNSMPADNVPDLIRSVHATMKEVSE----SEAK 56

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
              + KPAV + KS+ +  + CLEDG + K LKR+L++ +NM+PD+YR KWNL SDYPMV
Sbjct: 57  PEPKTKPAVALSKSVADDYIVCLEDGKKLKMLKRYLRSQYNMSPDDYRRKWNLPSDYPMV 116

Query: 120 SREYATTRSKLAKNMGLGRGRK 141
           +  Y+  RS+ AK++GLGRG+K
Sbjct: 117 APAYSRKRSQFAKDIGLGRGKK 138


>gi|221233919|ref|YP_002516355.1| transcriptional regulator [Caulobacter crescentus NA1000]
 gi|220963091|gb|ACL94447.1| transcriptional regulator [Caulobacter crescentus NA1000]
          Length = 142

 Score =  180 bits (456), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 58/142 (40%), Positives = 83/142 (58%), Gaps = 9/142 (6%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D A+       +E+T +IVA YV+N+  P++++ +LI   H AL  + S  P      
Sbjct: 1   MEDKAT------LIELTAEIVANYVANNSTPVSELPALIRATHDALAGIGSP-PAPTVEV 53

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
             +  PA  IRKSI    L   EDG  +K+LKRHL T H MT  EY+ KW L +DYP  +
Sbjct: 54  VTKATPA-QIRKSITPEALISFEDGKPYKTLKRHLTT-HGMTVAEYKAKWGLPNDYPTTA 111

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+  RS++AK +GLG+G +K
Sbjct: 112 PAYSEARSQMAKALGLGQGGRK 133


>gi|170741523|ref|YP_001770178.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168195797|gb|ACA17744.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 163

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 57/144 (39%), Positives = 84/144 (58%), Gaps = 5/144 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S +++   +E+  DIV+++VS++ V  AD+  LI  +H  L      A      +P +L 
Sbjct: 2   SEEAAPGHIELVSDIVSSFVSHNNVRPADLPDLIKSIHGTLSSFGKPA----EPEPVKLT 57

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           P +PI+K+I    +  LEDG  +KSLKRHL T   +TP +YR KW L  +YPMV+  YA 
Sbjct: 58  PLMPIKKTITPDAIISLEDGRPYKSLKRHL-TGRGLTPQQYREKWGLPPNYPMVAASYAA 116

Query: 126 TRSKLAKNMGLGRGRKKRVLTSKV 149
           +RS+LAK +GLG+ RK        
Sbjct: 117 SRSELAKQIGLGQSRKPAAEKRAA 140


>gi|170743650|ref|YP_001772305.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197924|gb|ACA19871.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 156

 Score =  180 bits (456), Expect = 8e-44,   Method: Composition-based stats.
 Identities = 58/141 (41%), Positives = 80/141 (56%), Gaps = 3/141 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           ++D  +  S    +++  DIVAAYVSN++V   D+ SLI  V + L  +   A      +
Sbjct: 11  VNDGNAVSSDAVSIKLVADIVAAYVSNNMVRPDDLPSLIAAVGATLGDLGKSAAPPAEEK 70

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P+       IRKSI    L    D   +KS+KRHL T + +TPDEYR  + L  DYPMV+
Sbjct: 71  PKAT--PTQIRKSITPDALISFIDAKPYKSMKRHL-TKNGLTPDEYRQMYGLPRDYPMVA 127

Query: 121 REYATTRSKLAKNMGLGRGRK 141
             YA  RS+LAK+MGLG  R+
Sbjct: 128 PNYAAQRSELAKSMGLGALRR 148


>gi|170744771|ref|YP_001773426.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168199045|gb|ACA20992.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 156

 Score =  180 bits (456), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 56/133 (42%), Positives = 73/133 (54%), Gaps = 3/133 (2%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSI 74
            + VDIVAAYVSN+ V   D+ +LI  V + L  +   A       P +  PA  IRKSI
Sbjct: 25  RLVVDIVAAYVSNNSVRPDDLPNLIASVGATLGDLGKPAAPPAEETP-KATPA-QIRKSI 82

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
               L    D   +KS+KRHL T + +TPDEYR ++ L  DYP V+  YA  RS+LAK +
Sbjct: 83  TPDALISFIDAKPYKSMKRHL-TKNGLTPDEYRQRYGLPRDYPTVAPNYAAQRSELAKQL 141

Query: 135 GLGRGRKKRVLTS 147
           GLG  R+      
Sbjct: 142 GLGANRRGGARGK 154


>gi|113473838|ref|YP_718101.1| putative transcriptional regulator [Sphingomonas sp. KA1]
 gi|112821518|dbj|BAF03389.1| putative transcriptional regulator [Sphingomonas sp. KA1]
          Length = 171

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 58/139 (41%), Positives = 81/139 (58%), Gaps = 4/139 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
            +E  L+   DIV+A+VSN+ V  AD+  LI  V+++L  +            E LKPAV
Sbjct: 2   ENEALLDHAADIVSAHVSNNAVAAADLPGLIQAVYASLAALGR----APEPAVEELKPAV 57

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +R S++   + CLE G + K LKRHL T H MTP EYR +W+L +DYPMV+ +YA  R 
Sbjct: 58  SVRSSVKPDAVTCLECGEKMKMLKRHLGTEHGMTPAEYRTRWSLPADYPMVAPDYAAKRK 117

Query: 129 KLAKNMGLGRGRKKRVLTS 147
            LA  +GLGR   +   + 
Sbjct: 118 DLAVRIGLGRKPGQSPKSE 136


>gi|167647010|ref|YP_001684673.1| MucR family transcriptional regulator [Caulobacter sp. K31]
 gi|167349440|gb|ABZ72175.1| transcriptional regulator, MucR family [Caulobacter sp. K31]
          Length = 143

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 88/138 (63%), Gaps = 3/138 (2%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D+  + D+    L ++  IVAAYV+ + V    +  LI  VH AL  + +    + +   
Sbjct: 4   DEPRTTDNEVDILGLSAGIVAAYVAQNTVSRTAVPDLIRSVHGALSALSAP---EVDRPA 60

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           ER KPAVP+ +S++   + CLEDG + K LKR+L+TH++M+P++YR KW+L  DYPMV+ 
Sbjct: 61  ERGKPAVPVSRSVQRDYIVCLEDGKRLKMLKRYLRTHYDMSPEDYRRKWSLPGDYPMVAP 120

Query: 122 EYATTRSKLAKNMGLGRG 139
            YA  RS  AK++GLG+G
Sbjct: 121 AYAERRSDFAKSIGLGKG 138


>gi|170743052|ref|YP_001771707.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197326|gb|ACA19273.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 158

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 62/145 (42%), Positives = 89/145 (61%), Gaps = 6/145 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M  D S D +   + +  DIV+AYV+N+ VP+ D+G LI  VH +L  +VS  P +    
Sbjct: 1   MTSDPSADQA-GLVNLAADIVSAYVANNSVPLGDLGGLIVSVHKSLATIVSPPPPEPAKP 59

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
                  +PIRK++    +  LEDG  +KSLKRHL +   +TP++YR KW L  DYPMV+
Sbjct: 60  VPP----IPIRKTVTPDAIISLEDGKPYKSLKRHL-SGRGLTPEQYREKWGLPPDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             YA  RS+LAK++GLG+ R++R  
Sbjct: 115 ATYAAQRSELAKSLGLGQLRRERAA 139


>gi|220923803|ref|YP_002499105.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948410|gb|ACL58802.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 172

 Score =  179 bits (455), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 61/145 (42%), Positives = 82/145 (56%), Gaps = 6/145 (4%)

Query: 1   MDDDASFDSSER---FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQD 57
           M D+A   +S      +E+  DIV+AYVSN+VV  AD+  LI  V   L  +   +    
Sbjct: 1   MSDEAGAPTSHSEAGTIELVADIVSAYVSNNVVRPADLPDLIAAVSRTLGELGKPSTPAA 60

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
              P+    A  IRKSI    +    DG  +K+LKRHL T H M+PDEYR ++ L   YP
Sbjct: 61  EETPKPT--AAQIRKSITPDHIVSFIDGKPYKTLKRHL-TRHGMSPDEYRSRYGLPPTYP 117

Query: 118 MVSREYATTRSKLAKNMGLGRGRKK 142
           MV+  YA+ RS+LAK  GLG+ R+K
Sbjct: 118 MVAESYASQRSELAKASGLGQNRRK 142


>gi|291037215|ref|ZP_06568179.1| transcriptional regulator, MucR family protein [Gluconacetobacter
           xylinus NBRC 3288]
          Length = 161

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 53/131 (40%), Positives = 78/131 (59%), Gaps = 7/131 (5%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +  +R L +TV+I+ AYVS + +   ++  LI  V+++L               +   PA
Sbjct: 3   EEQQRQLALTVEIITAYVSENKISPDELIRLIGTVYNSLS-------VPTASGVKEQIPA 55

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VPI++S+    + CLEDG + K LKRHL+  + MTP+EYR KW L S YPMV+  Y   R
Sbjct: 56  VPIKRSVFPDYIICLEDGKKLKMLKRHLQASYGMTPEEYRRKWGLPSHYPMVAPNYTVRR 115

Query: 128 SKLAKNMGLGR 138
           S+LA+ +GLGR
Sbjct: 116 SELAREIGLGR 126


>gi|220920120|ref|YP_002495421.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219944726|gb|ACL55118.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 174

 Score =  178 bits (453), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 56/141 (39%), Positives = 80/141 (56%), Gaps = 6/141 (4%)

Query: 1   MDDDA---SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQD 57
           MD++A   +       +E+   IV+AYVSN+VVP A++  LI  V   L  +   +    
Sbjct: 1   MDEEAGTVTPGPGAETIELVAGIVSAYVSNNVVPPAELPDLIAMVSRTLGELGKSSAPAA 60

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
              P+    A  IRKSI    +    DG  +KS+KRHL T + ++PD YR K+ L  DYP
Sbjct: 61  EEIPKLT--AAQIRKSITPDHIVSFIDGKPYKSMKRHL-TKNGLSPDAYRQKYGLPHDYP 117

Query: 118 MVSREYATTRSKLAKNMGLGR 138
           MV+  YA  RS+LAK++GLG+
Sbjct: 118 MVAPNYAAQRSELAKSLGLGQ 138


>gi|188580605|ref|YP_001924050.1| MucR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179344103|gb|ACB79515.1| transcriptional regulator, MucR family [Methylobacterium populi
           BJ001]
          Length = 166

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 55/142 (38%), Positives = 84/142 (59%), Gaps = 6/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D+ S D     L +T DIVAAYVS + +  +++ SL+  VH A   +++    +   +
Sbjct: 1   MEDNTSPD----LLTITADIVAAYVSKNSIRASELPSLLVQVHGAFASLLAGPSAETGSE 56

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            E+  PA  I+KSI    L    DG  +++LKRHL + H +T + YR ++ L +DYP V+
Sbjct: 57  IEKPTPA-QIKKSITPDALISFVDGKPYRTLKRHL-SVHGLTIEAYRARYGLPNDYPSVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+ +RS LAK +GLG  RKK
Sbjct: 115 ANYSASRSALAKQLGLGNPRKK 136


>gi|170744213|ref|YP_001772868.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168198487|gb|ACA20434.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 174

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 60/147 (40%), Positives = 81/147 (55%), Gaps = 3/147 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           +  +       +E   DIV+AYVS++ V   ++ SLI  +H+ALQ +   A       P+
Sbjct: 5   ESKAPTQEGALIEQVADIVSAYVSSNRVSAGELPSLIASLHTALQGLGKPATPPAEETPK 64

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
               A  IRKSI    L  L DG  +K+LKRHL T   +TPDEYR K+ L SDYPMV+  
Sbjct: 65  AT--AAQIRKSITPDALISLIDGKPYKTLKRHLTTQ-GLTPDEYRKKFGLPSDYPMVASN 121

Query: 123 YATTRSKLAKNMGLGRGRKKRVLTSKV 149
           YA  RS+LAK  GLG+ R +     + 
Sbjct: 122 YAAHRSELAKTSGLGQRRHRSPAEKRA 148


>gi|188584174|ref|YP_001927619.1| MucR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179347672|gb|ACB83084.1| transcriptional regulator, MucR family [Methylobacterium populi
           BJ001]
          Length = 177

 Score =  178 bits (452), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 55/142 (38%), Positives = 84/142 (59%), Gaps = 2/142 (1%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           MD       + R + +T D+V+AYVSN+ V  A++  L+ +VH A++ V           
Sbjct: 1   MDTSEQDAETARLVTLTADVVSAYVSNNHVQSAELPKLLGEVHEAIRTVSLSGRPSAETG 60

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
           P +  P   IRKSI +  L   EDG  +K+L+RHL T   ++P++YR KW L +DYPM S
Sbjct: 61  PPKATP-QEIRKSISHDFLISFEDGKPYKTLRRHL-TLRGLSPEQYRAKWGLPNDYPMTS 118

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+  RS+LA+ +GLG+ R++
Sbjct: 119 ASYSEQRSELARALGLGQQRRR 140


>gi|330990750|ref|ZP_08314706.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329762190|gb|EGG78678.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 161

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 53/131 (40%), Positives = 78/131 (59%), Gaps = 7/131 (5%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +  +R L +TV+I+ AYVS + +   ++  LI  V+++L               +   PA
Sbjct: 3   EEQQRQLALTVEIITAYVSENKISPDELIRLIGTVYNSLS-------VPTASGVKEQIPA 55

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VPI++S+    + CLEDG + K LKRHL+  + MTP+EYR KW L S YPMV+  Y   R
Sbjct: 56  VPIKRSVFPDYIICLEDGKKLKMLKRHLQASYGMTPEEYRRKWGLPSHYPMVAPNYTVRR 115

Query: 128 SKLAKNMGLGR 138
           S+LA+ +GLGR
Sbjct: 116 SELAREIGLGR 126


>gi|163851861|ref|YP_001639904.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|163663466|gb|ABY30833.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
          Length = 143

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 84/143 (58%), Gaps = 5/143 (3%)

Query: 1   MDDDASFDSSER-FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR--APCQD 57
           M ++AS D  +   +++ V+I++AY+ N+V+P  ++ +LI  VH+AL  +     AP  +
Sbjct: 1   MANNASEDPPDNGSIKLAVEIISAYLGNNVLPSKELPALIAGVHAALSGIGKAPAAPDAE 60

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
            ++ E+  PA  IRKS+    L    DG  +K+LKRHL   H +TP  Y  ++ L +DYP
Sbjct: 61  KIEIEKPTPA-QIRKSVTPDALISFIDGKPYKTLKRHL-AVHGLTPHAYCERYGLPADYP 118

Query: 118 MVSREYATTRSKLAKNMGLGRGR 140
             +  Y+  RS +AK  GLG+ R
Sbjct: 119 TTAPNYSAQRSAMAKGFGLGQRR 141


>gi|220923746|ref|YP_002499048.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948353|gb|ACL58745.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 135

 Score =  178 bits (451), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 58/139 (41%), Positives = 78/139 (56%), Gaps = 7/139 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D  +   S     +T  IV+AYV+   VP +++ +LI  VH AL  +   A  +    
Sbjct: 1   MPDIDT--QSPDLSGLTGRIVSAYVAYTAVPASELPALIAAVHGALAALGRPAEPEAPA- 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
              L P VPIRK+I    +  LEDG  +++LKRHL     +TP++YR KW L  DYPMV+
Sbjct: 58  ---LVPPVPIRKTITPDAIISLEDGKPYRTLKRHL-AGRGLTPEQYRAKWGLPLDYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRG 139
             YA  RS+LAK  GLGR 
Sbjct: 114 ANYAAQRSELAKQYGLGRK 132


>gi|170750713|ref|YP_001756973.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657235|gb|ACB26290.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 179

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 81/138 (58%), Gaps = 2/138 (1%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           +A+  S   F+E TVD+VAAYVSN+ +P A++ +LI  +H AL  + +          ER
Sbjct: 3   EAAPTSQLDFIERTVDVVAAYVSNNSLPSAELPALIASIHEALNTIGAGPAAPATESVER 62

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             PA  IRKSI    L    DG  +K+LKRHL T H + P  YR ++ L +DYP  S  Y
Sbjct: 63  PTPA-QIRKSIRPDGLVSFIDGKSYKTLKRHL-TKHGLDPQTYRERYGLPADYPTTSANY 120

Query: 124 ATTRSKLAKNMGLGRGRK 141
           +  RS LAK++GLG+  +
Sbjct: 121 SAQRSALAKSLGLGQPGR 138


>gi|220922439|ref|YP_002497741.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219947046|gb|ACL57438.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 165

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 62/142 (43%), Positives = 85/142 (59%), Gaps = 7/142 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D  S +S    +E+  DI++AYVSN+ VP A +  LI  V+  L  + +  P     +
Sbjct: 1   MTDSVSTNS----VELASDIISAYVSNNPVPAASLPELIKAVYETLSNLTNP-PAPAVEE 55

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
             +  PA  IRKSI    L    DG  +KSLKRHL T H MTP++YR K+ L   YPMV+
Sbjct: 56  TPKASPA-QIRKSITPDHLISFIDGKPYKSLKRHL-TKHGMTPEDYRTKFGLPVTYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             YAT RS+LAK++GLG+ R++
Sbjct: 114 ETYATQRSELAKSIGLGQKRQE 135


>gi|295690719|ref|YP_003594412.1| MucR family transcriptional regulator [Caulobacter segnis ATCC
           21756]
 gi|295432622|gb|ADG11794.1| transcriptional regulator, MucR family [Caulobacter segnis ATCC
           21756]
          Length = 142

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 58/142 (40%), Positives = 82/142 (57%), Gaps = 9/142 (6%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D A+       +E+T +IVA YV+N+  P++++ +LI   H AL  +   AP    V+
Sbjct: 1   MEDKAT------LIELTAEIVANYVANNSTPVSELPALIRATHDALAGI--GAPPAPTVE 52

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
                    IRKSI    L   EDG  +K+LKRHL T H MT  EY+ KW L +DYP  +
Sbjct: 53  TVTKATPAQIRKSITPEALISFEDGKPYKTLKRHLTT-HGMTVAEYKAKWGLPNDYPTTA 111

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+  RSK+AK +GLG+G +K
Sbjct: 112 PAYSEARSKMAKALGLGQGGRK 133


>gi|170739458|ref|YP_001768113.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193732|gb|ACA15679.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 174

 Score =  177 bits (450), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 54/137 (39%), Positives = 75/137 (54%), Gaps = 3/137 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            +E   DIV+AYVSN+ V   ++  LI  +H+ALQ +   A       P+    A  IR+
Sbjct: 15  LIEQAADIVSAYVSNNRVTAGELPGLIASLHAALQDLGKPATPPAEETPKAT--AAQIRR 72

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           SI    L    DG  +K LKRHL T H +TP EYR K+ L  DYPMV+  +   RS++AK
Sbjct: 73  SITPDALISFVDGKPYKVLKRHLTT-HGLTPAEYRQKFGLPGDYPMVAPSFTARRSEIAK 131

Query: 133 NMGLGRGRKKRVLTSKV 149
           + GLG+ R +     + 
Sbjct: 132 SSGLGQRRPRAAAEKRA 148


>gi|220923416|ref|YP_002498718.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948023|gb|ACL58415.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 131

 Score =  177 bits (449), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 51/135 (37%), Positives = 78/135 (57%), Gaps = 5/135 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           + +S    +++   IV+AYVSN+ +P +++  LI  +H+A+ R+   A          + 
Sbjct: 2   TEESRTNHIDLASAIVSAYVSNNSMPASELPGLIQSIHTAVNRLAQPAVPDPEKPVPPVP 61

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
                  +I    +  LEDG  +KSLKRHL T   +TP++YR KW L  DYPMV+  YA 
Sbjct: 62  VKK----TITPDAIISLEDGKPYKSLKRHLTTR-GLTPEQYRQKWGLPPDYPMVAANYAV 116

Query: 126 TRSKLAKNMGLGRGR 140
            RS+LAK++GLGR +
Sbjct: 117 QRSELAKSIGLGRRK 131


>gi|170750764|ref|YP_001757024.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657286|gb|ACB26341.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 150

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 51/134 (38%), Positives = 75/134 (55%), Gaps = 1/134 (0%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           + + ++S R + +  +IVAAYVSN+ VP   +  L+  VH+AL  +  + P         
Sbjct: 3   EKNPENSLRLVTLVGEIVAAYVSNNSVPPTALPELMASVHAALAALDGQPPAAAAEPAVE 62

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
                 IRKS++   +    DG  +K+LKRHL T H +TP+ YR ++ L  DYPM +  Y
Sbjct: 63  RPTPAQIRKSVQEDGIVSFIDGRTYKTLKRHL-TAHGLTPERYRERYGLPDDYPMTAPGY 121

Query: 124 ATTRSKLAKNMGLG 137
           A  RS LAK +GLG
Sbjct: 122 AAQRSALAKAIGLG 135


>gi|220919995|ref|YP_002495298.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952415|gb|ACL62806.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 175

 Score =  176 bits (448), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 57/144 (39%), Positives = 83/144 (57%), Gaps = 3/144 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           +       + +T +IV+AYVSN+VVP A++  LI  V  AL  +    P    V+     
Sbjct: 9   TLKPETETIGLTANIVSAYVSNNVVPAAELPELIAIVDRALDELSK--PATPVVEEVLKP 66

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
            A  IRKSI    L    DG  +KS+KRHL T + +TP EYR ++ L ++YPMV+  YA 
Sbjct: 67  TAAQIRKSITPDHLISFIDGKPYKSMKRHL-TKNGLTPAEYRQQYGLPANYPMVAPNYAA 125

Query: 126 TRSKLAKNMGLGRGRKKRVLTSKV 149
            RS+LAK++GLG+ R++R    + 
Sbjct: 126 QRSELAKSLGLGQMRRQRAAEKRA 149


>gi|170738948|ref|YP_001767603.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193222|gb|ACA15169.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 166

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 54/142 (38%), Positives = 86/142 (60%), Gaps = 5/142 (3%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +SS    E+  DIVAAYVSN+ +  A++ +++  V+  L  +++  P             
Sbjct: 7   ESSINLTELASDIVAAYVSNNRISGAELPAVLRSVYETLHALIAPPPAAPEKPVPP---- 62

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           +PI+K++    +  LEDG  +KSLKRHL +   +TP++YR KW L  DYPMV+  YA  R
Sbjct: 63  IPIKKTVTPDAIISLEDGKPYKSLKRHL-SGRGLTPEQYREKWGLPPDYPMVAATYAAQR 121

Query: 128 SKLAKNMGLGRGRKKRVLTSKV 149
           S+LAK++GLG+ R++R +  + 
Sbjct: 122 SELAKSLGLGQLRRERAMQKRA 143


>gi|167645306|ref|YP_001682969.1| MucR family transcriptional regulator [Caulobacter sp. K31]
 gi|167347736|gb|ABZ70471.1| transcriptional regulator, MucR family [Caulobacter sp. K31]
          Length = 142

 Score =  176 bits (446), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 56/142 (39%), Positives = 80/142 (56%), Gaps = 9/142 (6%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+D A+       +E+T +IVA YV+N+   ++D+ +LI   H AL  + S         
Sbjct: 1   MEDKAT------LIELTAEIVANYVANNSTSVSDLPALIRATHDALAGIGSP-EAAPVET 53

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
             +  PA  IR+SI    L   EDG  +K+LKRHL T H MT  EY+ KW L +DYP  +
Sbjct: 54  VTKATPA-QIRRSITPDALISFEDGKPYKTLKRHLTT-HGMTVAEYKAKWGLPNDYPTTA 111

Query: 121 REYATTRSKLAKNMGLGRGRKK 142
             Y+  RS +AK +GLG+G +K
Sbjct: 112 PAYSEARSAMAKALGLGQGGRK 133


>gi|330990607|ref|ZP_08314564.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329762309|gb|EGG78796.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 146

 Score =  175 bits (445), Expect = 1e-42,   Method: Composition-based stats.
 Identities = 54/131 (41%), Positives = 76/131 (58%), Gaps = 7/131 (5%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
           +   R + +T ++VAAYVS + +    +  LIT V  +L         +     E   PA
Sbjct: 3   EELNRRISVTAEMVAAYVSKNTIDPEKLPYLITSVFQSLS-------PKAEPVSELPIPA 55

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VPI++S+    + CLEDG + K LKRHL   + MTP++YR KW L  +YPMV+  YA  R
Sbjct: 56  VPIKRSVFPDYIICLEDGKKLKMLKRHLNVAYGMTPEQYRAKWGLPVEYPMVAPNYANRR 115

Query: 128 SKLAKNMGLGR 138
           S+LA+ MGLGR
Sbjct: 116 SELAREMGLGR 126


>gi|218529586|ref|YP_002420402.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218521889|gb|ACK82474.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 145

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/142 (37%), Positives = 77/142 (54%), Gaps = 6/142 (4%)

Query: 1   MDDD---ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR-APCQ 56
           M DD    +  ++   +  T  I AAYV+ + +   D   LIT VH+AL  +    A   
Sbjct: 1   MSDDDFKGAATNNADIIYQTAAITAAYVTKNTISATDFPGLITRVHAALAGLGGASATPV 60

Query: 57  DNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116
              + E+  PA  IRKSI    +    DG  +K+LKRHL   + + P  YR ++ L +DY
Sbjct: 61  AEAEIEKATPA-QIRKSITPDAIVSFIDGKAYKTLKRHLGA-NGLDPHSYRHRYGLPNDY 118

Query: 117 PMVSREYATTRSKLAKNMGLGR 138
           PMV+  YA  RS+LAK++G+GR
Sbjct: 119 PMVAPNYAARRSELAKSLGVGR 140


>gi|326385875|ref|ZP_08207502.1| regulator [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209664|gb|EGD60454.1| regulator [Novosphingobium nitrogenifigens DSM 19370]
          Length = 157

 Score =  175 bits (445), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 56/141 (39%), Positives = 84/141 (59%), Gaps = 4/141 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + E  L +  DIV+A+VS++ V    +  LI  V+++L  +       +    E+ +PAV
Sbjct: 2   ADETLLTLAADIVSAHVSHNAVAADQLPLLIQSVYASLAGLGQTPAPVE----EKREPAV 57

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +R S++   + CLE G + K LKRHL T H ++P EYR +WNLA+DYPMV+ +YA  R 
Sbjct: 58  SVRSSVKADAIACLECGAKMKMLKRHLSTDHGLSPAEYRARWNLAADYPMVAPDYAAKRK 117

Query: 129 KLAKNMGLGRGRKKRVLTSKV 149
           +LA  +GLGR  K  V T+  
Sbjct: 118 ELAVKIGLGRKPKAVVETASA 138


>gi|220923470|ref|YP_002498772.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219948077|gb|ACL58469.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 144

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 57/147 (38%), Positives = 81/147 (55%), Gaps = 6/147 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D  +  + +    +T  IV AYV++  VP A++  LI  VH AL+ +   A  +    
Sbjct: 1   MSDTPT-TTPDHHAGLTARIVGAYVAHTAVPPAELPGLIASVHGALEALSRPAEPEAPA- 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
              L P VPIRK++    +  LEDG  +++L+RHL     +TP++YR KW L  DYPMV+
Sbjct: 59  ---LVPPVPIRKTVTPDAIISLEDGKPYRTLERHL-AGRGLTPEQYRAKWGLPVDYPMVA 114

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTS 147
             YA  RS+LAK  GLGR   +  L  
Sbjct: 115 ANYAAHRSELAKASGLGRHGARTGLPK 141


>gi|83310305|ref|YP_420569.1| transcriptional regulatory protein mucR [Magnetospirillum
           magneticum AMB-1]
 gi|82945146|dbj|BAE50010.1| Transcriptional regulatory protein mucR [Magnetospirillum
           magneticum AMB-1]
          Length = 153

 Score =  175 bits (444), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 55/137 (40%), Positives = 82/137 (59%), Gaps = 3/137 (2%)

Query: 13  FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRK 72
            + +T  IV+A+V  + V + D+  LI   ++AL   V+ A        ++ +PAVPI+K
Sbjct: 1   MIGVTARIVSAFVRGNAVAVEDLSDLIRTTYAAL---VTTAMPMQVPLTDQPRPAVPIKK 57

Query: 73  SIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           S++   + CLE G   K LKRHL T H ++  +YR KW+L +DYP+V+  YA  RS +A 
Sbjct: 58  SVQPDAVICLECGKPQKMLKRHLATSHGLSVTDYRTKWSLPADYPVVAPSYAEHRSAMAI 117

Query: 133 NMGLGRGRKKRVLTSKV 149
            +GLGR RKK V   +V
Sbjct: 118 KIGLGRKRKKTVEPEEV 134


>gi|220920589|ref|YP_002495890.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219945195|gb|ACL55587.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 147

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 53/144 (36%), Positives = 86/144 (59%), Gaps = 10/144 (6%)

Query: 1   MDDDASFDSSER-----FLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPC 55
           M +D S  ++        + +T DIV+A+++++ +P A +  L+T VH++L R+   A  
Sbjct: 1   MPNDISITTANDASSLSTIAITADIVSAFLAHNQIPAASLPPLLTSVHASLARLTKPA-- 58

Query: 56  QDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASD 115
                PE L P VPI+K++    +  LEDG  +K+L RHL     +TP++YR KW L ++
Sbjct: 59  --EPAPEPLVPPVPIKKTVTPDAIISLEDGKPYKTLARHL-AGRGLTPEQYRQKWGLPAN 115

Query: 116 YPMVSREYATTRSKLAKNMGLGRG 139
           YPM +  Y++ RS+LAK  GLG+ 
Sbjct: 116 YPMTAANYSSQRSELAKKSGLGQK 139


>gi|170742234|ref|YP_001770889.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168196508|gb|ACA18455.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 143

 Score =  175 bits (443), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 83/136 (61%), Gaps = 4/136 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +   + +T   VAAYV+++ +  AD+  LI D H+AL  + + AP  +  +P    P VP
Sbjct: 6   TRDLVALTAQTVAAYVAHNPIRPADLPGLIRDTHAALVALTAPAPAPEAGRP---VPPVP 62

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           IRK++    ++ LEDG  +KSLKRHL +   +TP+ YR KW L +DYPM    Y+  RS+
Sbjct: 63  IRKTVTPDAIFSLEDGKPYKSLKRHLNSR-GLTPEAYRAKWGLPADYPMTCASYSAARSE 121

Query: 130 LAKNMGLGRGRKKRVL 145
           LAK +GLGR    R++
Sbjct: 122 LAKVLGLGRKAAPRLV 137


>gi|58038420|ref|YP_190388.1| MucR family transcriptional regulator [Gluconobacter oxydans 621H]
 gi|58000834|gb|AAW59732.1| transcriptional regulator, MucR family [Gluconobacter oxydans 621H]
          Length = 165

 Score =  175 bits (443), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 54/150 (36%), Positives = 77/150 (51%), Gaps = 6/150 (4%)

Query: 1   MDD--DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           M D   A+         +T  IVAAY+S + V    +  LI  VH+AL          + 
Sbjct: 1   MTDLTPATEPPHSDLRSLTAKIVAAYLSRNDVAPDVLPGLIRSVHTALTVPAVSEAAAEE 60

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
                + P    +KS+    + CLEDG + K L+RHLKT +NMTPDEYR +W L  +YPM
Sbjct: 61  APVPVVNP----KKSVFPDYIICLEDGKKLKMLRRHLKTAYNMTPDEYRARWGLPPEYPM 116

Query: 119 VSREYATTRSKLAKNMGLGRGRKKRVLTSK 148
           V+  Y+  RS LA+ +GLG   +  +   +
Sbjct: 117 VAPGYSAQRSALAREIGLGSRNRSSLAQEE 146


>gi|220925468|ref|YP_002500770.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219950075|gb|ACL60467.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 133

 Score =  174 bits (442), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 54/140 (38%), Positives = 80/140 (57%), Gaps = 7/140 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D+ +   S   + M  +IV+AYVS++ +P  ++ +LI  V+  L ++   A  +    
Sbjct: 1   MSDEYASKLSP--VTMVAEIVSAYVSHNNLPAGELPTLIRSVYDQLGKLARPAEPEPEKP 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
              +     I+K+I    +  LEDG  +KSLKRHL T   +TP++YR KW L  DYPMV+
Sbjct: 59  VPPVP----IKKTITPDAIISLEDGKPYKSLKRHLSTR-GLTPEQYRQKWGLPQDYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGR 140
             YA  RS+LAK  GLGR +
Sbjct: 114 ANYAAQRSELAKATGLGRRK 133


>gi|170740145|ref|YP_001768800.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168194419|gb|ACA16366.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 156

 Score =  174 bits (442), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 55/128 (42%), Positives = 72/128 (56%), Gaps = 3/128 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           + +   IVAAYVSN+ V   D+ SLI  V + L  +    P    V+ +       IRKS
Sbjct: 24  ISLVAGIVAAYVSNNSVRPDDLPSLIAAVGATLGDLGK--PAAPPVEEKPKATPTQIRKS 81

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    L    D   +KS+KRHL T + +TPDEYR  + L  DYPMV+  YA  RS+LAK+
Sbjct: 82  ITPDALISFIDAKPYKSMKRHL-TKNGLTPDEYRQMYGLPRDYPMVAPNYAAQRSELAKS 140

Query: 134 MGLGRGRK 141
           MGLG  R+
Sbjct: 141 MGLGAIRR 148


>gi|170751279|ref|YP_001757539.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657801|gb|ACB26856.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 180

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 53/147 (36%), Positives = 83/147 (56%), Gaps = 5/147 (3%)

Query: 1   MDDDASFDSSE--RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           M+D       +   F+E+T DIV+AYV+N+ VP+ D+ SL++ VH+AL  +         
Sbjct: 1   MEDSNPAPHQDPIDFVELTADIVSAYVANNSVPVPDLPSLLSGVHAALAGLGHTT-GSSE 59

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
            + ++  PA  I+KSI    L    DG  +K+LKRHL T + MT ++YR ++ L  DYP 
Sbjct: 60  PEFKKATPA-QIKKSITPDALISFIDGKPYKTLKRHL-TGNGMTIEQYRQRYGLPPDYPT 117

Query: 119 VSREYATTRSKLAKNMGLGRGRKKRVL 145
            +  Y+  R++ A+N GLG  R+    
Sbjct: 118 TASNYSAMRAEFARNAGLGHKRRSPAA 144


>gi|170750632|ref|YP_001756892.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657154|gb|ACB26209.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 151

 Score =  173 bits (440), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 57/139 (41%), Positives = 82/139 (58%), Gaps = 4/139 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV--Q 60
           ++   ++S     MT ++VAAYVSN+ VP A++ +LI  VH A+  +V+  P       Q
Sbjct: 2   NETFDETSNTLAAMTAELVAAYVSNNPVPAAELPALIVRVHGAISGLVAGTPTAAGAAPQ 61

Query: 61  PERLKP-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
            E  KP A  IRKS+ +  +    DG  +K+LKRHL + H + P  YR  + L +DYPMV
Sbjct: 62  VEVEKPSATQIRKSVRHDGIVSFIDGKLYKTLKRHLAS-HGLDPRSYRDSYGLPTDYPMV 120

Query: 120 SREYATTRSKLAKNMGLGR 138
           +  YA  RS LAK +GLG+
Sbjct: 121 APGYAEQRSALAKAIGLGQ 139


>gi|220920173|ref|YP_002495474.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219944779|gb|ACL55171.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 137

 Score =  173 bits (439), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 53/140 (37%), Positives = 77/140 (55%), Gaps = 5/140 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +     +T DIV+ Y+ N+ +   D+ +LI  VHSAL+ +       +  QP  L+P VP
Sbjct: 2   ASDLTLITADIVSLYIMNNSIGADDLPNLIRSVHSALEDIDR----VEKPQPATLEPPVP 57

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           I +++    +  LEDG  +K+L RHL T   +TPD+YR KW L  DYPM++  YA  R++
Sbjct: 58  IEQTVTPDYIVSLEDGKPYKTLGRHLHTK-GLTPDQYRRKWGLPPDYPMIAPSYAAHRAE 116

Query: 130 LAKNMGLGRGRKKRVLTSKV 149
           LAK   LGR    R      
Sbjct: 117 LAKRGSLGRKLGSRAEGDDA 136


>gi|170747935|ref|YP_001754195.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654457|gb|ACB23512.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 160

 Score =  173 bits (439), Expect = 8e-42,   Method: Composition-based stats.
 Identities = 56/136 (41%), Positives = 83/136 (61%), Gaps = 5/136 (3%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
            S   S RF+ +  +IV+AYVS++ V  AD+  L+ +VH+A++ +          QP   
Sbjct: 3   QSNGGSLRFVTLASEIVSAYVSHNHVQSADLPGLLNEVHAAIRGICDAG----QSQPIAK 58

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
             A  IR+SI    L   EDG  +K+L+RHL T   +TP+ YR KW LASDYPM ++ Y+
Sbjct: 59  ATAQEIRRSINPDFLISFEDGKPYKTLRRHL-TLRGLTPEAYRAKWGLASDYPMTAQSYS 117

Query: 125 TTRSKLAKNMGLGRGR 140
             RS+LA+++GLG+ R
Sbjct: 118 EQRSQLARSLGLGQPR 133


>gi|220914715|ref|YP_002490023.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952466|gb|ACL62856.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 174

 Score =  173 bits (438), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 54/152 (35%), Positives = 82/152 (53%), Gaps = 6/152 (3%)

Query: 1   MDDDASFDSSE---RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQD 57
           M+D A   +S+     +E+   I++AYVSN++VP AD+ +LI      L  +    P   
Sbjct: 1   MNDKADVSTSQPGADTIELVAAIISAYVSNNIVPPADLPALIATAGQTLGELGK--PSAP 58

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
             +      A  IRKS+    +    DG  +K++KRHL T + +TP EYR  + L  DYP
Sbjct: 59  AAEETPKLTAAQIRKSVTPDHIISFIDGKPYKAMKRHL-TKNGLTPAEYRQTYGLPGDYP 117

Query: 118 MVSREYATTRSKLAKNMGLGRGRKKRVLTSKV 149
           +V+  YA  RS+LAK++GLG+ R+K       
Sbjct: 118 IVAPNYAAQRSELAKSLGLGQLRRKMAEKRAA 149


>gi|148554719|ref|YP_001262301.1| MucR family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148499909|gb|ABQ68163.1| transcriptional regulator, MucR family [Sphingomonas wittichii RW1]
          Length = 148

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 61/132 (46%), Positives = 84/132 (63%), Gaps = 4/132 (3%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + E  LE+T DIVA++++N+ V + D+  LI +VH+ L  +   A          LKPAV
Sbjct: 2   ADEIMLELTADIVASHLTNNKVAVGDVAELIRNVHATLTSLGQPAA----EPVAELKPAV 57

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           PIR SI+   L  LE G + K LKR+L+T++ M+PD+YR KW LA+DYPMV+  YA TR 
Sbjct: 58  PIRSSIKPDYLVSLESGKKMKMLKRYLQTNYGMSPDDYRKKWGLAADYPMVAPNYAETRR 117

Query: 129 KLAKNMGLGRGR 140
            LA   GLGR +
Sbjct: 118 NLAVKSGLGRKK 129


>gi|83310092|ref|YP_420356.1| transcriptional regulatory protein [Magnetospirillum magneticum
           AMB-1]
 gi|82944933|dbj|BAE49797.1| Transcriptional regulatory protein [Magnetospirillum magneticum
           AMB-1]
          Length = 137

 Score =  172 bits (437), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 55/134 (41%), Positives = 79/134 (58%), Gaps = 4/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           ++    +T  IVAAY+S+  +   +I +LI  V+S L    + A    +   E+ +PAV 
Sbjct: 2   ADDIKALTTKIVAAYLSSSTLAATEIPTLIKSVYSTLAATDNPA----SAPAEQQQPAVS 57

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           +++S+    + CLE G + K LKRHL T H +T DEYR KW L  DYP+V+ EYA  RS+
Sbjct: 58  VKRSVTPDYIVCLECGDRQKMLKRHLTTGHGLTADEYRAKWALPRDYPLVAPEYAARRSE 117

Query: 130 LAKNMGLGRGRKKR 143
            AK +GLG  R  R
Sbjct: 118 FAKAVGLGYSRTNR 131


>gi|170743289|ref|YP_001771944.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168197563|gb|ACA19510.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 185

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 57/135 (42%), Positives = 81/135 (60%), Gaps = 3/135 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
             +  ++     +T DIV+AYVS + VP A++ +LI  ++ AL     +AP     +  +
Sbjct: 2   SETGAAAIDLSGLTSDIVSAYVSRNSVPSAELPALIRSIYDALVS-TGKAPAPSTQESAK 60

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             PA  IRKSI    L    DG  +KSLKRHL T H +TP+EYR+K+ L  DYPMV+  Y
Sbjct: 61  ATPA-QIRKSISYDHLVSFVDGKPYKSLKRHL-TKHGLTPEEYRVKYGLPRDYPMVAESY 118

Query: 124 ATTRSKLAKNMGLGR 138
           A  RS+LA+ +GLG+
Sbjct: 119 AKQRSELARTLGLGQ 133


>gi|83311179|ref|YP_421443.1| transcriptional regulatory protein Ros [Magnetospirillum magneticum
           AMB-1]
 gi|82946020|dbj|BAE50884.1| Transcriptional regulatory protein ros [Magnetospirillum magneticum
           AMB-1]
          Length = 137

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 56/134 (41%), Positives = 76/134 (56%), Gaps = 4/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           ++    +T  IVAAY+  + V   ++ +LI  V+S L               E+ +PAV 
Sbjct: 2   ADDIKALTTKIVAAYLGGNTVEAKEVPNLIKSVYSTLVGTD----APVTALAEQQQPAVS 57

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           ++KS+  G + CLE G   K LKRHL T H +T DEYR KW+L  DYP+V+ EYA  RS+
Sbjct: 58  VKKSVTPGHIVCLECGDHQKMLKRHLLTGHGLTADEYRAKWSLPRDYPLVAPEYAARRSE 117

Query: 130 LAKNMGLGRGRKKR 143
           LAK  GLG  R  R
Sbjct: 118 LAKAAGLGYSRTNR 131


>gi|218532804|ref|YP_002423620.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|240141313|ref|YP_002965793.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens AM1]
 gi|218525107|gb|ACK85692.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
 gi|240011290|gb|ACS42516.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens AM1]
          Length = 177

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 55/148 (37%), Positives = 84/148 (56%), Gaps = 4/148 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +     +    +E+  D+V+AYVSN+ +P  ++  LI  VH+AL  + +    ++  +
Sbjct: 1   MSETNQV-TQHDRIELAADLVSAYVSNNSLPSPELAGLIVQVHAALVALSAPQAPKEE-E 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            ER  PA  I+KSI    L    DG  +K+LKRHL T H +  D YR ++ L +DYP VS
Sbjct: 59  VERATPA-QIKKSITPDALISFIDGKPYKTLKRHLTT-HGLDIDGYRRRYGLPADYPTVS 116

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSK 148
             Y+  RS LAK++GLG+ R+K    + 
Sbjct: 117 SNYSAARSALAKDLGLGQQRRKSSAKAA 144


>gi|170742252|ref|YP_001770907.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168196526|gb|ACA18473.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 140

 Score =  172 bits (436), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 55/131 (41%), Positives = 77/131 (58%), Gaps = 5/131 (3%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
              +E+T  IVAAYVS +  P+AD+  LI  V+ AL ++ +    +           VPI
Sbjct: 8   ADAVELTAAIVAAYVSKNATPVADLPGLIASVNGALNQLSAPPAAEPAPLVPP----VPI 63

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           +K++    +  LEDG  +KSLKRHL     +TPDEYR KW L   YPMV+  YA  RS+L
Sbjct: 64  KKTVTPDYIISLEDGKPYKSLKRHLGIR-GLTPDEYRKKWGLPHGYPMVAANYAAKRSEL 122

Query: 131 AKNMGLGRGRK 141
           AK++ LG+ R+
Sbjct: 123 AKSLALGQSRR 133


>gi|170745595|ref|YP_001776817.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170752152|ref|YP_001783298.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659249|gb|ACB28301.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659279|gb|ACB28330.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 172

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 59/144 (40%), Positives = 83/144 (57%), Gaps = 5/144 (3%)

Query: 1   MDDDASFDSSE--RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           MDD+     +E   + E+T D+VAAYVSN+ +P A++ +LI  VH+A+  + +  P    
Sbjct: 1   MDDNTGTIEAEAIDYTEVTADLVAAYVSNNPLPAAELATLIASVHAAVTGLGT--PGVPA 58

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
           V       A  IRKSI    L   EDG  +K+L+RHL T   +    YR KW L  DYPM
Sbjct: 59  VPRPEKPTAAQIRKSIRPDALISFEDGKPYKTLRRHL-TGLGLDAATYREKWGLPRDYPM 117

Query: 119 VSREYATTRSKLAKNMGLGRGRKK 142
           V+  Y+  RS +AK++GLG+ R K
Sbjct: 118 VAASYSEARSAMAKSIGLGQMRGK 141


>gi|220914951|ref|YP_002490259.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952702|gb|ACL63092.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 173

 Score =  172 bits (436), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 59/151 (39%), Positives = 82/151 (54%), Gaps = 5/151 (3%)

Query: 1   MDD--DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           M D  +A+ D+    +E+  DI++AYV+++ VP+A +  LI  V   L  +   A     
Sbjct: 1   MADVQEATADAGGPAIELVADIISAYVAHNPVPVAQLPDLIATVSQTLDSLGKPAASAAE 60

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
             P +  PA  IRKSI    L    DG  +K+LKRHL T H M+PDEYR K+ L   YPM
Sbjct: 61  ETP-KATPA-QIRKSITPDALISFIDGKPYKTLKRHL-TRHGMSPDEYRSKFGLPPTYPM 117

Query: 119 VSREYATTRSKLAKNMGLGRGRKKRVLTSKV 149
           V+  YA  RS+LAK  GLG+  ++       
Sbjct: 118 VAESYAVQRSELAKASGLGQSHRRTAPKQSA 148


>gi|254563822|ref|YP_003070917.1| RosR/MucR family transcriptional regulator [Methylobacterium
           extorquens DM4]
 gi|254271100|emb|CAX27107.1| transcriptional regulator (Ros/MucR family) [Methylobacterium
           extorquens DM4]
          Length = 177

 Score =  171 bits (435), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 55/148 (37%), Positives = 84/148 (56%), Gaps = 4/148 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +     +    +E+  D+V+AYVSN+ +P  ++  LI  VH+AL  + +    ++  +
Sbjct: 1   MSETNQV-TQHDRIELAADLVSAYVSNNSLPSPELAGLIVQVHAALVALSAPQAPKEE-E 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            ER  PA  I+KSI    L    DG  +K+LKRHL T H +  D YR ++ L +DYP VS
Sbjct: 59  VERATPA-QIKKSITPDALISFIDGKPYKTLKRHLTT-HGLDIDGYRRRYGLPADYPTVS 116

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSK 148
             Y+  RS LAK++GLG+ R+K    + 
Sbjct: 117 SNYSAARSALAKDLGLGQQRRKSSAKAA 144


>gi|188584163|ref|YP_001927608.1| MucR family transcriptional regulator [Methylobacterium populi
           BJ001]
 gi|179347661|gb|ACB83073.1| transcriptional regulator, MucR family [Methylobacterium populi
           BJ001]
          Length = 178

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 54/145 (37%), Positives = 83/145 (57%), Gaps = 4/145 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +     S    +E+  D+V+AYVSN+ +P  ++  LI  VH+AL  + +    ++  +
Sbjct: 1   MSETNQV-SQIDRIELAADLVSAYVSNNSLPSPELAGLIVQVHAALVALSAPQAPKEE-E 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            ER  PA  ++KSI    L    DG  +K+LKRHL T H +  + YR ++ L +DYP VS
Sbjct: 59  VERATPA-QVKKSITPDALISFIDGKPYKTLKRHLTT-HGLDIEGYRRRYGLPADYPTVS 116

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
             Y+  RS LAK++GLG+ R+K   
Sbjct: 117 SNYSAARSALAKDLGLGQQRRKSAA 141


>gi|163853859|ref|YP_001641902.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|163665464|gb|ABY32831.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
          Length = 177

 Score =  171 bits (433), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 56/148 (37%), Positives = 84/148 (56%), Gaps = 4/148 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +        R +E+  D+V+AYVSN+ +P  ++  LI  VH+AL  + +    ++  +
Sbjct: 1   MSETNQVTQHGR-IELAADLVSAYVSNNSLPSPELAGLIVQVHAALVALSAPQAPKEE-E 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            ER  PA  I+KSI    L    DG  +K+LKRHL T H +  D YR ++ L +DYP VS
Sbjct: 59  VERATPA-QIKKSITPDALISFIDGKPYKTLKRHLTT-HGLDIDGYRRRYGLPADYPTVS 116

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSK 148
             Y+  RS LAK++GLG+ R+K    + 
Sbjct: 117 SNYSAARSALAKDLGLGQQRRKSSAKAA 144


>gi|218528320|ref|YP_002419136.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218520623|gb|ACK81208.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 153

 Score =  170 bits (432), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 51/151 (33%), Positives = 78/151 (51%), Gaps = 6/151 (3%)

Query: 1   MDDDASFDSSE---RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVS-RAPCQ 56
           M +D + D++      +++T  IV AYV+ + +    +  LIT VH AL  +    A   
Sbjct: 1   MSNDNTDDAAAIGVDTVDLTATIVMAYVAKNTLTAKALPGLITSVHEALAGLGGTSATPV 60

Query: 57  DNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116
              + E+  PA  IRKSI    L    DG  +K LKRHL+  H + P  YR ++ L +DY
Sbjct: 61  AEAEIEKPTPA-QIRKSITPDALISFIDGKPYKMLKRHLR-LHGLNPQGYRQRYGLPADY 118

Query: 117 PMVSREYATTRSKLAKNMGLGRGRKKRVLTS 147
           PM +  Y+  R+++A+  GLGR   +    S
Sbjct: 119 PMTASGYSARRAEVARATGLGRHGGRTTAQS 149


>gi|218528150|ref|YP_002418966.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218520453|gb|ACK81038.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 197

 Score =  170 bits (432), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 50/130 (38%), Positives = 76/130 (58%), Gaps = 3/130 (2%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           +R + +  +IV AYV+ + V  A++  L+  VH+ L  + S     +  +  R   A  I
Sbjct: 9   DRLVTLATEIVTAYVTRNHVQAAELPGLLRSVHAGLLTLSSG--SVEPAEERRTLTATEI 66

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           R+SI+   L   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM +  Y+  RS+L
Sbjct: 67  RRSIQPEGLISFEDGKAYKTLRRHL-TKRGLTPEAYRAKWGLPVDYPMTASAYSAQRSQL 125

Query: 131 AKNMGLGRGR 140
           A+++GLGR R
Sbjct: 126 ARDLGLGRSR 135


>gi|220922087|ref|YP_002497388.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219946693|gb|ACL57085.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 166

 Score =  170 bits (431), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 59/149 (39%), Positives = 85/149 (57%), Gaps = 7/149 (4%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M D+    S+   + M  DIV+AYVS++ VP  ++ +LI  V+  L ++   A  +    
Sbjct: 1   MSDEER--SAFDGIAMAADIVSAYVSHNNVPPGELTALIRSVYDQLGKLGRPAEPEPERP 58

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
              +     IRKS+  G +  LEDG  +KSLKRHL+T   +TP +YR KW+L  DYPMV+
Sbjct: 59  VPPVP----IRKSVTPGAIISLEDGKPYKSLKRHLRTR-GLTPQQYRQKWDLPPDYPMVA 113

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSKV 149
            +YA  RS+LAK  GLGR R++       
Sbjct: 114 ADYAARRSELAKANGLGRSRQRAAEKRAA 142


>gi|326387354|ref|ZP_08208964.1| regulator [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208535|gb|EGD59342.1| regulator [Novosphingobium nitrogenifigens DSM 19370]
          Length = 153

 Score =  170 bits (431), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 53/141 (37%), Positives = 80/141 (56%), Gaps = 4/141 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + E  L +  DIV+A+VS++ V    +  LI  V+++L  +            E+ +PAV
Sbjct: 2   ADETLLTLAADIVSAHVSHNAVAADQLPVLIQSVYASLAGLGQ----APAPVEEKREPAV 57

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +R S++   + CLE G + K LKRHL T H ++P EYR +W+L +DYPMV+ +YA  R 
Sbjct: 58  SVRSSVKADAIACLECGAKMKMLKRHLSTDHGISPAEYRTRWSLPADYPMVAPDYAAKRK 117

Query: 129 KLAKNMGLGRGRKKRVLTSKV 149
           +LA  +GLGR  K  V     
Sbjct: 118 ELAVKIGLGRKPKAVVEAEPA 138


>gi|163849624|ref|YP_001637667.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|163661229|gb|ABY28596.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
          Length = 186

 Score =  169 bits (430), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 52/132 (39%), Positives = 74/132 (56%), Gaps = 3/132 (2%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
             +R + +  +IV AYV+ + V  A++  L+  VHS L R+ S     +  +  R   A 
Sbjct: 7   GQDRLVTLATEIVTAYVTRNQVQAAELPGLLRSVHSGLLRLSSG--SGEPTEEPRTLTAT 64

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            IR+SI    L   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM +  Y+  RS
Sbjct: 65  EIRRSIRPEGLISFEDGKAYKTLRRHL-TKRGLTPEAYRAKWGLPVDYPMTASAYSAQRS 123

Query: 129 KLAKNMGLGRGR 140
           +LA + GLGR R
Sbjct: 124 QLALDRGLGRPR 135


>gi|170751556|ref|YP_001757816.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170658078|gb|ACB27133.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 190

 Score =  169 bits (429), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 80/140 (57%), Gaps = 3/140 (2%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
            +  S       +++T +IVAAYVSN+ V  AD+ +L+++VH+A+  + +          
Sbjct: 4   SNQISVADHTDVIDLTANIVAAYVSNNSVRPADLPALLSEVHAAITGL-NGTSATAAPAV 62

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           E+  P+  IRKSI    L    DG  +K+LKRH+ T   MT +EYR ++ L  DYP  + 
Sbjct: 63  EKATPS-QIRKSITPDALISFIDGKPYKTLKRHI-TGAGMTIEEYRERFGLPRDYPSTAA 120

Query: 122 EYATTRSKLAKNMGLGRGRK 141
            Y+  RS LAK++GLG  R+
Sbjct: 121 NYSAQRSALAKSLGLGNQRR 140


>gi|270208579|ref|YP_003329350.1| MucR [Sinorhizobium meliloti]
 gi|76880853|gb|ABA56023.1| MucR [Sinorhizobium meliloti]
          Length = 141

 Score =  168 bits (425), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 65/138 (47%), Positives = 90/138 (65%), Gaps = 2/138 (1%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
             +   + +T +IV+AYV  HV+   ++  +ITDVH+AL  V S     + V+  +    
Sbjct: 6   PQNGLLVTLTAEIVSAYVKKHVIRGVEVTKIITDVHAALSAVGSDKVVPEPVEKPKPP-- 63

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           VP+RKSI++G L CLE+G +FKSLKRHL   + MTP++YR KW+L  DYPMV+  YA  R
Sbjct: 64  VPVRKSIQDGYLICLENGKKFKSLKRHLMAKYQMTPEQYRTKWDLPDDYPMVAPAYAAKR 123

Query: 128 SKLAKNMGLGRGRKKRVL 145
           S+LAK+ GLG  RKKR  
Sbjct: 124 SELAKSAGLGYFRKKRAA 141


>gi|170738927|ref|YP_001767582.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193201|gb|ACA15148.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 157

 Score =  167 bits (423), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 53/140 (37%), Positives = 80/140 (57%), Gaps = 4/140 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           +++   S     +T  IV AYV+ + +  +D+  L+  V+S L  +   A        E 
Sbjct: 11  ESTAPDSGALAGLTAGIVTAYVTGNALRASDMPHLVRSVYSTLATLGGPA---KPAVAEA 67

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             P +PI+K++    +  LEDG  +KSLKRHL T   ++P+EYR KWNL  DYPMV+  Y
Sbjct: 68  PVPPIPIKKTVTRDAIISLEDGKPYKSLKRHL-TARGLSPEEYRRKWNLPPDYPMVAEVY 126

Query: 124 ATTRSKLAKNMGLGRGRKKR 143
           A  RS LA+ +GLG+ R ++
Sbjct: 127 AQRRSDLARVLGLGQIRSRK 146


>gi|240142007|ref|YP_002966517.1| putative transcriptional regulator, MucR family [Methylobacterium
           extorquens AM1]
 gi|240011951|gb|ACS43176.1| putative transcriptional regulator, MucR family [Methylobacterium
           extorquens AM1]
          Length = 198

 Score =  166 bits (422), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 53/149 (35%), Positives = 79/149 (53%), Gaps = 3/149 (2%)

Query: 1   MDDDASFDSS-ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M D     S+    + +  DI++AYV  + V  AD+  L+  VH++++ + + +      
Sbjct: 1   MTDKNDTQSALTNSVILASDIISAYVVRNHVAPADLPGLLRSVHASIESLGNGSAQSAAA 60

Query: 60  QPERLKP-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
           + E  KP    IRKSI    L    DG  +K+LKRHL T + + P  YR ++ L  DYPM
Sbjct: 61  EEEVEKPTPAQIRKSITPDGLISFIDGKAYKTLKRHLST-NGLDPYSYRARYGLPHDYPM 119

Query: 119 VSREYATTRSKLAKNMGLGRGRKKRVLTS 147
           V   YA  RS+LAK +GLGR  +K  +  
Sbjct: 120 VDANYAAQRSQLAKALGLGRTGEKPAVQK 148


>gi|170748085|ref|YP_001754345.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654607|gb|ACB23662.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 142

 Score =  166 bits (421), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 73/137 (53%), Gaps = 3/137 (2%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           ++ + D +   ++ T  +VAAYVS + V + D+  LI  VH+A+  +             
Sbjct: 7   NEKTSDPNTDLIKCTASLVAAYVSRNAVGVGDLPVLIDQVHTAISVLQGGGSGSGPGWTG 66

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
               A  I  SI+   L    DG  +K+LKRHL T H +TP+ YR K+ L +DYPMV+  
Sbjct: 67  PT--AAQIEASIQQDGLISFIDGRSYKTLKRHL-TAHGLTPERYRAKYGLPADYPMVAPG 123

Query: 123 YATTRSKLAKNMGLGRG 139
           YA  RS++AK + LG  
Sbjct: 124 YAAKRSEIAKAIQLGHK 140


>gi|170751235|ref|YP_001757495.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657757|gb|ACB26812.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 146

 Score =  166 bits (420), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 54/138 (39%), Positives = 80/138 (57%), Gaps = 5/138 (3%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ--- 60
           D++  S +  +E+T  +VAAYVSN+ V   D+ +LI   H A+  + +R           
Sbjct: 3   DSTLVSPQTNIELTAGLVAAYVSNNRVSAGDLPALIAQCHDAITALANRGEASIAAADLD 62

Query: 61  PERLKP-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             R +P A  IR SI    +    DG ++K+LKRHL T H + P  YR ++ L +DYPMV
Sbjct: 63  ALRDRPSAAQIRNSIRPDAIVSFIDGRRYKTLKRHL-TAHGLHPQSYRERYGLPADYPMV 121

Query: 120 SREYATTRSKLAKNMGLG 137
           ++EYA  RS LA+++GLG
Sbjct: 122 AQEYAERRSALARSIGLG 139


>gi|255624718|ref|XP_002540518.1| Transcriptional regulatory protein ros, putative [Ricinus communis]
 gi|223495226|gb|EEF21865.1| Transcriptional regulatory protein ros, putative [Ricinus communis]
          Length = 152

 Score =  165 bits (419), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 49/127 (38%), Positives = 71/127 (55%), Gaps = 2/127 (1%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            + + + +E+T +IVA YV+N+  P+ D+ SLI   H AL  + S A  +      ++ P
Sbjct: 2   AERNTKLIELTAEIVANYVANNSTPVNDLPSLIKATHDALAGIESGASAEPEEAVAKVTP 61

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           A  IRKSI    L    DG  +K+LKRHL T H  T  EY+ K+ L +DYP  +  Y+  
Sbjct: 62  A-QIRKSITPDALISFIDGKPYKTLKRHLTT-HGTTIAEYKAKYGLPNDYPTTAPNYSAA 119

Query: 127 RSKLAKN 133
           RS +AK 
Sbjct: 120 RSAMAKE 126


>gi|83312282|ref|YP_422546.1| transcriptional regulator [Magnetospirillum magneticum AMB-1]
 gi|82947123|dbj|BAE51987.1| Predicted transcriptional regulator [Magnetospirillum magneticum
           AMB-1]
          Length = 160

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 53/136 (38%), Positives = 77/136 (56%), Gaps = 4/136 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +     IVAAY+ NH V + D+  +I+  ++AL    +  P       +R  PAVPI+KS
Sbjct: 6   VSFAARIVAAYLRNHEVAIGDLSGIISATYAALAGTDAPPPVGA----DRPTPAVPIKKS 61

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    + CLE G + K L+RHL T H ++ D YR KW+L +DYPM +  Y+  RS++A  
Sbjct: 62  ITPNFVACLECGKRQKMLRRHLSTSHGLSVDAYRSKWSLPADYPMAAPNYSQKRSEMAIQ 121

Query: 134 MGLGRGRKKRVLTSKV 149
           +GLGR  K  V  +  
Sbjct: 122 IGLGRKPKTTVAKNAA 137


>gi|330990398|ref|ZP_08314361.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329762525|gb|EGG79006.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 131

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 49/120 (40%), Positives = 66/120 (55%), Gaps = 6/120 (5%)

Query: 1   MDD-DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNV 59
           M D +     ++   E+T  IVAAYVS++ VP   +  LI  V  AL       P Q   
Sbjct: 1   MTDHETRSSEADTLRELTTRIVAAYVSSNTVPADTLPGLIASVFQAL-----GGPGQATT 55

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
               + PAVP++KS+    + CLEDG + K LKRHL+T + MTP++YR KW L   YPM 
Sbjct: 56  GTPDMVPAVPVKKSVFPDYIVCLEDGKKMKMLKRHLRTVYGMTPEQYREKWGLPESYPMT 115


>gi|170739310|ref|YP_001767965.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193584|gb|ACA15531.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 170

 Score =  165 bits (419), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 60/133 (45%), Positives = 78/133 (58%), Gaps = 3/133 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           +   S   LE+T DIV+AYV+N+ V M D+ +L+T V+ AL  V++        +  +  
Sbjct: 2   TGPVSSSSLELTSDIVSAYVANNSVRMTDLPALLTRVYEALGNVLNPP-PPAVEEAPKAT 60

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
           PA  I+KSI    L    DG  +KSLKRHL T H MTP EYR K+ L   YPMV   YA 
Sbjct: 61  PA-QIKKSITPDALISFIDGKPYKSLKRHL-TGHGMTPAEYREKFGLPPTYPMVPENYAK 118

Query: 126 TRSKLAKNMGLGR 138
            RS LAK +GLG+
Sbjct: 119 ARSALAKALGLGQ 131


>gi|218528580|ref|YP_002419396.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218520883|gb|ACK81468.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 176

 Score =  165 bits (418), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 46/131 (35%), Positives = 70/131 (53%), Gaps = 1/131 (0%)

Query: 8   DSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA 67
                 +E+  +I++AYV+ + V  ADI  L+  VH+AL  + +        +       
Sbjct: 7   PQGSDLIELAGEILSAYVTRNHVSPADIPRLLCSVHAALTGLANGHASTALKEEMDKPTP 66

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
             +RKSI    L    DG  +K+LKRHL + H + P  Y  ++ L +DYPMV+  YA  R
Sbjct: 67  EQVRKSITPDALISFIDGKPYKTLKRHL-SAHGLDPYSYCQRYGLPNDYPMVAAAYAARR 125

Query: 128 SKLAKNMGLGR 138
           S+LAK++GL R
Sbjct: 126 SELAKSIGLRR 136


>gi|222081607|ref|YP_002540971.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Agrobacterium radiobacter K84]
 gi|221726286|gb|ACM29375.1| transcriptional regulator protein - nodulation competitiveness
           determinant [Agrobacterium radiobacter K84]
          Length = 154

 Score =  164 bits (416), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 53/132 (40%), Positives = 74/132 (56%), Gaps = 3/132 (2%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           +  L+  V IV+A++S + V    +  LI DV++ L  + S              PA  +
Sbjct: 16  DPLLDGCVAIVSAFLSRNSVYANTVPRLIEDVYTTLFSLSSNTVALRQ---NGQSPAADL 72

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
             S+    + CLEDG + K LKR+L+TH  +TPDEYR KW LASDYPMV+  YA  RS+L
Sbjct: 73  GASLTGDYIVCLEDGKKVKLLKRYLRTHFGLTPDEYRAKWGLASDYPMVAPNYANRRSEL 132

Query: 131 AKNMGLGRGRKK 142
           AK  G G   ++
Sbjct: 133 AKLSGFGENTRQ 144


>gi|218529272|ref|YP_002420088.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218521575|gb|ACK82160.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 146

 Score =  164 bits (415), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 49/142 (34%), Positives = 72/142 (50%), Gaps = 3/142 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            D S     +T +I+ AYV N+ +P A +  LI  VH  L  + +           R  P
Sbjct: 3   TDDSCGLEAITANIIIAYVRNNHLPGAILPDLIRTVHETLLSLGTTT-APPAPDSARPTP 61

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           A  +RKSI    L    DG  +K+LKRHL T   +    YR ++ L +DYPMV+  Y+  
Sbjct: 62  A-EVRKSITPDALISFIDGRPYKTLKRHL-TSRGLDAYSYRARFGLPADYPMVAASYSRD 119

Query: 127 RSKLAKNMGLGRGRKKRVLTSK 148
           RS++AK +GLG   + +  T +
Sbjct: 120 RSEIAKALGLGIPNRSKAATER 141


>gi|303247430|ref|ZP_07333702.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
 gi|302491126|gb|EFL51018.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
          Length = 134

 Score =  164 bits (415), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 39/133 (29%), Positives = 60/133 (45%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E FL+  ++IV A  S   +   +I S++  +   ++ +VS        + E   P V 
Sbjct: 1   MEDFLKEALEIVKAQASVRNMTEEEITSMVRRLSDDIRGIVSAGTAIPGGEAEAPTPPVD 60

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K++    + CLE G  FK L +   +   +TPD YR KW      P+V +E    R K
Sbjct: 61  PKKAVRERSIICLESGKSFKILTKKHLSKFGLTPDTYREKWGYPKGMPLVCKELQRERRK 120

Query: 130 LAKNMGLGRGRKK 142
             K M L   R K
Sbjct: 121 KMKEMRLWEKRVK 133


>gi|83312396|ref|YP_422660.1| transcriptional regulatory protein Ros [Magnetospirillum magneticum
           AMB-1]
 gi|82947237|dbj|BAE52101.1| Transcriptional regulatory protein ros [Magnetospirillum magneticum
           AMB-1]
          Length = 159

 Score =  163 bits (412), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 4/134 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           + +   I AAY+ NH +P+ D+  LI   ++AL           +V  +R  PAVPI+KS
Sbjct: 6   MSLAARIAAAYLRNHEIPITDLPELIKATYAALAGTD----APPSVDADRPIPAVPIKKS 61

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    + CLE G +   L+RHL T H ++ D YR KW L +DYPM +  Y+  RS++A  
Sbjct: 62  ITPDAVTCLECGKKQMMLRRHLLTSHGLSVDAYRSKWALPADYPMAAPNYSQKRSEMAIQ 121

Query: 134 MGLGRGRKKRVLTS 147
           +GLGR  K     +
Sbjct: 122 IGLGRKPKAAAAEA 135


>gi|291037449|ref|ZP_06568413.1| transcriptional regulator Ros/MucR [Gluconacetobacter xylinus NBRC
           3288]
          Length = 222

 Score =  161 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 56/138 (40%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNH--VVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           D S D S   +    DIVAA++ N    +P   + + I DV++A++   +    + N   
Sbjct: 2   DQSDDLSPAIVIAMSDIVAAHLGNTNTSLPTEHVPAFIRDVYAAIRE--TTPVTEKNSSI 59

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
               PAVP+ +S+    + CLEDG + K LKRHL+T + MTP +YR KW L  DYPMV+ 
Sbjct: 60  PAQHPAVPVAQSVFPDYIVCLEDGKKLKMLKRHLQTRYGMTPTQYREKWQLPMDYPMVAP 119

Query: 122 EYATTRSKLAKNMGLGRG 139
           EYA  R+ LA++ GLGR 
Sbjct: 120 EYAKMRAALARDAGLGRK 137


>gi|220919620|ref|YP_002494923.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952040|gb|ACL62431.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 143

 Score =  161 bits (409), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 60/148 (40%), Positives = 81/148 (54%), Gaps = 5/148 (3%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +  +    E  +  T  IV AYVSN+ +  A++  LI  VH+A+ R   RAP     Q
Sbjct: 1   MVNQVAQQPDEAIVR-TATIVMAYVSNNSLRPAELPDLIASVHAAIGR--GRAPEPAEPQ 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
             R  PA  IR+SI +  L   ED   +KSL+RHL T   +TP++YR KW L  DYPMV+
Sbjct: 58  TPRATPA-QIRRSISHEALISFEDSKPYKSLRRHLTTR-GLTPEQYRAKWGLPPDYPMVA 115

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSK 148
             Y+  RS LA+  GLGR R      ++
Sbjct: 116 AAYSEERSALARAAGLGRKRAAVRPPAR 143


>gi|239907916|ref|YP_002954657.1| ROSMUCR family transcriptional regulator [Desulfovibrio magneticus
           RS-1]
 gi|239797782|dbj|BAH76771.1| ROSMUCR family transcriptional regulator [Desulfovibrio magneticus
           RS-1]
          Length = 137

 Score =  161 bits (407), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 39/133 (29%), Positives = 61/133 (45%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + FL+  ++IV A  S   +   +I S++  +   ++ +VS  P     +     PAV 
Sbjct: 1   MDDFLKEALEIVKAQASVRNMSEEEITSMVRRLTDDIRGLVSAGPSLAAAEEVAATPAVD 60

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K++    + CLE G  FK L +       +TP+EYR KW      P+V +E    R K
Sbjct: 61  PKKAVRERSIICLESGKSFKILTKKHLAKFGLTPEEYRTKWGYPKGMPLVCKELQRERRK 120

Query: 130 LAKNMGLGRGRKK 142
             K M L   R K
Sbjct: 121 KMKEMRLWEKRVK 133


>gi|220924528|ref|YP_002499830.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219949135|gb|ACL59527.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 139

 Score =  160 bits (405), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 48/130 (36%), Positives = 70/130 (53%), Gaps = 5/130 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +     MT DI+A Y+ N+     ++  LI  VHSAL+ +   +   +  +     P VP
Sbjct: 2   ASELTLMTADIIALYLINNACSTQELPELIRSVHSALEDIERTSKPVEVQEA----PPVP 57

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           I  ++    +  LEDG  +K+L RHL T   +TP++YR KW L  DYPM++  YA  R+ 
Sbjct: 58  IETTVTPDYIISLEDGKPYKTLGRHLHTR-GLTPEQYRRKWGLPPDYPMIAPTYAAERAA 116

Query: 130 LAKNMGLGRG 139
           LAK  G GR 
Sbjct: 117 LAKRGGFGRK 126


>gi|329846734|ref|ZP_08262007.1| transcriptional regulatory protein ros [Asticcacaulis biprosthecum
           C19]
 gi|328844241|gb|EGF93809.1| transcriptional regulatory protein ros [Asticcacaulis biprosthecum
           C19]
          Length = 116

 Score =  160 bits (405), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 52/120 (43%), Positives = 69/120 (57%), Gaps = 4/120 (3%)

Query: 30  VPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFK 89
           +P AD+  LI  VH++L          D    E   P+V ++KSI    L CLEDG QFK
Sbjct: 1   MPGADLPGLIKSVHASLNHTS----VPDAPAAEVKAPSVSVKKSITPNYLICLEDGRQFK 56

Query: 90  SLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKKRVLTSKV 149
           SLKRHL++ + +TPD YR KW L  DYPMV+  Y+  RS +AK+M LG   ++     K 
Sbjct: 57  SLKRHLQSKYGLTPDAYRAKWGLPKDYPMVAPAYSAARSAMAKSMQLGVKGRQTRAKRKA 116


>gi|283850461|ref|ZP_06367749.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
 gi|283574032|gb|EFC22004.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
          Length = 134

 Score =  159 bits (404), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 63/134 (47%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + FL+  ++IV A  S   +   +I S++  +   ++ +V+        + E   PAV 
Sbjct: 1   MDDFLKEALEIVKAQASVRNMTEEEITSMVRRLSDDIRGLVAAGAAAGAPEAEVQTPAVD 60

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K++    + CLE G  FK L +   +   +TPD YR KW    + P+V +E    R K
Sbjct: 61  PKKAVRERSIICLESGKSFKILTKKHLSKFGLTPDTYREKWGYPKNMPLVCKELQRERRK 120

Query: 130 LAKNMGLGRGRKKR 143
             K M L   R K+
Sbjct: 121 KMKEMKLWEKRIKK 134


>gi|330990194|ref|ZP_08314172.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329762740|gb|EGG79206.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 230

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 52/143 (36%), Positives = 73/143 (51%), Gaps = 6/143 (4%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSN--HVVPMADIGSLITDVHSA----LQRVVSRAPCQD 57
           + S       +     IV+AY+ N    +P   I  LI  V +A    +       P   
Sbjct: 2   NQSDGPDHTIITAMTSIVSAYLGNPQTALPPDAIPLLIRSVTAAVREDIASGTEAVPSPA 61

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
                +  PAVP+ ++I    + CLEDG +FK +KRHLK  + MTP++YR KW L  DYP
Sbjct: 62  LPAGTKPVPAVPLSETIFPDHIVCLEDGKKFKMMKRHLKRVYQMTPEQYRQKWGLPPDYP 121

Query: 118 MVSREYATTRSKLAKNMGLGRGR 140
           M +  YA  R+ LA+ +GLGR R
Sbjct: 122 MTAPAYAEQRATLARKIGLGRPR 144


>gi|220925328|ref|YP_002500630.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219949935|gb|ACL60327.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 147

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 47/134 (35%), Positives = 73/134 (54%), Gaps = 4/134 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
            ++F ++ +   +T DI  AY+S + +   ++  LI ++H+AL              P +
Sbjct: 2   TSTFPNAGKLAVLTADIATAYLSRNHLQSGELPRLIGEIHAALHSAAQGTTAPSG--PPK 59

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             PA  IR+SI    L   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM   +Y
Sbjct: 60  PTPA-EIRRSITYDALISFEDGKPYKTLRRHL-TRLGLTPEAYREKWGLPPDYPMTCADY 117

Query: 124 ATTRSKLAKNMGLG 137
           +  RS+LA+ + LG
Sbjct: 118 SKRRSELARALTLG 131


>gi|94986509|ref|YP_594442.1| transcriptional regulator [Lawsonia intracellularis PHE/MN1-00]
 gi|94730758|emb|CAJ54120.1| predicted transcriptional regulator [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 132

 Score =  158 bits (400), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 42/134 (31%), Positives = 64/134 (47%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + FL+  +DIV A  S  V+   +I S++  + S ++ V      Q+   P  L+  + 
Sbjct: 1   MDDFLKEALDIVKAQASVRVMAEDEIISMVRRLSSGIKVVSEGDCIQEEQAPTELQ--MD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            RKS++   + CLE G  FK L R     H +  +EYR KW L  D P+V +     R  
Sbjct: 59  PRKSVKEKSITCLECGRTFKILTRKHLRSHGLDANEYREKWGLKKDTPLVCKSLQRERRN 118

Query: 130 LAKNMGLGRGRKKR 143
             K+M L   R+K 
Sbjct: 119 KMKDMKLWEKRRKS 132


>gi|218533382|ref|YP_002424197.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218525685|gb|ACK86269.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 170

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 52/146 (35%), Positives = 83/146 (56%), Gaps = 2/146 (1%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
            +  + +E  L  +VDIV AYV+N+ +  A++  LI  VH+ALQ++ +        Q  +
Sbjct: 5   QSGVEQNETILNRSVDIVLAYVNNNHIQSAELPGLIRVVHTALQQIANAPAGPTEPQFGK 64

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             P+  IR+SI    L    DG  +++LKRHL T + +  + YR ++ L  DYP  S  Y
Sbjct: 65  PSPSA-IRRSITPEGLISFIDGKSYQTLKRHL-TKNGLDINGYRARYGLPIDYPSTSSNY 122

Query: 124 ATTRSKLAKNMGLGRGRKKRVLTSKV 149
           + TR++LA++MGLGR   + + T  V
Sbjct: 123 SATRAELARSMGLGRKVNRSLKTDAV 148


>gi|332701276|ref|ZP_08421364.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332551425|gb|EGJ48469.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 135

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 65/136 (47%), Gaps = 3/136 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR-APCQDNVQPERLKPAV 68
            + +L+  ++IV A  S   +   +I S++  +   ++ V       + N   E  +   
Sbjct: 1   MDEYLKEALEIVKAQASVRNMTEEEITSMVMKLAEGIRNVGDGFMETEGNGNGEPQEAVT 60

Query: 69  PIRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
             +K++ +  + CLE G  FK+L KRHL   + +TPDEYR KW    + P+V +     R
Sbjct: 61  DPKKAVRDKSITCLECGCSFKTLTKRHLI-KYGLTPDEYRDKWGYPHNMPLVCKSLQRER 119

Query: 128 SKLAKNMGLGRGRKKR 143
            K  K M L   R K+
Sbjct: 120 RKKMKEMRLWERRAKK 135


>gi|170752190|ref|YP_001783335.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659317|gb|ACB28367.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 151

 Score =  157 bits (398), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 53/154 (34%), Positives = 81/154 (52%), Gaps = 8/154 (5%)

Query: 1   MDDD--ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           M+ D  A+  S+  +  MT  +V+AYV N+ VP +D+  LI     AL  + +  P    
Sbjct: 1   MNQDTIANAISAHDYGRMTATLVSAYVRNNHVPASDLAELIASAADALIGLGT--PDAST 58

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
                      IR+S+ +  L   EDG ++K+LKRHL T   +TP+ YR KW L  DYPM
Sbjct: 59  ASTAGKVTQAEIRRSVTHEALISFEDGKRYKTLKRHLTT-CGLTPETYRAKWGLPLDYPM 117

Query: 119 VSREYATTRSKLAKNMGLGRGRK---KRVLTSKV 149
           V+  Y+  RS +A ++   RG +   ++   S+V
Sbjct: 118 VAPGYSQRRSAIAASLQFNRGYRAIPQKAQASQV 151


>gi|240142322|ref|YP_002966832.1| putative transcriptional regulator MucR [Methylobacterium
           extorquens AM1]
 gi|240012266|gb|ACS43491.1| putative transcriptional regulator MucR [Methylobacterium
           extorquens AM1]
          Length = 163

 Score =  157 bits (397), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 46/133 (34%), Positives = 72/133 (54%), Gaps = 1/133 (0%)

Query: 5   ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL 64
           AS   ++  + +   IV AYV+N+ +P   + SLI  V S L  + +        +    
Sbjct: 3   ASETQNDVRILLVSRIVRAYVANNSIPAGGLPSLIVSVDSTLAGIANGQTSPKPAEDVSK 62

Query: 65  KPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
             +  +RKSI    +    DG  +K+LKRHL + +++TP +YR ++ L +DYPMV   Y+
Sbjct: 63  PTSAQVRKSIGQDGIVSFIDGRTYKTLKRHL-SKNDLTPMQYRERFGLPNDYPMVCASYS 121

Query: 125 TTRSKLAKNMGLG 137
             RS+LAK  GLG
Sbjct: 122 ARRSELAKQTGLG 134


>gi|218886897|ref|YP_002436218.1| MucR family transcriptional regulator [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757851|gb|ACL08750.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 133

 Score =  156 bits (396), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 41/135 (30%), Positives = 67/135 (49%), Gaps = 2/135 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  +DIV A  S   +   +I S++  +  A++++    PC++   PE   P   
Sbjct: 1   MEEYLKQALDIVKAQASVRTMNEEEISSMVQKIALAIRQISDGVPCEEQAAPEAPLP--D 58

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
             K+++   + CLE G  FK L R     H++TPD YR K+    D P+V +     R K
Sbjct: 59  AAKALKEKSITCLECGKTFKILTRKHLASHDLTPDSYRDKYGYRKDMPLVCKSLQRERRK 118

Query: 130 LAKNMGLGRGRKKRV 144
             K+M L   R+K+ 
Sbjct: 119 KMKDMKLWEKRRKQA 133


>gi|332703277|ref|ZP_08423365.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332553426|gb|EGJ50470.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 134

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 64/132 (48%), Gaps = 8/132 (6%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + FL+  ++IV A  S   +   +I S++  +   +Q + +          E   PA  
Sbjct: 1   MDDFLKEALEIVKAQASVRNMTEEEIISMVKSLAGGIQAIGASEGG------EAFNPAED 54

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+++   + CL+ G  FK L K+HL T H +TPD+YR KW+     P+V +     R 
Sbjct: 55  PKKAVKEKTIVCLDCGKSFKILTKKHLST-HGLTPDQYREKWDYPKKMPLVCKSLQRERR 113

Query: 129 KLAKNMGLGRGR 140
           K  K+M L   R
Sbjct: 114 KKMKDMRLWEKR 125


>gi|83310023|ref|YP_420287.1| transcriptional regulator [Magnetospirillum magneticum AMB-1]
 gi|82944864|dbj|BAE49728.1| Predicted transcriptional regulator [Magnetospirillum magneticum
           AMB-1]
          Length = 137

 Score =  155 bits (393), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 68/117 (58%), Gaps = 4/117 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           ++    +T  IVAAY+S+  +   +I +LI  V+S L    + A    +   ER +PAV 
Sbjct: 2   ADDIKALTAKIVAAYLSSSTLAATEIPTLIKSVYSTLAATDNPA----SAPAERQQPAVS 57

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           +++S+    + CLE G + K LKRHL T H +T DEYR KW L  DYP+V+ EYA  
Sbjct: 58  VKRSVTPDYIVCLECGDRQKVLKRHLTTGHGLTADEYRAKWALPRDYPLVAPEYAAR 114


>gi|242280857|ref|YP_002992986.1| MucR family transcriptional regulator [Desulfovibrio salexigens DSM
           2638]
 gi|242123751|gb|ACS81447.1| transcriptional regulator, MucR family [Desulfovibrio salexigens
           DSM 2638]
          Length = 131

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 43/135 (31%), Positives = 67/135 (49%), Gaps = 5/135 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E  L+  ++IV A  S   +   +I S++  + + ++++       ++ +P    P V 
Sbjct: 1   MEDHLKEALEIVKAQASVRTMTEEEITSMVHKLAAGIKKISEGMLDSNSPEP---TPPVD 57

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+I    + CLE G  FK L KRHL   + +TPDEYR KW  A   P+V +     R 
Sbjct: 58  PKKAIREKSIICLESGKSFKVLTKRHL-AKYGLTPDEYREKWGYAKKTPLVCKSLQRERR 116

Query: 129 KLAKNMGLGRGRKKR 143
           K  K M L   RKK+
Sbjct: 117 KKMKEMKLWEKRKKQ 131


>gi|258406286|ref|YP_003199028.1| transcriptional regulator, MucR family [Desulfohalobium retbaense
           DSM 5692]
 gi|257798513|gb|ACV69450.1| transcriptional regulator, MucR family [Desulfohalobium retbaense
           DSM 5692]
          Length = 133

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 41/136 (30%), Positives = 68/136 (50%), Gaps = 4/136 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + +L+  ++IV A      +   +I S++  + + L+ +V   P + +   E  +PAV 
Sbjct: 1   MDTYLQQALEIVKAQAGVRNMTEEEITSMVHRLANQLKGIVEGEPQEQH--EEHQEPAVD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+I    + CLE G  FK L KRHL   H +TP EY+ KW       ++++  A  R 
Sbjct: 59  PKKAIREKSVVCLECGKTFKVLTKRHL-AQHGLTPAEYKAKWGFKKTQSLIAKALARERR 117

Query: 129 KLAKNMGLGRGRKKRV 144
           K  ++M L   RKK  
Sbjct: 118 KKMQDMRLWERRKKNA 133


>gi|46580931|ref|YP_011739.1| transcriptional regulator [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601767|ref|YP_966167.1| MucR family transcriptional regulator [Desulfovibrio vulgaris DP4]
 gi|46450351|gb|AAS96999.1| transcriptional regulator, putative [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120561996|gb|ABM27740.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris DP4]
 gi|311234622|gb|ADP87476.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris
           RCH1]
          Length = 132

 Score =  155 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 37/133 (27%), Positives = 64/133 (48%), Gaps = 3/133 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + FL+  ++IV A  S   +   +I +++  + + L+ +   A  + N++    +    
Sbjct: 1   MDEFLKEALEIVKAQASVRTMTEDEITAMVRKLATGLKAI---AEGEMNLEEGCCETGGD 57

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            RK+I+   + CLE G  FK L +     H + PD YR KW L  + P+V +     R K
Sbjct: 58  PRKAIKEKTITCLECGKSFKILTKKHLASHGLDPDSYREKWGLKKNSPLVCKSLQRERRK 117

Query: 130 LAKNMGLGRGRKK 142
             K+M L   R+K
Sbjct: 118 KMKDMKLWEKRRK 130


>gi|218886076|ref|YP_002435397.1| MucR family transcriptional regulator [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757030|gb|ACL07929.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 132

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 60/135 (44%), Gaps = 4/135 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + FL+  ++IV A  S   +   +I S++  + + ++ +       +    E  +    
Sbjct: 1   MDDFLKEALEIVKAQASVRTMTEDEITSMVQKLANGIRAISLG----EAEPEEACETCGD 56

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            RK+++   + CLE G  FK L R     H +    YR KW L  + P+V +     R K
Sbjct: 57  PRKAVKEKSITCLECGKSFKILTRKHLASHGLDAAAYREKWGLKKNTPLVCKALQRERRK 116

Query: 130 LAKNMGLGRGRKKRV 144
             K+M L   R+K V
Sbjct: 117 KMKDMKLWEKRRKHV 131


>gi|162148657|ref|YP_001603118.1| ROS/MUCR transcriptional regulator protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787234|emb|CAP56827.1| putative ROS/MUCR transcriptional regulator protein
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 149

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 45/105 (42%), Positives = 63/105 (60%), Gaps = 3/105 (2%)

Query: 35  IGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRH 94
           + +LI  V+  L      A   +   P    PAVPI++S+    + CLEDG + K LKRH
Sbjct: 1   MPNLIRAVYETLVSAGRPAESTNATAP---TPAVPIKRSVFPDYIVCLEDGKKLKMLKRH 57

Query: 95  LKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRG 139
           L + + MTP +YR +W L +DYPMV+  YAT RS+LA+  GLG+ 
Sbjct: 58  LSSAYGMTPGQYRERWGLPADYPMVAPNYATRRSELARASGLGQK 102


>gi|256830061|ref|YP_003158789.1| MucR family transcriptional regulator [Desulfomicrobium baculatum
           DSM 4028]
 gi|256579237|gb|ACU90373.1| transcriptional regulator, MucR family [Desulfomicrobium baculatum
           DSM 4028]
          Length = 134

 Score =  154 bits (390), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 43/138 (31%), Positives = 66/138 (47%), Gaps = 7/138 (5%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  ++IV A  S   +   +I S+I  +  +++ V      +        +PAV 
Sbjct: 1   MEDYLKQAIEIVKAQASVRNMNEDEITSMIRALTQSIRGV-----AEGVAPIVDTEPAVD 55

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            + +I    + C E G  FK L KRHL T H +TP+EYR K+       +V++  A  R 
Sbjct: 56  PKNAIREKSVICCECGKSFKVLTKRHLAT-HGLTPEEYREKFGYKKGTSLVAKSLARDRR 114

Query: 129 KLAKNMGLGRGRKKRVLT 146
           K  + M L   RKK V T
Sbjct: 115 KTMQGMKLWEKRKKAVKT 132


>gi|298530495|ref|ZP_07017897.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509869|gb|EFI33773.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 136

 Score =  154 bits (390), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 37/136 (27%), Positives = 65/136 (47%), Gaps = 2/136 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E  ++  ++IV A  S   +   +I S+I  +   +Q+    A  +     E   PAV 
Sbjct: 1   MEDHVKQALEIVKAQASVRNMTEEEINSMIKSLSEGIQKASQGAAEEQVS--EEQHPAVD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K+I    + CLE G  FK + +     H+MTP+EY+ KW    +  +V++  A  R K
Sbjct: 59  PKKAIREKSIICLECGKSFKVITKKHLAKHDMTPEEYKEKWGYKKNQSLVAKSLARERRK 118

Query: 130 LAKNMGLGRGRKKRVL 145
             + M L + R+ ++ 
Sbjct: 119 KMQEMELWKKREIKMP 134


>gi|260464128|ref|ZP_05812322.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
 gi|259030113|gb|EEW31395.1| transcriptional regulator, MucR family [Mesorhizobium opportunistum
           WSM2075]
          Length = 138

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 49/133 (36%), Positives = 71/133 (53%), Gaps = 5/133 (3%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
                  LE T  IV+A+VS +    +D+  L+ +V  ALQ +             ++ P
Sbjct: 2   ATDPVHHLESTAKIVSAFVSRNRASPSDLVDLVENVGRALQALAGGTEKSKP----KIVP 57

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           AVPI KS+    +  LEDG + KSLKR+L +   MTP +YR KW L  DYP+V+  +   
Sbjct: 58  AVPISKSVTPDFIISLEDGRRMKSLKRYLAS-LGMTPADYRRKWGLPPDYPLVAPNFTAL 116

Query: 127 RSKLAKNMGLGRG 139
           RS+ AK + LG+ 
Sbjct: 117 RSQAAKRIRLGQR 129


>gi|328952055|ref|YP_004369389.1| transcriptional regulator, MucR family [Desulfobacca acetoxidans
           DSM 11109]
 gi|328452379|gb|AEB08208.1| transcriptional regulator, MucR family [Desulfobacca acetoxidans
           DSM 11109]
          Length = 146

 Score =  154 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 47/143 (32%), Positives = 78/143 (54%), Gaps = 9/143 (6%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER------ 63
           +   L+MT  I+ ++ S   +   ++ S I  V++ L  +   A    + +         
Sbjct: 2   ATELLKMTAQIITSHASISELSSQELISEIKSVYNTLAELAGEAATAPSPEVTPTETKGM 61

Query: 64  --LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNL-ASDYPMVS 120
             LKPA+P+ +S+++  + CLE G +FK+LK HL+  H MTP +Y  ++ L A  YP+VS
Sbjct: 62  TGLKPAIPVEESLQDDYIVCLECGQKFKTLKAHLRRAHQMTPADYYERFGLDAKKYPLVS 121

Query: 121 REYATTRSKLAKNMGLGRGRKKR 143
           R Y+  R +LAK  GLG  R+ +
Sbjct: 122 RNYSEQRRQLAKEKGLGDFRRSK 144


>gi|218531276|ref|YP_002422092.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218523579|gb|ACK84164.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 154

 Score =  153 bits (388), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 48/138 (34%), Positives = 80/138 (57%), Gaps = 4/138 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S+ +    +++++ + +AYV NH +  AD+  LI   +SAL  +  +A    +  P   +
Sbjct: 7   SYAAMAAPVDLSIMVASAYVRNHTLAAADLPGLIQGTYSALAGL--KAEPDAHAAPRVQR 64

Query: 66  P-AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           P A  IR+SI    L    DG  +  LKRHL+  H + PD YR ++ L +DYPMV+  Y+
Sbjct: 65  PTAGQIRRSISPEGLISFIDGAPYMMLKRHLR-RHGLDPDSYRARYGLPADYPMVAPSYS 123

Query: 125 TTRSKLAKNMGLGRGRKK 142
             RS++A+++GL + R+K
Sbjct: 124 ERRSEIARSVGLPQRRRK 141


>gi|170752166|ref|YP_001783312.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659293|gb|ACB28344.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 147

 Score =  153 bits (387), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 49/149 (32%), Positives = 81/149 (54%), Gaps = 3/149 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M+   +  S      +T  ++AA+VS++ V  +D+ SLI   H+A+  + +         
Sbjct: 1   MNGSYAGSSHVDCNTLTTRVIAAFVSHNHVAASDVPSLIALTHAAIASLQTAGSSTAPGT 60

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
             +  PA  IR SI    L   EDG ++K+LKRHL T   +TP+ YR KW L +DYP+V+
Sbjct: 61  V-KATPA-QIRASITYEALISFEDGKRYKTLKRHL-TACGLTPETYRAKWGLPNDYPLVA 117

Query: 121 REYATTRSKLAKNMGLGRGRKKRVLTSKV 149
             YA  RS++AK++ + R ++     ++ 
Sbjct: 118 PGYAEKRSRIAKSLVMPRYQRDPAPEAEA 146


>gi|317484823|ref|ZP_07943718.1| transcriptional regulator [Bilophila wadsworthia 3_1_6]
 gi|316923930|gb|EFV45121.1| transcriptional regulator [Bilophila wadsworthia 3_1_6]
          Length = 134

 Score =  153 bits (387), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 63/133 (47%), Gaps = 2/133 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            +  L+  +DIV A  S  ++   +I S++  + S ++ V     C + +    ++    
Sbjct: 1   MDDHLKEALDIVKAQASVRIMSEDEIISMVRRLSSDIKNVAEGEGCVEELASSDVQ--SD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            RKSI+   + C+E G  FK L R     HN+   EYR KW L  D P+V +     R K
Sbjct: 59  PRKSIKEKSITCMECGKTFKILTRKHLASHNLDAAEYREKWGLKKDTPLVCKGLQRERRK 118

Query: 130 LAKNMGLGRGRKK 142
             K+M L   R+K
Sbjct: 119 KMKDMKLWEKRRK 131


>gi|294146435|ref|YP_003559101.1| AlgP-family transcriptional regulator [Sphingobium japonicum UT26S]
 gi|292676852|dbj|BAI98369.1| AlgP-family transcriptional regulator [Sphingobium japonicum UT26S]
          Length = 279

 Score =  153 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 44/136 (32%), Positives = 71/136 (52%), Gaps = 4/136 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S ++      +TV +V+A+VSN+ V    +  LI     AL      A   ++       
Sbjct: 2   SENNQPDITTLTVQLVSAFVSNNNVASEGLADLIRTTRLALTD--DLAAKPEDAAAPTYT 59

Query: 66  PAVPIRKSIE-NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           PAV +RKS+     +  + DG  +K+LKRHL + H +TP+EYR ++ L   YP+V+  Y+
Sbjct: 60  PAVSVRKSLSSPEHILSMIDGRPYKTLKRHLAS-HGLTPNEYRERYGLPKSYPLVAPNYS 118

Query: 125 TTRSKLAKNMGLGRGR 140
             R  +A  +GLG+  
Sbjct: 119 EARRAVATKLGLGKKP 134


>gi|242281037|ref|YP_002993166.1| MucR family transcriptional regulator [Desulfovibrio salexigens DSM
           2638]
 gi|242123931|gb|ACS81627.1| transcriptional regulator, MucR family [Desulfovibrio salexigens
           DSM 2638]
          Length = 128

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 62/133 (46%), Gaps = 5/133 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  ++IV A  S   +   ++ S++  + + +Q +      ++ +  +   PA  
Sbjct: 1   MEDYLKEALEIVKAQASVRTMSEEEMTSMVRKLSAGIQAI-----AENALPAQEEAPACE 55

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +KSI+   + C E G  FK + +     H +TPDEYR K+ L    P+V +     R K
Sbjct: 56  PKKSIKEKSIVCCECGKSFKIITKKHLASHGLTPDEYREKYGLKKKTPLVCKSLQRERRK 115

Query: 130 LAKNMGLGRGRKK 142
             K M L   R K
Sbjct: 116 KMKEMKLWTKRGK 128


>gi|220921285|ref|YP_002496586.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219945891|gb|ACL56283.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 148

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 52/130 (40%), Positives = 73/130 (56%), Gaps = 4/130 (3%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           DA     E  + +T D+++AYVSN+ V   D+  LIT+VH+A+  +       D     +
Sbjct: 2   DAKNQKPESAVALTADVISAYVSNNHVQADDLVRLITEVHAAITAIGRGQKAPDPA--RK 59

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
             PA  IR+SI    L   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM S  Y
Sbjct: 60  PTPA-EIRRSIGRDVLISFEDGKPYKTLRRHL-TMRGLTPESYRRKWGLPLDYPMTSASY 117

Query: 124 ATTRSKLAKN 133
           +  RS+LA+ 
Sbjct: 118 SEQRSQLART 127


>gi|78355350|ref|YP_386799.1| MucR family transcriptional regulator [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78217755|gb|ABB37104.1| transcriptional regulator, MucR family [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 130

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 39/135 (28%), Positives = 67/135 (49%), Gaps = 5/135 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            +  L+  ++IV A  S   +   +I S++  +  ++Q++      + N++P+  +PA  
Sbjct: 1   MDEALKQALEIVKAQASVRTMTEDEINSMVLKLAQSIQQIT-----EGNIEPQEAEPAAD 55

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
             K+I+   + CLE G  FK L R     H++TP EYR KW    + P+V +     R K
Sbjct: 56  PAKAIKEKSITCLECGKTFKILTRKHLGTHDLTPAEYREKWGYKKNLPLVCKTLQRERRK 115

Query: 130 LAKNMGLGRGRKKRV 144
             K+M L   RK + 
Sbjct: 116 KMKDMKLWEKRKAKA 130


>gi|46581483|ref|YP_012291.1| transcriptional regulator [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601348|ref|YP_965748.1| MucR family transcriptional regulator [Desulfovibrio vulgaris DP4]
 gi|46450905|gb|AAS97551.1| transcriptional regulator, putative [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120561577|gb|ABM27321.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris DP4]
 gi|311235133|gb|ADP87987.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris
           RCH1]
          Length = 132

 Score =  152 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 39/135 (28%), Positives = 65/135 (48%), Gaps = 3/135 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E  L+  ++IV A  S   +   +I S++  + +A++ +    P +   QPE     V 
Sbjct: 1   MEDHLKQALEIVKAQASVRTMTEDEISSMVFKLANAIRSISDGEPAE---QPEAEAAPVD 57

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
             ++++   + CLE G  FK + R     H++TPD YR K+    D P+V +     R K
Sbjct: 58  ASRALKEKSITCLECGKSFKIITRKHLMLHDLTPDTYREKYGYKKDMPLVCKALQRERRK 117

Query: 130 LAKNMGLGRGRKKRV 144
             K+M L   R+K V
Sbjct: 118 KMKDMKLWEKRRKTV 132


>gi|170738626|ref|YP_001767281.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168192900|gb|ACA14847.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 151

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 48/132 (36%), Positives = 72/132 (54%), Gaps = 4/132 (3%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S  ++ +   +T DI  AY+S + +   ++  LI ++H AL+      P Q+        
Sbjct: 4   SNTNAAKLAALTADIATAYLSRNHLQTGEVPRLIAEIHGALRVASHGTPVQEGPPKPT-- 61

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
            A  IR+S+    L   EDG  +K+L+RHL T   +TP+ YR KW L  DYPM S EY+ 
Sbjct: 62  -ASEIRRSVTPEALISFEDGKPYKTLRRHL-TRLGLTPETYRQKWGLPPDYPMTSAEYSK 119

Query: 126 TRSKLAKNMGLG 137
            RS+LA+ + LG
Sbjct: 120 RRSELARALTLG 131


>gi|46205056|ref|ZP_00209683.1| hypothetical protein Magn03002427 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 127

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 51/81 (62%), Positives = 64/81 (79%)

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
             L PAVPIR+SI+   L CLEDG +FKSLKRHL+T +N++PDEYR +WNL  DYPMV+ 
Sbjct: 12  PPLTPAVPIRRSIQQDFLICLEDGKKFKSLKRHLRTRYNLSPDEYRARWNLPDDYPMVAP 71

Query: 122 EYATTRSKLAKNMGLGRGRKK 142
            YA TRS+LA+ MGLG+ R+K
Sbjct: 72  SYAATRSELARTMGLGQQRRK 92


>gi|307295341|ref|ZP_07575180.1| transcriptional regulator, MucR family [Sphingobium
           chlorophenolicum L-1]
 gi|306878844|gb|EFN10063.1| transcriptional regulator, MucR family [Sphingobium
           chlorophenolicum L-1]
          Length = 262

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 45/143 (31%), Positives = 72/143 (50%), Gaps = 4/143 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S ++      +TV +V+A+VSN+ V   ++  LI     AL      A   D        
Sbjct: 2   SENNQPDITTLTVQLVSAFVSNNNVASENLADLIRTTRLALTD--DPAAKPDEAAAPTYT 59

Query: 66  PAVPIRKSIE-NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           PAV +RKS+     +  + DG  +K+LKRHL + H +TP++YR ++ L   YP+V+  Y+
Sbjct: 60  PAVSVRKSLSSPEHILSMIDGKPYKTLKRHLAS-HGLTPNDYRERYGLPKSYPLVAPNYS 118

Query: 125 TTRSKLAKNMGLGRGRKKRVLTS 147
             R  +A  +GLGR        +
Sbjct: 119 EARRAVATKLGLGRKPVVSAKKA 141


>gi|166007397|pdb|2JSP|A Chain A, The Prokaryotic Cys2his2 Zinc Finger Adopts A Novel Fold
           As Revealed By The Nmr Structure Of A. Tumefaciens Ros
           Dna Binding Domain
          Length = 87

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 51/84 (60%), Positives = 63/84 (75%)

Query: 58  NVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117
            V  E+ KPAV +RKS+++  + CLE G  FKSLKRHL THH+MTP+EYR KW+L  DYP
Sbjct: 1   AVNVEKQKPAVSVRKSVQDDHIVCLECGGSFKSLKRHLTTHHSMTPEEYREKWDLPVDYP 60

Query: 118 MVSREYATTRSKLAKNMGLGRGRK 141
           MV+  YA  RS+LAK MGLG+ RK
Sbjct: 61  MVAPAYAEARSRLAKEMGLGQRRK 84


>gi|254420954|ref|ZP_05034678.1| ROS/MUCR transcriptional regulator protein [Brevundimonas sp. BAL3]
 gi|196187131|gb|EDX82107.1| ROS/MUCR transcriptional regulator protein [Brevundimonas sp. BAL3]
          Length = 151

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 51/153 (33%), Positives = 77/153 (50%), Gaps = 8/153 (5%)

Query: 1   MDDDASFDS-SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAP-CQDN 58
           M D  +  + +   L +T DIV A+++++ +    +  LI   H AL  +    P     
Sbjct: 1   MTDRTTETAGAADRLSLTADIVVAFLASNTLDAGAVPELIRSTHRALGGLGVLEPEAAPE 60

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
             PER   +  IRKS+ +  +    DG  +++LKRHL T H  TPD YR  + L +DYPM
Sbjct: 61  ATPERPNRSA-IRKSLSDEGIVSFVDGGTYRTLKRHLST-HGYTPDSYRAHFGLPADYPM 118

Query: 119 VSREYATTRSKLAKNMGLGRGR----KKRVLTS 147
           V+  Y+  RS  AK  GLG  R    +K+   +
Sbjct: 119 VAPAYSAIRSAQAKANGLGAKRPPASRKKRKPA 151


>gi|170745597|ref|YP_001776819.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170752154|ref|YP_001783300.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659251|gb|ACB28303.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659281|gb|ACB28332.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 151

 Score =  151 bits (381), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 51/151 (33%), Positives = 77/151 (50%), Gaps = 5/151 (3%)

Query: 1   MDDDASFD--SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           MD +   D  S+  +  MT  +V+AYV  + VP++D+ +LI     AL  + +       
Sbjct: 1   MDQNRITDTVSAADYGRMTAHLVSAYVRRNNVPVSDLATLIASAADALIGLTNSD-TPAA 59

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
               +  PA  IR SI +  L   EDG ++++LKRHL T H +TP+ YR KW L  DYPM
Sbjct: 60  PAASKTTPA-QIRASITHEALISFEDGKRYQTLKRHL-TVHGLTPETYRAKWGLPRDYPM 117

Query: 119 VSREYATTRSKLAKNMGLGRGRKKRVLTSKV 149
           V+  Y+  RS +A ++     R      +  
Sbjct: 118 VAPGYSERRSAIATSLQFRPSRGATARKAGA 148


>gi|170751263|ref|YP_001757523.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170657785|gb|ACB26840.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 136

 Score =  150 bits (379), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 45/124 (36%), Positives = 69/124 (55%), Gaps = 3/124 (2%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSI 74
           ++ + +V AY+SN+ +P   I  L+  VH A   +  R P      PE+   A  IR S+
Sbjct: 14  DVALRVVTAYLSNNALPHTGIPPLLVTVHGAFSALAVR-PAVTEAPPEQPD-AARIRGSV 71

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
               +    DG  +K++KRHL T H +TP+ YR ++ L  DYPM +  YA  RS++AK +
Sbjct: 72  RPDGIVSFIDGRSYKTMKRHL-TAHGLTPERYRARYGLPDDYPMTAPGYAERRSEIAKAI 130

Query: 135 GLGR 138
            LG+
Sbjct: 131 RLGK 134


>gi|332187876|ref|ZP_08389609.1| ROS/MUCR transcriptional regulator family protein [Sphingomonas sp.
           S17]
 gi|332012037|gb|EGI54109.1| ROS/MUCR transcriptional regulator family protein [Sphingomonas sp.
           S17]
          Length = 162

 Score =  150 bits (379), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 47/147 (31%), Positives = 81/147 (55%), Gaps = 8/147 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSN--HVVPMADIGSLITDVHSALQRVVSRAPCQDN 58
           M DD    ++   +E+  ++  A++ N        ++ + +  +H  +  ++  AP   +
Sbjct: 1   MADDPIDVNA---VELATELTIAWLGNPNTRTSAEEVPAFLGKMHETVSSLLGSAPQTTD 57

Query: 59  VQ-PERLKPAVPIRKSI-ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116
           V+ P    PAV +RKS+     +  + DG  +K+L+RHL T H +TP+EYR ++ L SDY
Sbjct: 58  VEAPTEYVPAVSVRKSLASKDHIISMIDGKPYKTLRRHLAT-HGLTPEEYRERYGLKSDY 116

Query: 117 PMVSREYATTRSKLAKNMGLGRGRKKR 143
           PMV+  Y+ +R  +AK +GLGR    R
Sbjct: 117 PMVAESYSESRRAMAKKIGLGRKPGPR 143


>gi|189425919|ref|YP_001953096.1| MucR family transcriptional regulator [Geobacter lovleyi SZ]
 gi|189422178|gb|ACD96576.1| transcriptional regulator, MucR family [Geobacter lovleyi SZ]
          Length = 160

 Score =  149 bits (378), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 39/128 (30%), Positives = 64/128 (50%), Gaps = 4/128 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   +E+T +IVAA+ S + +    + SLI  VH  L+ +      +   +P      + 
Sbjct: 2   SSVLVELTSEIVAAHASVNEMTSEQMLSLIQKVHGLLKSLEEGGSPEVEAKPAV---TLQ 58

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +KSI+   + CL  G   FK+L RHLK  H+M P +YR ++ L +   +V++ Y+  R 
Sbjct: 59  PKKSIQKDQVVCLICGKGGFKTLTRHLKQVHDMKPGQYRKQFGLPAGTALVAKNYSEARR 118

Query: 129 KLAKNMGL 136
             A    L
Sbjct: 119 ASAIERNL 126


>gi|298530002|ref|ZP_07017404.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509376|gb|EFI33280.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 135

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 68/136 (50%), Gaps = 3/136 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E  ++  ++IV A  +   +   +I S+I  + + +Q        Q+    +  +P+V 
Sbjct: 1   MEDHVKQALEIVKAQAAVRNMTEEEINSMIKSLSAGIQEASKTDELQEK---DSQEPSVD 57

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K+I+   + CLE G  FK L +     H+MTP+EY+ KW    +  +V++  A  R K
Sbjct: 58  PKKAIKEKSITCLECGKSFKVLTKKHFAKHDMTPEEYKAKWGYKKNQSLVAKSLARERRK 117

Query: 130 LAKNMGLGRGRKKRVL 145
             ++M L + R+ ++ 
Sbjct: 118 KMQDMELWKKREIKMP 133


>gi|258405035|ref|YP_003197777.1| transcriptional regulator, MucR family [Desulfohalobium retbaense
           DSM 5692]
 gi|257797262|gb|ACV68199.1| transcriptional regulator, MucR family [Desulfohalobium retbaense
           DSM 5692]
          Length = 137

 Score =  149 bits (376), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 40/135 (29%), Positives = 68/135 (50%), Gaps = 4/135 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +++  ++IV A      +   +I S++  +   L+ +      Q+  + +  +PAV 
Sbjct: 1   MEDYMKQALEIVKAQAGVRNMSEEEITSMVQALSQKLKNLEEG--TQEQEEQQEQQPAVD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+I    + CLE G QFK L K+HL T H +TP EY+ KW       ++++  A  R 
Sbjct: 59  PKKAIREKSVICLECGKQFKVLTKKHLAT-HGLTPAEYKEKWGFKKTQALIAKSLARERK 117

Query: 129 KLAKNMGLGRGRKKR 143
           K  + M L   RKK+
Sbjct: 118 KKMQEMQLWERRKKK 132


>gi|256828325|ref|YP_003157053.1| MucR family transcriptional regulator [Desulfomicrobium baculatum
           DSM 4028]
 gi|256577501|gb|ACU88637.1| transcriptional regulator, MucR family [Desulfomicrobium baculatum
           DSM 4028]
          Length = 130

 Score =  148 bits (375), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 6/135 (4%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +++  ++IV A  S   +   ++ S+I  +   ++ V       +  +PE       
Sbjct: 1   MEEYVKQALEIVKAQASVRNMNEEELTSMIRSLTEGIKNVAEG----NQPEPEATLSLDD 56

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+I    + C+E    FK L KRHL T H +TP+EYR KW       +V++  A  R 
Sbjct: 57  AKKAIREKSIICMECSKSFKVLTKRHLAT-HGLTPEEYREKWGYKKGTSLVAKSLARDRR 115

Query: 129 KLAKNMGLGRGRKKR 143
           K  ++M L   R K+
Sbjct: 116 KKMQDMKLWEKRVKK 130


>gi|298528759|ref|ZP_07016163.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298512411|gb|EFI36313.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 139

 Score =  148 bits (374), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 61/134 (45%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E  ++  ++IV A  S   +   +I S+I  +   +Q+        +    +  +PA  
Sbjct: 1   MEDHVKQALEIVKAQASVRNMTEEEINSMIKSLSEGIQKASQ--EVAEPQAEQEQQPATD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K+I    + CLE G  FK L +     H+MT +EY+ KW    +  +V +  A  R K
Sbjct: 59  PKKAIREKSILCLECGKSFKVLTKKHFAKHDMTTEEYKEKWGYKKNQSLVCKSLARERKK 118

Query: 130 LAKNMGLGRGRKKR 143
             + M L + R+ +
Sbjct: 119 KMQEMELWKKREMK 132


>gi|239908073|ref|YP_002954814.1| hypothetical protein DMR_34370 [Desulfovibrio magneticus RS-1]
 gi|239797939|dbj|BAH76928.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 133

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 37/133 (27%), Positives = 61/133 (45%), Gaps = 2/133 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  ++IV A   +  +   +I S++  V S +  + +  P     Q E   P + 
Sbjct: 1   MEEYLQSALEIVKAQAGSRPMTEEEILSMVKSVASGIAALTTGQPVLG--QEEAAAPGMD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +KSI+   + CLE G  FK + R     H +TP+EYR K+       +  +  A  R  
Sbjct: 59  PKKSIKEASIACLECGKSFKVITRKHLASHGLTPEEYRAKYGFKKTQALACKSLARERRA 118

Query: 130 LAKNMGLGRGRKK 142
             K+M L   R+K
Sbjct: 119 KMKDMKLWERRQK 131


>gi|218887346|ref|YP_002436667.1| MucR family transcriptional regulator [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758300|gb|ACL09199.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 130

 Score =  148 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 60/132 (45%), Gaps = 6/132 (4%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +E +L+  +DIV A  S   +   +I +++  +   ++ +       ++        A+ 
Sbjct: 2   TESYLKEALDIVKAQASVRTMTEDEITTMVRRLAEGIRTLSEGGALPESGDGA----AMD 57

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+I+   + C E G  FK L K+HL T H  TP+ YR K       P+V +     R 
Sbjct: 58  PKKAIKEKSITCCECGKSFKILTKKHLAT-HGFTPETYREKCGYKKGTPLVCKSLQRERR 116

Query: 129 KLAKNMGLGRGR 140
           K  ++M L   R
Sbjct: 117 KKMRDMKLWERR 128


>gi|256829069|ref|YP_003157797.1| MucR family transcriptional regulator [Desulfomicrobium baculatum
           DSM 4028]
 gi|256578245|gb|ACU89381.1| transcriptional regulator, MucR family [Desulfomicrobium baculatum
           DSM 4028]
          Length = 133

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 39/139 (28%), Positives = 65/139 (46%), Gaps = 7/139 (5%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E  L+  ++IV A  S   +   +I S+I  +  +++ V      +        +PAV 
Sbjct: 1   MEDSLKQAIEIVKAQASVRNMNEDEITSMIKALAGSIRGV-----AEGVAPVVETEPAVD 55

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            + +I    + C E G  FK L KRHL T H +TP++Y+ K+       +V++  A +R 
Sbjct: 56  PKNAIREKSVICCECGKSFKVLTKRHLIT-HGLTPEQYKEKYGYKKGTSLVAKSLARSRR 114

Query: 129 KLAKNMGLGRGRKKRVLTS 147
           K  ++M L   RKK     
Sbjct: 115 KTMQDMKLWEKRKKAPKAK 133


>gi|212702312|ref|ZP_03310440.1| hypothetical protein DESPIG_00323 [Desulfovibrio piger ATCC 29098]
 gi|212674258|gb|EEB34741.1| hypothetical protein DESPIG_00323 [Desulfovibrio piger ATCC 29098]
          Length = 136

 Score =  147 bits (372), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 63/135 (46%), Gaps = 5/135 (3%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + + +L+  ++I  A  S  V+   +I S I  V + ++ V   A  +  V+ +      
Sbjct: 4   TMDDYLKEALEIARAQASVRVMSEEEITSFIQKVAAGIRTV---AEGEMPVELDSADMQQ 60

Query: 69  PIRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
             RKSI+   + CLE G  FK L KRHL   H M    YR KW    D P+V +     R
Sbjct: 61  DARKSIKEKSVTCLECGKTFKILTKRHL-AMHGMDAAAYREKWGFKKDTPLVCKALQRER 119

Query: 128 SKLAKNMGLGRGRKK 142
            +  K+M L   R+K
Sbjct: 120 RRKMKDMKLWEKRRK 134


>gi|303326659|ref|ZP_07357101.1| putative transcriptional regulator [Desulfovibrio sp. 3_1_syn3]
 gi|302862647|gb|EFL85579.1| putative transcriptional regulator [Desulfovibrio sp. 3_1_syn3]
          Length = 132

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 41/134 (30%), Positives = 64/134 (47%), Gaps = 5/134 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + +L+  ++I  A     ++   +I + I  V   ++ V   A  +  V+ +  + A  
Sbjct: 1   MDDYLKEALEITRAQAGVRIMTEEEIAAFIQKVAMGIRAV---AEGEAPVELDSAEMAQE 57

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            RKS++   + CLE G  FK L KRHL + H M   EYR KW    D P+V +     R 
Sbjct: 58  ARKSVKEKSVTCLECGKSFKILTKRHLAS-HGMDTAEYREKWGFKKDAPLVCKALQRERR 116

Query: 129 KLAKNMGLGRGRKK 142
           K  K+M L   R+K
Sbjct: 117 KKMKDMKLWEKRRK 130


>gi|330992892|ref|ZP_08316835.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329760046|gb|EGG76547.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 346

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 47/157 (29%), Positives = 75/157 (47%), Gaps = 20/157 (12%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAP----------------- 54
           + +E+T DI+  Y+  + V   ++  LI  V ++L   ++  P                 
Sbjct: 5   KLIEITGDIIREYIKINQVAPHELPGLIQSVRASLCGPMTMPPRTDMPPAAQVPPPAAGQ 64

Query: 55  ---CQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWN 111
                  V      PAVP+ +S+    + CLEDG   + LKR+++    MT D+YR KWN
Sbjct: 65  GRVEATTVTEPGPVPAVPVERSVFPEYIVCLEDGRHMRVLKRYIQRMFGMTEDDYRKKWN 124

Query: 112 LASDYPMVSREYATTRSKLAKNMGLGRGRKKRVLTSK 148
           L  DYPMV+  Y+  R  +AK  GLG+  +K    ++
Sbjct: 125 LPEDYPMVAPAYSLHRRFIAKMKGLGKSYRKAGTPAE 161


>gi|78357655|ref|YP_389104.1| MucR family transcriptional regulator [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78220060|gb|ABB39409.1| transcriptional regulator, MucR family [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 156

 Score =  147 bits (371), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 65/135 (48%), Gaps = 5/135 (3%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
           + + +L+  ++IV A  S   +   +I S++  + S ++ +     C+ +V P+    A 
Sbjct: 24  NMDDYLKEALEIVKAQASVRNMTEDEITSMVMKLASGIKGI-----CEGSVTPDGGMDAQ 78

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
             ++SI+   + CLE G  FK + +     H++    YR KW    + P+V +     R 
Sbjct: 79  AAQRSIKEKTISCLECGKSFKIITKKHLALHDLDAVSYREKWGFKKNTPLVCKSLQRERR 138

Query: 129 KLAKNMGLGRGRKKR 143
           K  K+M L   R+K+
Sbjct: 139 KKMKDMQLWEKRRKQ 153


>gi|170749695|ref|YP_001755955.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656217|gb|ACB25272.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 141

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 46/126 (36%), Positives = 67/126 (53%), Gaps = 3/126 (2%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           L+ ++ IV AYVS + V    +  ++   +  L ++ S  P      PE    A  IR S
Sbjct: 17  LKNSIKIVCAYVSRNSVSHTQLCEILVSTYEMLCQI-SVGPAPAVATPEAAT-AREIRTS 74

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I+   L    DG  +K+LKRHL T H +TP +YR K+ L  DYPMV+  YA  RS++A+ 
Sbjct: 75  IQAEGLISFIDGRSYKTLKRHL-TAHGLTPQDYRAKYGLPRDYPMVAPGYAAKRSEIARL 133

Query: 134 MGLGRG 139
           + L   
Sbjct: 134 LQLRHK 139


>gi|148553115|ref|YP_001260697.1| MucR family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148498305|gb|ABQ66559.1| transcriptional regulator, MucR family [Sphingomonas wittichii RW1]
          Length = 162

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 46/154 (29%), Positives = 82/154 (53%), Gaps = 8/154 (5%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPM--ADIGSLITDVHSALQRVVSRAPC--Q 56
           M ++    +S   LE+  ++  A+++N        ++   +  +H A+  + S A    +
Sbjct: 1   MPEEEKGANS--HLELATELTIAWLANPNTRATKEEVPEFLKSMHEAVASLSSDASADAE 58

Query: 57  DNVQPERLKPAVPIRKSI-ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASD 115
            +       PAV +RKS+     +  + DG  +K+L+RHL T HN+TP+EYR ++ L +D
Sbjct: 59  PSAAAPEHVPAVSVRKSLASKDHIISMIDGKPYKTLRRHLST-HNLTPEEYRERYGLKAD 117

Query: 116 YPMVSREYATTRSKLAKNMGLGRGRKKRVLTSKV 149
           YPMV+  Y+  R ++AK +GLGR   ++    K 
Sbjct: 118 YPMVAPSYSEHRREMAKRIGLGRKPGQKAPPRKA 151


>gi|170745612|ref|YP_001752059.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659340|gb|ACB28389.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 134

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 46/121 (38%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 16  MTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE 75
           MT  +V+AYV  + VP++D+ +LI     AL  + +  P               IR SI 
Sbjct: 1   MTAHLVSAYVRRNNVPVSDLATLIASAADALIGLRN--PDTPAAPAAGKTTPAQIRASIT 58

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135
           +  L   EDG  +K+LKRHL T   +TP+ YR KW L  DYPMV+  Y+  RS +A ++ 
Sbjct: 59  HEALISFEDGRGYKTLKRHL-TACGLTPETYRAKWGLPRDYPMVAPGYSERRSAIAMSLQ 117

Query: 136 L 136
           L
Sbjct: 118 L 118


>gi|317153558|ref|YP_004121606.1| ROSMUCR transcriptional regulator [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316943809|gb|ADU62860.1| ROSMUCR transcriptional regulator [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 128

 Score =  146 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 57/133 (42%), Gaps = 5/133 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E  L+  ++IV A  S   +   +I S++  + + ++ +      +          ++ 
Sbjct: 1   MEDHLKEALEIVKAQASVRTMTEEEITSMVQKLAAGIKAIAEGGGIEIEPDA-----SLD 55

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K+I    + C   G  FK L +   + H++TP+EYR K+      P+V +     R K
Sbjct: 56  PKKAIREKTIICCVCGKSFKILTKKHLSSHDLTPEEYREKFGYKKKLPLVCKSLQRERRK 115

Query: 130 LAKNMGLGRGRKK 142
             K M L   R K
Sbjct: 116 KMKEMKLWTKRGK 128


>gi|118592655|ref|ZP_01550045.1| transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118434706|gb|EAV41357.1| transcriptional regulator [Stappia aggregata IAM 12614]
          Length = 109

 Score =  146 bits (370), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 49/109 (44%), Positives = 74/109 (67%), Gaps = 5/109 (4%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           +D+S ++S   +++T DIV AYVSN++V   ++  LI  VH   Q + + A   +  + E
Sbjct: 2   NDSSVETS--LIDLTSDIVTAYVSNNMVTTTELTDLIGSVH---QALHAAAAVAEEPEAE 56

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWN 111
           RL PAV I+KS++   + CLEDG +FKSLKRHL++ +N+TP+EYR KW 
Sbjct: 57  RLIPAVAIKKSVQPDYIVCLEDGKRFKSLKRHLRSTYNLTPEEYRGKWG 105


>gi|330990810|ref|ZP_08314766.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
 gi|329762250|gb|EGG78738.1| Putative mucR family transcriptional regulatory protein
           [Gluconacetobacter sp. SXCC-1]
          Length = 204

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 49/120 (40%), Positives = 73/120 (60%), Gaps = 4/120 (3%)

Query: 22  AAYVSNH--VVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCL 79
           AA++ N    +P   + + I DV++A++   +    + N      +PAVP+ +S+    +
Sbjct: 2   AAHLGNTNTSLPTEHVPAFIRDVYAAIRE--TTPATEKNSSIPAQQPAVPVGQSVFPDHI 59

Query: 80  YCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRG 139
            CLEDG + K LKRHL+T + MTP +YR KW L  DYPMV+ EYA  R+ LA++ GLGR 
Sbjct: 60  VCLEDGKKLKMLKRHLQTRYGMTPTQYREKWQLPMDYPMVAPEYAKMRATLARDAGLGRK 119


>gi|114328465|ref|YP_745622.1| transcriptional regulatory protein mucR [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316639|gb|ABI62699.1| transcriptional regulatory protein mucR [Granulibacter bethesdensis
           CGDNIH1]
          Length = 170

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 44/150 (29%), Positives = 81/150 (54%), Gaps = 6/150 (4%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSN--HVVPMADIGSLITDVHSALQRVVSR--APCQDNV 59
           D +   +   +E+  ++  A++ N    +    + + +  +HSA+ ++         D V
Sbjct: 3   DETITDAAHAVELATELTIAWLGNPNTRIDAEQVPAFLGSMHSAILKLAGGSETAAADAV 62

Query: 60  QPERLKPAVPIRKSI-ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
                 PAV +RKS+     +  + DG  +K+L+RHL T + +TP++YR ++NL +DYPM
Sbjct: 63  DTTEYTPAVSVRKSLASKDHIISMIDGKPYKTLRRHLAT-NGLTPEQYRERYNLKADYPM 121

Query: 119 VSREYATTRSKLAKNMGLGRGRKKRVLTSK 148
           VS  Y+ +R  +AK +GLGR    +V ++ 
Sbjct: 122 VSETYSESRRVMAKKIGLGRKPGTKVASAA 151


>gi|77919911|ref|YP_357726.1| transcriptional regulator [Pelobacter carbinolicus DSM 2380]
 gi|77545994|gb|ABA89556.1| transcriptional regulator, MucR family [Pelobacter carbinolicus DSM
           2380]
          Length = 147

 Score =  146 bits (369), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 67/132 (50%), Gaps = 2/132 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER--LKPA 67
               LEM  +IVA++ S   +   ++ + + D+H AL  + S    +   + E     P 
Sbjct: 1   MANLLEMAAEIVASHASTTPMSKEELIAELNDLHQALSAIESGTALEGGAEQEETSQAPV 60

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
           V  +K+     + C+  G   K+L RHLKT H MT  EYR ++++    P+ +R Y+ +R
Sbjct: 61  VSRKKAFGKDKVVCMICGKPMKTLARHLKTAHGMTASEYRKQFDIPRTQPLAARAYSESR 120

Query: 128 SKLAKNMGLGRG 139
            ++A + GLG  
Sbjct: 121 RQMAIDRGLGEN 132


>gi|218531757|ref|YP_002422573.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218524060|gb|ACK84645.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 154

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 44/137 (32%), Positives = 73/137 (53%), Gaps = 2/137 (1%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S  ++   +++T+ + +AY  NH +   D+  LI   +SAL  + +        + +RL 
Sbjct: 7   SSAATAEPVDLTIIVASAYGRNHTLAATDLPGLIQGTYSALAVLKAEPEAHAVPKVQRLT 66

Query: 66  PAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYAT 125
               IR+ I    L    DG  +  LKRHL+  H + PD YR ++ L +DYPMV+  Y+ 
Sbjct: 67  -VGQIRRPITTEGLTFFVDGKPYMMLKRHLR-RHGLDPDSYRARYGLPADYPMVAPSYSE 124

Query: 126 TRSKLAKNMGLGRGRKK 142
            RS++A++ GL   R+K
Sbjct: 125 RRSEIARSFGLPHRRRK 141


>gi|78355393|ref|YP_386842.1| MucR family transcriptional regulator [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|78217798|gb|ABB37147.1| transcriptional regulator, MucR family [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 130

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 37/135 (27%), Positives = 66/135 (48%), Gaps = 6/135 (4%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  ++IV A  S   +   +I +++  +   ++ +   +   ++   +    AV 
Sbjct: 1   MEAYLKEALEIVKAQASVRTMTEEEITTMVKTLAEGIKNISECSVTAEDAAVD----AVD 56

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+I+   + C+E G  FK L K+HL T H +TPDEYR K       P+V +     R 
Sbjct: 57  AKKAIKEKTITCVECGKSFKILTKKHLAT-HGLTPDEYRAKCGYKKGTPLVCKSLQRERR 115

Query: 129 KLAKNMGLGRGRKKR 143
           K  K+M L   R ++
Sbjct: 116 KKMKDMKLWERRTQK 130


>gi|239905785|ref|YP_002952524.1| hypothetical protein DMR_11470 [Desulfovibrio magneticus RS-1]
 gi|239795649|dbj|BAH74638.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 145

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 34/145 (23%), Positives = 64/145 (44%), Gaps = 4/145 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M      ++ E  ++  ++IV A  S   +   +I S++  + + +  +      QD+  
Sbjct: 5   MPISLQGETMEDHVKSALEIVKAQASVRSMTDEEISSMVRRLAAGILEISLGLCPQDDED 64

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
              ++P    +K+++   + CLE G  FK + R     H +TP+EY+ K       P+V 
Sbjct: 65  AVEMEP----KKAVKEKSITCLECGKSFKVITRKHLATHGLTPEEYKAKHGYKKTMPLVC 120

Query: 121 REYATTRSKLAKNMGLGRGRKKRVL 145
           +     R K  K+M L   + K V 
Sbjct: 121 KGLQRERRKKMKDMRLWEKKVKTVA 145


>gi|220904570|ref|YP_002479882.1| MucR family transcriptional regulator [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219868869|gb|ACL49204.1| transcriptional regulator, MucR family [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 132

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/134 (31%), Positives = 64/134 (47%), Gaps = 5/134 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + +L+  ++I  A     V+   +I + I  V   ++ V   A  +   + +  + A  
Sbjct: 1   MDDYLKEALEITRAQAGVRVMSEEEIATFIQKVALGIRAV---AEGEAPSEMDSAEMAQE 57

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            RKS++   + CLE G  FK L KRHL   H+MT  EYR KW    D P+V +     R 
Sbjct: 58  GRKSVKEKSVTCLECGKSFKILTKRHL-AGHDMTTAEYREKWGFKKDAPLVCKALQRERR 116

Query: 129 KLAKNMGLGRGRKK 142
           K  K+M L   R+K
Sbjct: 117 KKMKDMKLWEKRRK 130


>gi|114765235|ref|ZP_01444367.1| putative mucR family transcriptional regulatory protein [Pelagibaca
           bermudensis HTCC2601]
 gi|114542370|gb|EAU45398.1| putative mucR family transcriptional regulatory protein
           [Roseovarius sp. HTCC2601]
          Length = 142

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 42/124 (33%), Positives = 62/124 (50%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSI 74
           E    IVAAY S   V   +I +L   +   L  V +            ++PA+P+ +++
Sbjct: 9   EQVSRIVAAYASRPDVTPDEIVALYRRLSGELDDVPAEVAPARAPARAGMQPALPLEQAV 68

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
               +YCL  G  FK LKRHL   H MT  EYR  + L  D+P+V+  Y+  ++  AK  
Sbjct: 69  TEDKVYCLCCGRGFKMLKRHLGAEHGMTEAEYRTAFGLPEDFPLVAPSYSRKKAAHAKEA 128

Query: 135 GLGR 138
           GLG+
Sbjct: 129 GLGK 132


>gi|117926885|ref|YP_867502.1| MucR family transcriptional regulator [Magnetococcus sp. MC-1]
 gi|117610641|gb|ABK46096.1| transcriptional regulator, MucR family [Magnetococcus sp. MC-1]
          Length = 159

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 48/154 (31%), Positives = 72/154 (46%), Gaps = 21/154 (13%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRA----PCQDNVQPE--- 62
           S   ++ T  IV A+V N+ +   +I   I +VH++L  +   A         V P+   
Sbjct: 2   SSDMVQKTAQIVEAFVRNNSITAREIPQFIKEVHASLTGLSQPADPPLAAPSVVAPKVEL 61

Query: 63  --------------RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRI 108
                         +  PAV I  SI +  + CL  G   K+LK HL   H++  DEYR 
Sbjct: 62  APVLVANEVGQPSGKPTPAVAIADSISDAFVTCLICGKPCKTLKGHLTRSHHLELDEYRA 121

Query: 109 KWNLASDYPMVSREYATTRSKLAKNMGLGRGRKK 142
            ++L + YP+VS +Y+  R KLA + GLG    K
Sbjct: 122 MFDLPTSYPVVSPDYSAKRRKLAIDSGLGDKLHK 155


>gi|170750265|ref|YP_001756525.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656787|gb|ACB25842.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 146

 Score =  145 bits (367), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 47/137 (34%), Positives = 73/137 (53%), Gaps = 5/137 (3%)

Query: 3   DDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE 62
           D  +   S   LE    IVAAYVS + + +  + +LI  VH+A+  +         V   
Sbjct: 13  DHLTDHRSTFMLEKVGAIVAAYVSRNAIEVTALPALIDQVHAAIAVLRRAPSDFGGVGLS 72

Query: 63  RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE 122
           + +    +  SI++  L    DG  +++LKRHL T H +TP+ YR K+ L +DYPMV+  
Sbjct: 73  QPQ----VEASIQDTGLISFIDGRSYQTLKRHL-TAHGLTPERYRAKYGLPADYPMVAPG 127

Query: 123 YATTRSKLAKNMGLGRG 139
           YA  RS++A+ + LG  
Sbjct: 128 YAARRSEIARAIQLGHK 144


>gi|283852310|ref|ZP_06369581.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
 gi|283572267|gb|EFC20256.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
          Length = 132

 Score =  145 bits (367), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 62/133 (46%), Gaps = 2/133 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + +L + +DIV A      +   +I  +++ + ++++ + S AP     +      ++ 
Sbjct: 1   MDTYLSLALDIVKAQAKTRNMTEEEITGMVSKLATSIRTIDSGAPAAPGGEGPAG--SLD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K+++   + C+E G  FK L R       +TP++YR KW+     P+V +     R K
Sbjct: 59  AKKAVKERSITCMESGKAFKILTRRHLAKFGLTPEQYREKWSYPKGMPLVCKSLQRERRK 118

Query: 130 LAKNMGLGRGRKK 142
             + M L   R K
Sbjct: 119 KMREMKLWERRGK 131


>gi|303248757|ref|ZP_07335009.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
 gi|302489844|gb|EFL49773.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
          Length = 132

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 63/136 (46%), Gaps = 4/136 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  ++IV A  S   +   +I S++  +   ++ +   AP ++  Q   + P   
Sbjct: 1   MEEYLKSALEIVKAQASVRNMTDEEITSMVRRLAIGIRDISGEAPAEEAQQAVGMDP--- 57

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K+I+   + CLE G  FK + +     H +TP+EY+ K       P+V +     R K
Sbjct: 58  -KKAIKEKSVTCLECGKSFKVITKKHLASHGLTPEEYKAKHGYKKSMPLVCKSLQRDRRK 116

Query: 130 LAKNMGLGRGRKKRVL 145
             K+M L   + K V 
Sbjct: 117 KMKDMRLWEKKGKVVA 132


>gi|189425371|ref|YP_001952548.1| MucR family transcriptional regulator [Geobacter lovleyi SZ]
 gi|189421630|gb|ACD96028.1| transcriptional regulator, MucR family [Geobacter lovleyi SZ]
          Length = 174

 Score =  143 bits (362), Expect = 6e-33,   Method: Composition-based stats.
 Identities = 40/141 (28%), Positives = 71/141 (50%), Gaps = 1/141 (0%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S   +E+T +IV+++ +   +   ++   I  V++AL+ + S    ++    +   PA+ 
Sbjct: 2   SSILVELTANIVSSHAATVEMSSDELLQEIQKVYAALKNLDSDNVIEEGTVAKEAAPAIS 61

Query: 70  IRKSIENGCLYCLEDGM-QFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +KSI+   + CL  G   FK+L RHLK  H +   EYR ++ +AS  P+ ++ Y+  R 
Sbjct: 62  PKKSIQKDQIICLICGKGGFKTLSRHLKQAHGLKASEYRKQFGIASGTPLAAKNYSEARR 121

Query: 129 KLAKNMGLGRGRKKRVLTSKV 149
           + A N  LG    K   T   
Sbjct: 122 QSAINNNLGEKLAKGRATRMA 142


>gi|332701481|ref|ZP_08421569.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332551630|gb|EGJ48674.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 140

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 57/134 (42%), Gaps = 3/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            +  ++  ++IV A  S   +   +I S++  + S+L  V   A    N   ++ +PA  
Sbjct: 1   MDDMIKQVLEIVKAQASVRQMTEEEIVSMVKKLASSLGGV---AEVAGNGTTQQQEPACD 57

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +KSI  G + CLE G  FK +       H +  + Y  KW L     +  +     R K
Sbjct: 58  TKKSIREGTVICLECGKSFKVITNKHLAEHGLDKESYLAKWGLPKGTALACKRLVRERRK 117

Query: 130 LAKNMGLGRGRKKR 143
             K+M L   R  +
Sbjct: 118 TMKDMKLWERRGSK 131


>gi|117925579|ref|YP_866196.1| MucR family transcriptional regulator [Magnetococcus sp. MC-1]
 gi|117609335|gb|ABK44790.1| transcriptional regulator, MucR family [Magnetococcus sp. MC-1]
          Length = 164

 Score =  143 bits (361), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 41/160 (25%), Positives = 72/160 (45%), Gaps = 26/160 (16%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPE------- 62
           S   ++ T  I+ +YVSN+ +    +  LI +V ++L+ +  +    D            
Sbjct: 2   SRDLIQTTAGIIQSYVSNNPIEAEQLTGLIGEVFNSLEELSQKGSLGDIDAATAEDLDRW 61

Query: 63  -------------RLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIK 109
                        +L+PAV + ++++   + CL  G   K+LK HL   H +   +YR  
Sbjct: 62  VDGLNKKERTGLTKLQPAVAVDQAVQEDSVTCLICGKTCKALKGHLTRTHKLDVADYRAM 121

Query: 110 WNLASDYPMVSREYATTRSKLAKNMGLGRG------RKKR 143
           +NL  D+PM +  Y+  R  LA+ +GL         RKK+
Sbjct: 122 FNLPKDFPMTAPNYSARRRVLAEEVGLSEKLQASRERKKK 161


>gi|170749787|ref|YP_001756047.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170656309|gb|ACB25364.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 135

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 41/134 (30%), Positives = 70/134 (52%), Gaps = 6/134 (4%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +E+   I++AYV+ + VP   +  L+++VH ++  +   A  Q     E       I+ S
Sbjct: 8   VELAAKILSAYVTRNSVPAGTLPDLLSEVHRSITALDQPAEPQVRRPTEAQ-----IKAS 62

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    L   EDG  +K+L+RHL T   +TP+ Y+ KW L  DYP+VS  Y+  RS +++ 
Sbjct: 63  IRPDTLISFEDGKPYKALRRHL-TMRGLTPEAYKAKWGLPVDYPLVSAAYSARRSTISRQ 121

Query: 134 MGLGRGRKKRVLTS 147
           +G  +  + +    
Sbjct: 122 IGQDQRLRMQQAAE 135


>gi|148264291|ref|YP_001230997.1| MucR family transcriptional regulator [Geobacter uraniireducens
           Rf4]
 gi|146397791|gb|ABQ26424.1| transcriptional regulator, MucR family [Geobacter uraniireducens
           Rf4]
          Length = 189

 Score =  143 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 71/134 (52%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +   LE+T +IV+++ S   +   ++   +  V+SALQ++ +  P +   Q E   PA+ 
Sbjct: 2   ASTLLELTANIVSSHASVSEMSGEELLQELQKVYSALQKLET-VPVETGEQAEVKTPAIS 60

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++K+ +   + C+  G    K+L RHL   HNM P  YR ++ + S   + ++ ++  R 
Sbjct: 61  LKKAFQPDQVSCMICGKTGMKTLARHLAQVHNMKPGAYRKQFGIPSTQALTAKNFSEARR 120

Query: 129 KLAKNMGLGRGRKK 142
           K+A++ GL     K
Sbjct: 121 KMAQDRGLADNLAK 134


>gi|95930105|ref|ZP_01312844.1| transcriptional regulator, MucR family [Desulfuromonas acetoxidans
           DSM 684]
 gi|95133799|gb|EAT15459.1| transcriptional regulator, MucR family [Desulfuromonas acetoxidans
           DSM 684]
          Length = 139

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 39/139 (28%), Positives = 74/139 (53%), Gaps = 1/139 (0%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
             + LEM V+IV+A+ S   +   D+ + + ++H+AL+ + +     +  Q +  +PAV 
Sbjct: 1   MSKLLEMAVEIVSAHASTTTMSKEDLVAELAEIHTALKAMENGEQVAEQ-QDQEQQPAVS 59

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
           ++K+     +YC+  G    +L RHL+  H +TP EYR ++++    P+ ++ Y+  R K
Sbjct: 60  MKKAFGKDKVYCMICGKGMTTLGRHLRMVHGITPAEYRKQFDIPRTQPLAAKAYSEQRKK 119

Query: 130 LAKNMGLGRGRKKRVLTSK 148
           +A   GLG    +     K
Sbjct: 120 MAIERGLGEKLAQARAAKK 138


>gi|294023729|ref|YP_003547048.1| MucR-family transcriptional regulator [Sphingobium japonicum UT26S]
 gi|292677509|dbj|BAI99025.1| MucR-family transcriptional regulator [Sphingobium japonicum UT26S]
          Length = 294

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 71/136 (52%), Gaps = 6/136 (4%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           S         +TV +++AYVSN+ V  +++  LI    +AL    S     D        
Sbjct: 2   SEAEKPDLTSLTVQLLSAYVSNNTVESSELAGLIQSTRAAL----SEDKAPDAPAAPEFV 57

Query: 66  PAVPIRKSI-ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           PA   RKS+     +  + DG  +K+LKRHL T + +TP EYR ++ L  DYPMV+  Y+
Sbjct: 58  PATTARKSLASRDHIISMIDGKPYKTLKRHLAT-NGLTPSEYRERYGLPRDYPMVAPGYS 116

Query: 125 TTRSKLAKNMGLGRGR 140
             R ++A+ +GLGR  
Sbjct: 117 EQRREVAQRLGLGRKP 132


>gi|323697662|ref|ZP_08109574.1| transcriptional regulator, MucR family [Desulfovibrio sp. ND132]
 gi|323457594|gb|EGB13459.1| transcriptional regulator, MucR family [Desulfovibrio desulfuricans
           ND132]
          Length = 130

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 35/134 (26%), Positives = 59/134 (44%), Gaps = 7/134 (5%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  ++IV A  S   +   +I S++  + + ++ +         +        + 
Sbjct: 1   MEDYLQEALEIVKAQASVRTMTEEEITSMVQKLAAGIKAIAEGEAVDSAMPA-----TID 55

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+I    + C   G  FK L K+HL T H MTP+EYR ++      P+V +     R 
Sbjct: 56  PQKAIREKSILCCACGKSFKVLTKKHLAT-HGMTPEEYREQYGYKKKLPLVCKSLQRERR 114

Query: 129 KLAKNMGLGRGRKK 142
           K  K M L   R K
Sbjct: 115 KKMKEMQLWTKRGK 128


>gi|254418228|ref|ZP_05031952.1| ROS/MUCR transcriptional regulator protein [Brevundimonas sp. BAL3]
 gi|196184405|gb|EDX79381.1| ROS/MUCR transcriptional regulator protein [Brevundimonas sp. BAL3]
          Length = 848

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 45/98 (45%), Positives = 59/98 (60%)

Query: 40  TDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHH 99
             V      +        +       PAVPIRKSI+   L CLEDG +FKSLKRHL+T +
Sbjct: 747 RVVFGGGDAMPLATDIDPSAVSAPDNPAVPIRKSIQPDYLVCLEDGRRFKSLKRHLRTRY 806

Query: 100 NMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLG 137
           N++P+EY ++W L SDYPM +  YA  R++LA  MGLG
Sbjct: 807 NLSPEEYIVRWGLPSDYPMQAPNYARARAELAAQMGLG 844


>gi|283851225|ref|ZP_06368508.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
 gi|283573394|gb|EFC21371.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
          Length = 137

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 4/139 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  ++IV A  S   +   +I S++ +V       +  A   ++V  E   PA+ 
Sbjct: 1   MEEYLKAALEIVKAQASVRTMTDEEITSMLRNV----AAGIQAAAEAESVPAEAAAPAMD 56

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
             K+++   + CLE G  FK L +     H +TP+EYR K+      P+ ++     R K
Sbjct: 57  PSKAVKESSVVCLECGKAFKVLTKKHLGAHGLTPEEYRAKYGYKKGAPLAAKSLQRERRK 116

Query: 130 LAKNMGLGRGRKKRVLTSK 148
             K+M L   R+K V  + 
Sbjct: 117 KMKDMRLWERRRKPVAAAA 135


>gi|46581487|ref|YP_012295.1| transcriptional regulator [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120601345|ref|YP_965745.1| MucR family transcriptional regulator [Desulfovibrio vulgaris DP4]
 gi|46450909|gb|AAS97555.1| transcriptional regulator, putative [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120561574|gb|ABM27318.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris DP4]
 gi|311235136|gb|ADP87990.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris
           RCH1]
          Length = 128

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 61/132 (46%), Gaps = 6/132 (4%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            +  L+  + IV A  S   +   D+ +++  +   ++ + +        + E  + A+ 
Sbjct: 1   MDDLLKEALGIVKAQASVRTMTEDDMLAMVHRLAEGIRNISAGI----TPEAEDEQVAID 56

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            RK+I+   + C+E G  FK + K+HL T H +TP+ YR K       P+V +     R 
Sbjct: 57  PRKAIKEKSITCVECGKVFKLISKKHLAT-HGLTPETYREKCGYKKGTPLVCKGLQRERR 115

Query: 129 KLAKNMGLGRGR 140
           K  K+M L   R
Sbjct: 116 KKMKDMKLWERR 127


>gi|118580904|ref|YP_902154.1| MucR family transcriptional regulator [Pelobacter propionicus DSM
           2379]
 gi|118503614|gb|ABL00097.1| transcriptional regulator, MucR family [Pelobacter propionicus DSM
           2379]
          Length = 167

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 72/134 (53%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +   +E+T +IV+A+ S   +   ++   I  V +AL+++ S  P  + V+     PA+ 
Sbjct: 2   TTSLVELTANIVSAHASGSQLSRDELIQEINTVFTALKQLESGTPATE-VETAPAAPAMS 60

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++K+ +N  + C+  G   FK+L RHLK  HN+ P +YR ++N+ S   + ++ Y+  R 
Sbjct: 61  LKKAFQNDQVSCMICGKSGFKTLTRHLKQAHNLKPGQYRKQFNIPSTQSLTAKNYSEARR 120

Query: 129 KLAKNMGLGRGRKK 142
           + A    L    +K
Sbjct: 121 QAATENNLAANLEK 134


>gi|323700555|ref|ZP_08112467.1| transcriptional regulator, MucR family [Desulfovibrio sp. ND132]
 gi|323460487|gb|EGB16352.1| transcriptional regulator, MucR family [Desulfovibrio desulfuricans
           ND132]
          Length = 143

 Score =  139 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 7/129 (5%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIR 71
             +E  + IV A      +   +   ++ ++   L+ + +         P R +P V  +
Sbjct: 2   DHVEKAMRIVEAQAGVRPMTADEACQMVKNLSDGLRELANG-----EAAPTRQEPPVDPK 56

Query: 72  KSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           ++I N  + CLE G  FK+L KRHL++ H +TPDEYR KW      P+  RE A  RS+ 
Sbjct: 57  RAIRNKSIVCLECGRTFKTLSKRHLES-HGLTPDEYRAKWGYKKRTPLSCRETAKARSER 115

Query: 131 AKNMGLGRG 139
            K M L   
Sbjct: 116 MKEMKLWTR 124


>gi|283852807|ref|ZP_06370070.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
 gi|283571799|gb|EFC19796.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
          Length = 132

 Score =  139 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 32/136 (23%), Positives = 58/136 (42%), Gaps = 4/136 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  ++IV A  S   +   +I S+I  +   ++ +    P             + 
Sbjct: 1   MEDYLKSALEIVRAQASVRHMTDEEITSMIRRLAVGIRDISGEVPAG----VAEQTMDMD 56

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K+I+   + C+E G  FK + +     H +TP+EY+ K       P+V +     R K
Sbjct: 57  AKKAIKEKSVTCMECGKSFKVITKKHLASHGLTPEEYKAKHGYKKSMPLVCKSLQRDRRK 116

Query: 130 LAKNMGLGRGRKKRVL 145
             K+M L   + K V 
Sbjct: 117 KMKDMRLWEKKGKVVA 132


>gi|303247568|ref|ZP_07333839.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
 gi|302491048|gb|EFL50942.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
          Length = 136

 Score =  139 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 36/137 (26%), Positives = 62/137 (45%), Gaps = 4/137 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  ++IV A  S   +   +I S++ +V       +  A   +    E + PA+ 
Sbjct: 1   MEDYLKAALEIVKAQASVRTMTDDEITSMLKNV----AAGIQAAAEAETAPAEAVTPAID 56

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
             K+++   + CLE G  FK L +     H +TP+EYR K+      P+ ++     R K
Sbjct: 57  PAKAVKESSVVCLECGKSFKVLTKKHLAAHGLTPEEYRAKYGYKKGAPLAAKSLQRERRK 116

Query: 130 LAKNMGLGRGRKKRVLT 146
             K+M L   R+K    
Sbjct: 117 KMKDMRLWERRRKPAAA 133


>gi|170745331|ref|YP_001766788.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170658932|gb|ACB27986.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 159

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 46/135 (34%), Positives = 69/135 (51%), Gaps = 5/135 (3%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
                     +E+  DIV AYV+++ V   ++  +I  +H+A    +++     + QP  
Sbjct: 2   KTDDPRPRPIIELVTDIVVAYVASNSVRAGEVTRMIGAIHAA----LAKCGAAADPQPGP 57

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
                 I +SI +  L   EDG  +KSL+RHL     ++PD YR KW L  DYPM +  Y
Sbjct: 58  RLTKAEIARSITHEALISFEDGRPYKSLRRHLG-KRGLSPDTYREKWGLPPDYPMTAPGY 116

Query: 124 ATTRSKLAKNMGLGR 138
           +  RS LA+  GLGR
Sbjct: 117 SEFRSALARKHGLGR 131


>gi|303328482|ref|ZP_07358919.1| putative transcriptional regulator [Desulfovibrio sp. 3_1_syn3]
 gi|302861476|gb|EFL84413.1| putative transcriptional regulator [Desulfovibrio sp. 3_1_syn3]
          Length = 134

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 39/134 (29%), Positives = 63/134 (47%), Gaps = 5/134 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + +L+  ++I  A  S  V+   +I + +  V   ++ V   A  +  V+    +  + 
Sbjct: 1   MDDYLKEALEIAKAQASVRVMKEEEITAFVQKVTQGIRVV---AETEQPVEMSTEEMVLE 57

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            RKS++   + CLE G  FK L KRHL T H ++ DEYR KW       +V +     R 
Sbjct: 58  GRKSVKEKSVTCLECGKNFKVLTKRHLAT-HGISTDEYREKWGFKKGSALVCKALQRERR 116

Query: 129 KLAKNMGLGRGRKK 142
           K   +M L   R+K
Sbjct: 117 KKMNDMKLWERRRK 130


>gi|303248174|ref|ZP_07334438.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
 gi|302490438|gb|EFL50347.1| transcriptional regulator, MucR family [Desulfovibrio
           fructosovorans JJ]
          Length = 132

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 31/132 (23%), Positives = 61/132 (46%), Gaps = 4/132 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + +L + +DIV A      +   +I ++++ +  +++ +   +     +       A+ 
Sbjct: 1   MDTYLSLALDIVKAQARVRNMTEEEITAMMSKLAGSIKSIDLASGGARELA--SGDTALD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+++   + C+E G  +K L KRHL     +TP+EYR KW      P+V +     R 
Sbjct: 59  PKKAVKERTITCMESGKPYKILTKRHL-AKFGLTPEEYRAKWGYPKGMPLVCKALQRERR 117

Query: 129 KLAKNMGLGRGR 140
           K  + M L   R
Sbjct: 118 KKMREMQLWTRR 129


>gi|170752182|ref|YP_001783327.1| MucR family transcriptional regulator [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659309|gb|ACB28359.1| transcriptional regulator, MucR family [Methylobacterium
           radiotolerans JCM 2831]
          Length = 151

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 72/136 (52%), Gaps = 3/136 (2%)

Query: 4   DASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPER 63
           + S + S  +  MT +++AAYVS++ VP +D+ +LI    +A   +   +        +R
Sbjct: 6   NISSNFSLNYSRMTANLIAAYVSHNRVPASDLPALIAAAGAAFTGLQLASLA--TGPKDR 63

Query: 64  LKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
                 I+ SI    L   EDG  ++++KRHL T   +TP+ YR KW L  DYPM +  Y
Sbjct: 64  KVTQAQIQASITYEALISFEDGKPYQTIKRHLTTR-GLTPETYRAKWGLPPDYPMFAPAY 122

Query: 124 ATTRSKLAKNMGLGRG 139
              RSK+AK + L R 
Sbjct: 123 GVKRSKIAKRLALRRN 138


>gi|258406651|ref|YP_003199392.1| transcriptional regulator, MucR family [Desulfohalobium retbaense
           DSM 5692]
 gi|257798878|gb|ACV69814.1| transcriptional regulator, MucR family [Desulfohalobium retbaense
           DSM 5692]
          Length = 134

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 39/135 (28%), Positives = 66/135 (48%), Gaps = 4/135 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E  ++  ++IV A      +   ++ S++ ++ S L+R+          Q +    AV 
Sbjct: 1   MEDHMKQALEIVKAQAGVRTMTEEEMTSMVANIASKLKRIEGGEQEPQEEQKQEP--AVD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+I    + CLE G  FK L KRHL T H +TP EY+ KW       ++++  A  R 
Sbjct: 59  PKKAIREKSVVCLECGKTFKVLTKRHLAT-HGLTPAEYKAKWGFKKTQSLIAKSLARERK 117

Query: 129 KLAKNMGLGRGRKKR 143
           K  + M L + R+K+
Sbjct: 118 KKMQEMQLWKRREKK 132


>gi|239905505|ref|YP_002952244.1| ROSMUCR family transcriptional regulator [Desulfovibrio magneticus
           RS-1]
 gi|239795369|dbj|BAH74358.1| ROSMUCR family transcriptional regulator [Desulfovibrio magneticus
           RS-1]
          Length = 132

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 36/135 (26%), Positives = 62/135 (45%), Gaps = 4/135 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  ++IV A  S   +   +I S++ +V       +  A   +    +   PA+ 
Sbjct: 1   MEEYLKAALEIVKAQASVRTMTDDEITSMLRNV----AAGIQAAAEAEAAPTDAPTPAMD 56

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
             K+++   + CLE G  FK L +     HN+TP+EYR K+      P+ ++     R K
Sbjct: 57  PSKAVKESSVVCLECGKSFKVLTKKHLAAHNLTPEEYRAKYGYKKGAPLAAKSLQRERRK 116

Query: 130 LAKNMGLGRGRKKRV 144
             K+M L   R+K  
Sbjct: 117 KMKDMRLWERRRKVA 131


>gi|118577407|ref|YP_899647.1| MucR family transcriptional regulator [Pelobacter propionicus DSM
           2379]
 gi|118504912|gb|ABL01394.1| transcriptional regulator [Pelobacter propionicus DSM 2379]
          Length = 148

 Score =  138 bits (347), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 71/135 (52%), Gaps = 2/135 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAP-CQDNVQPERLKPAV 68
           ++  +E+T  IV+A+ S   +   D+   I  V+S+L+ +    P   +  +P    PA+
Sbjct: 2   TQSLVELTASIVSAHASGSQMSKEDLLGEINAVYSSLKALEGGTPEALEASEPASQAPAL 61

Query: 69  PIRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
            IRK+ ++  + C+  G   FK+L RHLK  H++ P +YR ++N++    + ++ Y+  R
Sbjct: 62  TIRKAFKDDQIGCMICGKTGFKTLTRHLKQAHDLKPGQYRKQFNISPTQALTAKNYSEAR 121

Query: 128 SKLAKNMGLGRGRKK 142
              AK   L    +K
Sbjct: 122 RAAAKENNLAANLEK 136


>gi|239908834|ref|YP_002955576.1| hypothetical protein DMR_41990 [Desulfovibrio magneticus RS-1]
 gi|239798701|dbj|BAH77690.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 134

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 60/136 (44%), Gaps = 2/136 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  ++IV A  S   +   +I S++  + + +  +   A  + +   +   PA+ 
Sbjct: 1   MEEYLQSALEIVKAQASARPMTEDEIISMVRSIANGIAAI--NAGQESSKTEDSAAPAMD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K+I+   + CLE G  FK + +     H +TP+EY+ K        +  +  A  R  
Sbjct: 59  PKKAIKEASITCLECGKSFKVITKKHLAVHGLTPEEYKAKHGYKKTQALACKSLARERRA 118

Query: 130 LAKNMGLGRGRKKRVL 145
             K+M L   +  +  
Sbjct: 119 KMKDMKLWERKGNKAE 134


>gi|118592702|ref|ZP_01550092.1| Transcriptional regulator [Stappia aggregata IAM 12614]
 gi|118434753|gb|EAV41404.1| Transcriptional regulator [Stappia aggregata IAM 12614]
          Length = 91

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 42/83 (50%), Positives = 60/83 (72%)

Query: 57  DNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116
           +  + ERL P VPI+KS++   + CLED  +FKSLKRHL+  +N+T +EYR +W L +DY
Sbjct: 3   EEPEAERLIPTVPIKKSVQPDYIVCLEDDKRFKSLKRHLRAAYNLTSEEYRARWGLEADY 62

Query: 117 PMVSREYATTRSKLAKNMGLGRG 139
           PMV+  YA  RS++A+ +GLGR 
Sbjct: 63  PMVAPNYAAARSEIAEELGLGRK 85


>gi|222056089|ref|YP_002538451.1| transcriptional regulator, MucR family [Geobacter sp. FRC-32]
 gi|221565378|gb|ACM21350.1| transcriptional regulator, MucR family [Geobacter sp. FRC-32]
          Length = 180

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 34/128 (26%), Positives = 69/128 (53%), Gaps = 5/128 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +   LE+T  IV+++ S   +   ++ + +  VH+ALQ++ + A  +     E   PA+ 
Sbjct: 2   ASTLLELTASIVSSHASVSEMSSEELLAELQKVHAALQKLEAPAEAES----ESKAPAIS 57

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++K+ +   + C+  G    K+L RHL   H+M P  YR ++ + S   + ++ ++  R 
Sbjct: 58  LKKAFQPDQVSCMICGKTGMKTLARHLAQVHDMKPGAYRKQFGIPSSQALTAKNFSEARR 117

Query: 129 KLAKNMGL 136
           K+A++ GL
Sbjct: 118 KMAQDRGL 125


>gi|332702257|ref|ZP_08422345.1| ROSMUCR transcriptional regulator [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332552406|gb|EGJ49450.1| ROSMUCR transcriptional regulator [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 137

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 58/136 (42%), Gaps = 3/136 (2%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIR 71
            +LE  + IV A      +   ++ S+   +   L+  V   P     Q E  + A+   
Sbjct: 2   EYLEEALKIVKAQAGVRQMTPEEMISMTKKICQGLKEAV---PEGSQAQGEEEECALSPD 58

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           K+I    + CLE G +FK L R   + H ++P EY+ KW       ++++  A  R K  
Sbjct: 59  KAIRERSVQCLECGKKFKVLTRKHLSQHGLSPKEYKAKWGYKKGTSLIAKGLARDRRKKM 118

Query: 132 KNMGLGRGRKKRVLTS 147
             + L   R  R  TS
Sbjct: 119 GELKLWEKRGSRGATS 134


>gi|320354869|ref|YP_004196208.1| MucR family transcriptional regulator [Desulfobulbus propionicus
           DSM 2032]
 gi|320123371|gb|ADW18917.1| transcriptional regulator, MucR family [Desulfobulbus propionicus
           DSM 2032]
          Length = 147

 Score =  136 bits (344), Expect = 7e-31,   Method: Composition-based stats.
 Identities = 38/137 (27%), Positives = 70/137 (51%), Gaps = 2/137 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S+  +EMT +I+ + +S+  +   +I + + D    L+ +          +PE + PA+ 
Sbjct: 2   SKSLVEMTAEIIQSQISSKQMSTEEIKAALNDTFQTLKALQESESVGIEAEPEEINPAID 61

Query: 70  IRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +KSI+   + CLE G +FK L  +HLK+ H +   EYR K   ++  P+ ++  +  RS
Sbjct: 62  PKKSIQKNKIICLECGQEFKMLSPKHLKS-HGLNSKEYRKKHGFSARQPLCAKALSEKRS 120

Query: 129 KLAKNMGLGRGRKKRVL 145
           +  K  GL    +K + 
Sbjct: 121 QSGKERGLPDNLRKAIE 137


>gi|253700631|ref|YP_003021820.1| MucR family transcriptional regulator [Geobacter sp. M21]
 gi|251775481|gb|ACT18062.1| transcriptional regulator, MucR family [Geobacter sp. M21]
          Length = 173

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 69/134 (51%), Gaps = 4/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
               +E+   IVA++ S+  +    +   I  VH+AL+ + +  P + +   E  K ++ 
Sbjct: 1   MATLVEIAAQIVASHASSTPMTSDQLIFEIGKVHTALKNLEAGEPVEGS---EETKTSLT 57

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++++   G + C+  G   FK+L RHL T H M P EY+ ++++    P+ ++ Y+  R 
Sbjct: 58  VKEAFRKGEVVCMICGKGGFKTLARHLNTAHGMKPGEYKKQFSIPGKQPLAAKNYSDARR 117

Query: 129 KLAKNMGLGRGRKK 142
           K+A + GL     K
Sbjct: 118 KMALDRGLADNLAK 131


>gi|322420557|ref|YP_004199780.1| MucR family transcriptional regulator [Geobacter sp. M18]
 gi|320126944|gb|ADW14504.1| transcriptional regulator, MucR family [Geobacter sp. M18]
          Length = 168

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 67/128 (52%), Gaps = 2/128 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +   LE+T  IV+++ S   +   D+   +  VH ALQ++      +   + E  +PAVP
Sbjct: 2   ASSLLELTASIVSSHASVTEMSGEDLLLELQKVHGALQKLEVET-GEVVERDEAKEPAVP 60

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++K+ +   + C+  G    K+L RHL   H + P EYR ++ + S   + ++ ++  R 
Sbjct: 61  LKKAFQPDQVSCMLCGKSGMKTLTRHLAQVHGIKPGEYRKQFGIPSSQALTAKNFSEARR 120

Query: 129 KLAKNMGL 136
           ++A+  GL
Sbjct: 121 RMAQEKGL 128


>gi|298530753|ref|ZP_07018155.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510127|gb|EFI34031.1| transcriptional regulator, MucR family [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 132

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 32/135 (23%), Positives = 60/135 (44%), Gaps = 3/135 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +L+  ++IV A  S   +   ++ ++I  +   ++      P   +   +   P V 
Sbjct: 1   MEEYLKEALEIVKAQASVRNMTEEEMSAMILALSRGIRETAREMPGAAS---QSAAPGVD 57

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
             ++I    + CLE G  F+ L +     H MTP+EY+ KW    +  +V+R     R K
Sbjct: 58  PARAIREKSILCLECGKSFRVLTKKHLGKHGMTPEEYKAKWGYKKNTSLVARSLTRNRRK 117

Query: 130 LAKNMGLGRGRKKRV 144
             + M L + R+ + 
Sbjct: 118 RMQEMQLWKKRQAQA 132


>gi|239909130|ref|YP_002955872.1| hypothetical protein DMR_44950 [Desulfovibrio magneticus RS-1]
 gi|239798997|dbj|BAH77986.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 131

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 59/131 (45%), Gaps = 7/131 (5%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E  L M ++IV A      +   +I +++  + + ++ +   A     + P+       
Sbjct: 1   MEDHLAMAIEIVKAQAKVRNMKEDEIRAMVASLSATIRDMDLAAATGAGMPPDA------ 54

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +++I+   + CLE G  FK L R     + +TPDEYR KW  A D P+V +     R K
Sbjct: 55  -KRAIKERTITCLESGKPFKILTRKHLAKYGLTPDEYRAKWGYARDMPLVCKALQRERRK 113

Query: 130 LAKNMGLGRGR 140
             + + L   R
Sbjct: 114 KMRELRLWERR 124


>gi|253701019|ref|YP_003022208.1| MucR family transcriptional regulator [Geobacter sp. M21]
 gi|251775869|gb|ACT18450.1| transcriptional regulator, MucR family [Geobacter sp. M21]
          Length = 177

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
               +E+   +V+A+ S+  +   ++ + I  VH+AL+++ +    +        KPA+ 
Sbjct: 1   MATLVEIAAQLVSAHASSTPMTSDELLADIAKVHAALKKLDTGGTLETEGD---AKPALT 57

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++ +I+   + CL  G   FK+L RHL T H+M P  YR ++ + S   +V++ Y+  R 
Sbjct: 58  VKNAIKKNEVVCLVCGKGGFKTLARHLTTVHDMKPGVYRKQFGIPSKQSLVAKSYSEARR 117

Query: 129 KLAKNMGLGRGRKK 142
           K+A + GL     K
Sbjct: 118 KMANDRGLADNLAK 131


>gi|239904743|ref|YP_002951481.1| hypothetical protein DMR_01040 [Desulfovibrio magneticus RS-1]
 gi|239794606|dbj|BAH73595.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 135

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 35/134 (26%), Positives = 61/134 (45%), Gaps = 4/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            + +L+  ++IV A  S   +   +I S++  V + +  V S        +       + 
Sbjct: 1   MDDYLQSALEIVKAQASARPMTEDEIISMVRSVANGIAAVSSGQLVASEAESAAPA--MD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +K+I+   + CLE G  FK + K+HL T H +T +EY+ K+      P+  +  A  R 
Sbjct: 59  PKKAIKEASITCLECGKSFKVITKKHLAT-HGLTTEEYKAKYGYKKTQPLACKSLARDRR 117

Query: 129 KLAKNMGLGRGRKK 142
              K+M L   R K
Sbjct: 118 NKMKDMKLWERRTK 131


>gi|322419711|ref|YP_004198934.1| MucR family transcriptional regulator [Geobacter sp. M18]
 gi|320126098|gb|ADW13658.1| transcriptional regulator, MucR family [Geobacter sp. M18]
          Length = 185

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 69/134 (51%), Gaps = 4/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
               +E+   +V+++ S+  +   ++ + I  VH+AL+ + +    +     E  KP++ 
Sbjct: 1   MATLVEIAAQLVSSHASSTPMTSDELLAEIAKVHAALKSLEAGQTVEGA---EEAKPSLS 57

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           I+++ +   + CL  G   FK+L RHL T H M P  Y+ ++ + S   + ++ Y+  R 
Sbjct: 58  IKEAFKKNEVVCLICGKGGFKTLARHLSTAHGMKPGAYKKQFGIPSKQALSAKSYSEARR 117

Query: 129 KLAKNMGLGRGRKK 142
           K+A++ GL     K
Sbjct: 118 KMAQDRGLADNLAK 131


>gi|120601922|ref|YP_966322.1| MucR family transcriptional regulator [Desulfovibrio vulgaris DP4]
 gi|120562151|gb|ABM27895.1| transcriptional regulator, MucR family [Desulfovibrio vulgaris DP4]
          Length = 135

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 37/135 (27%), Positives = 66/135 (48%), Gaps = 3/135 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV- 68
            +  L+  ++IV A      +   ++ S++  + +++Q ++   P +++ + E     V 
Sbjct: 1   MDEALKQALEIVRAQARVRAMTADEMASMVKALAASIQGLMDGGPPEEHCEEEDEDGVVL 60

Query: 69  PIRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
              KSI    + CLE G  F+ L  RHL + H +TPDEYR KW +     ++ +     R
Sbjct: 61  EATKSIRERSVLCLECGKSFRILTTRHLAS-HGLTPDEYRAKWGIKKGGSLICKALQRER 119

Query: 128 SKLAKNMGLGRGRKK 142
            K  K+M L   R+K
Sbjct: 120 RKKMKSMQLWERRRK 134


>gi|239907041|ref|YP_002953782.1| hypothetical protein DMR_24050 [Desulfovibrio magneticus RS-1]
 gi|239796907|dbj|BAH75896.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 133

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 38/134 (28%), Positives = 63/134 (47%), Gaps = 7/134 (5%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV- 68
            E  L+  ++IV A      +  A+I S+I  V   +  V+S        +P+  + AV 
Sbjct: 1   MEDSLKSAIEIVTAQAKTRAMTEAEIVSMIQSVSGGISFVMS-----SQGEPDAQEAAVI 55

Query: 69  -PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTR 127
              + S+++  + CLE G  FK L +     HN+TP+EYR K+      P+V++     R
Sbjct: 56  MNPKDSVKDRSVTCLECGKVFKVLTKKHLVAHNLTPEEYRAKYGFKKGAPLVAKSLQRER 115

Query: 128 SKLAKNMGLGRGRK 141
            K  + M L   +K
Sbjct: 116 RKKMEEMRLWERKK 129


>gi|253699803|ref|YP_003020992.1| MucR family transcriptional regulator [Geobacter sp. M21]
 gi|251774653|gb|ACT17234.1| transcriptional regulator, MucR family [Geobacter sp. M21]
          Length = 169

 Score =  134 bits (337), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 66/128 (51%), Gaps = 2/128 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +   LE+T +IV+++ S   +   D+   +  VH ALQ++   A  +   + +   PA+ 
Sbjct: 2   ASSLLELTANIVSSHASVTEMSGEDLLLELQKVHVALQKLEVEA-GEGAEKADAKGPAIS 60

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++K+ +   + C+  G    K+L RHL   H M P EYR  + + S   + +R ++  R 
Sbjct: 61  LKKAFQPDQISCMLCGKSGMKTLARHLAQVHGMKPGEYRKLFGIPSGQALTARNFSEARR 120

Query: 129 KLAKNMGL 136
           ++A+  GL
Sbjct: 121 RMAQEKGL 128


>gi|197118598|ref|YP_002139025.1| MucR family transcriptional regulator [Geobacter bemidjiensis Bem]
 gi|197087958|gb|ACH39229.1| transcriptional regulator, MucR family [Geobacter bemidjiensis Bem]
          Length = 185

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 69/134 (51%), Gaps = 4/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
               +E+   IVA++ S+  +    +   I  VH+AL+ + +  P + +   E  K ++ 
Sbjct: 1   MATLVEIAAQIVASHASSTPMTSDQLIFEIGKVHTALKNLEAGEPVEGS---EETKTSLT 57

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++++   G + C+  G   FK+L RHL T H M P EY+ ++++    P+ ++ Y+  R 
Sbjct: 58  VKEAFRKGEVVCMICGKGGFKTLARHLNTAHGMKPGEYKKQFSIPGKQPLAAKNYSDARR 117

Query: 129 KLAKNMGLGRGRKK 142
           K+A + GL     K
Sbjct: 118 KMALDRGLADNLAK 131


>gi|322419527|ref|YP_004198750.1| MucR family transcriptional regulator [Geobacter sp. M18]
 gi|320125914|gb|ADW13474.1| transcriptional regulator, MucR family [Geobacter sp. M18]
          Length = 175

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
               +E+   IVA++ S+  +    +   I+ VHSAL+ + +  P +   +P   K ++ 
Sbjct: 1   MATLVEIAAQIVASHASSTPMTSDQLIFEISKVHSALKNLEAGEPVEGVEEP---KTSLT 57

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++++ + G + C+  G   FK+L RHL T H+M P EY+ ++ +    P+ ++ Y+  R 
Sbjct: 58  VKEAFKKGEVVCMLCGKGGFKTLARHLNTAHSMKPGEYKKQFGIPGKQPLAAKNYSEARR 117

Query: 129 KLAKNMGLGRGRKK 142
           K+A + GL     K
Sbjct: 118 KMALDRGLADNLAK 131


>gi|197119459|ref|YP_002139886.1| Ros/MucR family transcriptional regulator [Geobacter bemidjiensis
           Bem]
 gi|197088819|gb|ACH40090.1| transcriptional regulator, Ros/MucR family [Geobacter bemidjiensis
           Bem]
          Length = 169

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 66/128 (51%), Gaps = 2/128 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +   LE+T +IV+++ S   +   D+   +  VH ALQ++   A  +   + +   PA+ 
Sbjct: 2   ASSLLELTANIVSSHASVTEMSGEDLLLELQKVHVALQKLEVEA-GEGAEKADARGPAIS 60

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++K+ +   + C+  G    K+L RHL   H M P EYR  + + S   + +R ++  R 
Sbjct: 61  LKKAFQPDQVSCMLCGKSGMKTLARHLAQVHGMKPGEYRKLFGIPSGQALTARNFSEARR 120

Query: 129 KLAKNMGL 136
           ++A+  GL
Sbjct: 121 RMAQEKGL 128


>gi|218533415|ref|YP_002424230.1| MucR family transcriptional regulator [Methylobacterium
           chloromethanicum CM4]
 gi|218525718|gb|ACK86302.1| transcriptional regulator, MucR family [Methylobacterium
           chloromethanicum CM4]
          Length = 324

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 47/129 (36%), Positives = 66/129 (51%), Gaps = 4/129 (3%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           + MTV I  +Y+S + +   +IG LI  V  AL  +  R     N   ++L     I+ S
Sbjct: 13  VAMTVRIAKSYLSKNRIGPQEIGPLIEQVSLALAHLRRR---PHNASGQQLPTQEEIQAS 69

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I    L   EDG  +  LKRHL T   +TP+ Y  KW L +DYPMV+  Y   R++LAK 
Sbjct: 70  IHERHLISFEDGKSYHMLKRHL-TKLGLTPEAYLAKWGLPADYPMVAPFYTRKRARLAKR 128

Query: 134 MGLGRGRKK 142
             LG   ++
Sbjct: 129 TRLGHYDRE 137



 Score = 97.6 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/71 (42%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
           A  I  SI++  L C EDG  ++ L RHL+    +TPD YR KW L +DYPM+S      
Sbjct: 199 AKEIAASIQDTFLICFEDGEPYRMLSRHLR-LFGLTPDAYRAKWGLPADYPMMSASDLRH 257

Query: 127 RSKLAKNMGLG 137
           R++LA+   L 
Sbjct: 258 RAELARQRKLW 268


>gi|39996961|ref|NP_952912.1| Ros/MucR family transcriptional regulator [Geobacter sulfurreducens
           PCA]
 gi|39983849|gb|AAR35239.1| transcriptional regulator, Ros/MucR family [Geobacter
           sulfurreducens PCA]
          Length = 167

 Score =  133 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 69/131 (52%), Gaps = 1/131 (0%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +   LE+T  IV+++ +   +   ++   I  VH+ LQ++   A   +    E   PA+ 
Sbjct: 2   APTLLELTASIVSSHAAVSELSTEELVQEIQKVHATLQQLEGGAAAPEVAAEEAKAPAMT 61

Query: 70  IRKSIENGCLYCLEDGM-QFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++K+ +   + C+  G    K+L RHL   H M P EYR ++N+ S  P+ +++++  R 
Sbjct: 62  LKKAFQADQVCCMICGKGGMKTLTRHLAQVHQMKPGEYRKQFNIPSSQPLTAKKFSEARK 121

Query: 129 KLAKNMGLGRG 139
           ++AK+ GL   
Sbjct: 122 QMAKDRGLAEN 132


>gi|83944197|ref|ZP_00956653.1| putative mucR family protein transcriptional regulatory protein
           [Sulfitobacter sp. EE-36]
 gi|83955102|ref|ZP_00963758.1| putative mucR family transcriptional regulatory protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83840431|gb|EAP79604.1| putative mucR family transcriptional regulatory protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83845064|gb|EAP82945.1| putative mucR family protein transcriptional regulatory protein
           [Sulfitobacter sp. EE-36]
          Length = 155

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/139 (29%), Positives = 68/139 (48%), Gaps = 6/139 (4%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQD------NVQPERLKPAV 68
           E  + ++ A+       + DI +L   + +AL  +   A   +          E   PAV
Sbjct: 11  EAAIRVITAFAGRESATVQDILALSQALPAALAGLQPAAAKAEISKVAAQFTTETAIPAV 70

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           P+ +S  +  + CL  G  F  LKRHL+  H ++  EYRIK+NL  D+P+V+  Y+  ++
Sbjct: 71  PVAESFTDDSVTCLCCGRSFTMLKRHLRAEHGLSESEYRIKFNLDDDHPLVAPNYSLRKA 130

Query: 129 KLAKNMGLGRGRKKRVLTS 147
             AK  GLGR  +   + +
Sbjct: 131 DYAKKAGLGRYARDEAVQA 149


>gi|253700837|ref|YP_003022026.1| MucR family transcriptional regulator [Geobacter sp. M21]
 gi|251775687|gb|ACT18268.1| transcriptional regulator, MucR family [Geobacter sp. M21]
          Length = 186

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
               +E+   +V+++ S+  +   ++ + I+ VH+AL+ + +    +     +  KP+V 
Sbjct: 1   MATLVEIAAQLVSSHASSTPMTSDELLAEISKVHAALKSLEAGESIEG---VDETKPSVS 57

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++++     + CL  G   FK+L RHL T H M P  Y+ ++ ++S   + ++ Y+  R 
Sbjct: 58  MKEAFRKNEVVCLVCGKGGFKTLARHLSTAHGMKPGAYKKQFGISSKQALSAKSYSEARR 117

Query: 129 KLAKNMGLGRGRKK 142
           K+A++ GL     K
Sbjct: 118 KMAQDRGLADNLAK 131


>gi|197118385|ref|YP_002138812.1| MucR family transcriptional regulator [Geobacter bemidjiensis Bem]
 gi|197087745|gb|ACH39016.1| transcriptional regulator, MucR family [Geobacter bemidjiensis Bem]
          Length = 186

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
               +E+   +V+++ S+  +   ++ + I+ VH+AL+ + +    +     +  KP+V 
Sbjct: 1   MATLVEIAAQLVSSHASSTPMTSDELLAEISKVHAALKSLEAGESIEG---IDETKPSVS 57

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++++     + CL  G   FK+L RHL T H M P  Y+ ++ ++S   + ++ Y+  R 
Sbjct: 58  MKEAFRKNEVVCLVCGKGGFKTLARHLSTAHGMKPGAYKKQFGISSKQALSAKSYSEARR 117

Query: 129 KLAKNMGLGRGRKK 142
           K+A++ GL     K
Sbjct: 118 KMAQDRGLADNLAK 131


>gi|84502388|ref|ZP_01000524.1| putative mucR family transcriptional regulatory protein [Oceanicola
           batsensis HTCC2597]
 gi|84389200|gb|EAQ01997.1| putative mucR family transcriptional regulatory protein [Oceanicola
           batsensis HTCC2597]
          Length = 138

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 56/124 (45%), Gaps = 5/124 (4%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSI 74
           +M   IVA++ S        I  L   +        +              PA+P+ +++
Sbjct: 8   DMIATIVASFASRPDATPDAIVELYNRLMD-----EAGEETGTPAPQGTAVPALPLDRAV 62

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
               +YCL  G  FK LKRHL   H +T  EYR  + L +D+P+V+  Y+  ++  AK  
Sbjct: 63  TEDKVYCLCCGRGFKMLKRHLGAEHGLTEAEYRAMFGLPADFPLVAPNYSRKKASHAKQA 122

Query: 135 GLGR 138
           G G+
Sbjct: 123 GFGK 126


>gi|148550629|ref|YP_001260068.1| MucR family transcriptional regulator [Sphingomonas wittichii RW1]
 gi|148503048|gb|ABQ71301.1| transcriptional regulator, MucR family [Sphingomonas wittichii RW1]
          Length = 308

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 52/154 (33%), Positives = 78/154 (50%), Gaps = 18/154 (11%)

Query: 9   SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQR---VVSRAPCQDNVQP---- 61
                + +TV +++AY +N+ VP +++ +L+     AL     VVS AP +    P    
Sbjct: 5   EQSDVMSLTVALLSAYFANNTVPSSELPALVEGTRKALLGDAPVVSPAPEETVSAPVSVE 64

Query: 62  ---------ERLKPAVPIRKSI-ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWN 111
                       KPAV +  S+     +  L DG  +KSLKRHL T H +TP EYR +++
Sbjct: 65  PAAVPPTPAPEFKPAVTVDASLASPDQILSLIDGKPYKSLKRHLST-HGLTPAEYRARYD 123

Query: 112 LASDYPMVSREYATTRSKLAKNMGLGRGRKKRVL 145
           L +DYPMV+  Y+  R + A  +GLG  RK    
Sbjct: 124 LPADYPMVAPGYSAARREAALKLGLGGKRKDVAA 157


>gi|239907905|ref|YP_002954646.1| hypothetical protein DMR_32690 [Desulfovibrio magneticus RS-1]
 gi|239797771|dbj|BAH76760.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 135

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 57/133 (42%), Gaps = 2/133 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +++  ++IV A  +   +   +I S++  V   +  V +      N         + 
Sbjct: 1   MEEYIQSALEIVKAQANARPMTEDEIISMVKSVAQGIAAVSTGQIATINADAAAPA--ID 58

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K+I+   + CLE G  FK + +     H +TP+EY+ K+       +VS+     R  
Sbjct: 59  PKKAIKEASVTCLECGKSFKVITKKHLAAHGLTPEEYKEKFGYKKTQALVSKALVRERRA 118

Query: 130 LAKNMGLGRGRKK 142
             K+M L   R K
Sbjct: 119 KMKDMKLWERRGK 131


>gi|294146968|ref|YP_003559634.1| MucR-family transcriptional regulator [Sphingobium japonicum UT26S]
 gi|292677385|dbj|BAI98902.1| MucR-family transcriptional regulator [Sphingobium japonicum UT26S]
          Length = 238

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 70/136 (51%), Gaps = 4/136 (2%)

Query: 6   SFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLK 65
           + +       +TV +++AYVS + VP   +  LI    +      + A        E   
Sbjct: 2   ADEDKNDITALTVQLLSAYVSRNSVPSDSLADLIRTTRA--ALTENAAAAVAEPAAETFT 59

Query: 66  PAVPIRKSI-ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYA 124
           PAV +R+S+     +  L DG  +K+LKRHL   H +TP++YR ++ L S YP+V++ Y+
Sbjct: 60  PAVSVRRSLASPDRILSLIDGRPYKTLKRHLAA-HGLTPEQYRERYKLPSSYPLVAQSYS 118

Query: 125 TTRSKLAKNMGLGRGR 140
             R  +A+  GLG+  
Sbjct: 119 EARRAVAEKAGLGKKP 134


>gi|162148687|ref|YP_001603148.1| mucR family transcriptional regulatory protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787264|emb|CAP56858.1| putative mucR family transcriptional regulatory protein
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 258

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 47/161 (29%), Positives = 68/161 (42%), Gaps = 39/161 (24%)

Query: 19  DIVAAYVSNHVVPMADIGSLITDVHSAL-------------------------------- 46
           DIV A+++   V    +  L+ +V++++                                
Sbjct: 55  DIVMAHLATTKVETDRLAQLVREVYASVLHPEPAAGSPVAPVRNDPAPMPVAESAEQTSE 114

Query: 47  -------QRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHH 99
                      S A   D      L PAVPIR S+    + CLEDG + KSLKRHL +  
Sbjct: 115 RAAPPTPAVDTSSAAPADTAPTSGLVPAVPIRASVFPDYIVCLEDGKKLKSLKRHLSSAF 174

Query: 100 NMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGR 140
            MT  +Y+ KW+L  +YP V+  YA  R  +A+  GLGR  
Sbjct: 175 GMTIQDYKAKWDLPDEYPTVAPNYAEMRRDVARKSGLGRRP 215


>gi|239907544|ref|YP_002954285.1| hypothetical protein DMR_29080 [Desulfovibrio magneticus RS-1]
 gi|239797410|dbj|BAH76399.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 135

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 32/134 (23%), Positives = 58/134 (43%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +++  +DIV A  S   +   +I S++  V   +  V +       +  +   PA+ 
Sbjct: 1   MEEYIQSALDIVKAQASARPMTEDEIISMVKSVAKGIAAVSTGQLA--TIDADAAAPAMD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K+I+   + CLE G  FK + +     H +T +EY+ K+       +  +  A  R  
Sbjct: 59  PKKAIKEASITCLECGKSFKVITKKHLASHGLTSEEYKAKYGYKKTQALACKSLARERRT 118

Query: 130 LAKNMGLGRGRKKR 143
             K+M L   R K 
Sbjct: 119 KMKDMKLWERRTKS 132


>gi|301059672|ref|ZP_07200580.1| transcriptional regulator family protein [delta proteobacterium
           NaphS2]
 gi|300446238|gb|EFK10095.1| transcriptional regulator family protein [delta proteobacterium
           NaphS2]
          Length = 144

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 37/143 (25%), Positives = 63/143 (44%), Gaps = 3/143 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           ++   EM V++  A  S+  +   D+ + +T     L+ +       +    E  +P + 
Sbjct: 2   AKTLTEMAVELATAQASHATMSDEDMETYLTKTFQTLKHLKDVEEGAEITTEEPAEPQLD 61

Query: 70  IRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
            +KSI    + CLE G +FK L  +HL+  H M   EYR K+  +S   + +R  +  R 
Sbjct: 62  PKKSILKNKVICLECGREFKILTSKHLQKEHGMDSKEYRQKYGFSSRQSLAARSLSAQRR 121

Query: 129 KLAKNMGLGRGRK--KRVLTSKV 149
             AK   LG   +  K+    K 
Sbjct: 122 ATAKKHKLGEKLQANKKARQKKA 144


>gi|239908258|ref|YP_002954999.1| hypothetical protein DMR_36220 [Desulfovibrio magneticus RS-1]
 gi|239798124|dbj|BAH77113.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 135

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 58/133 (43%), Gaps = 2/133 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +++  ++IV A  S   +   +I S++  V   +  V +       +  +   PA+ 
Sbjct: 1   MEEYIQSALEIVKAQASARPMTEEEIISMVKSVAKGIAAVSTGQIA--TIDADAAAPAMD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            +K+I+   + CLE G  FK + +     H +T +EY+ K+       +  +  A  R  
Sbjct: 59  PKKAIKEASITCLECGKSFKVITKKHLASHGLTSEEYKAKYGYKKTQALACKSLARERRT 118

Query: 130 LAKNMGLGRGRKK 142
             K+M L   R K
Sbjct: 119 KMKDMKLWERRTK 131


>gi|89068740|ref|ZP_01156126.1| transcriptional regulator, MucR family protein [Oceanicola
           granulosus HTCC2516]
 gi|89045703|gb|EAR51765.1| transcriptional regulator, MucR family protein [Oceanicola
           granulosus HTCC2516]
          Length = 151

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 37/144 (25%), Positives = 66/144 (45%), Gaps = 3/144 (2%)

Query: 1   MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
           M +    D  +  +   + IV+A+ +   V    I  L + +   +    + A       
Sbjct: 1   MINMTKDDHEDDVI---LSIVSAFAARPDVEPDAIVELYSKLRREVGGETAVARAAAPAP 57

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
               +PA+PI +++    +YCL  G  FK LKRHL   H +T  +YR ++ L  + P+V+
Sbjct: 58  EAAAEPALPIEQAVTPDKVYCLCCGRGFKMLKRHLGAEHGLTEQQYRRRFGLPEEMPLVA 117

Query: 121 REYATTRSKLAKNMGLGRGRKKRV 144
             Y+  ++  AK  G G+  +  V
Sbjct: 118 PNYSRQKASYAKGAGFGKYDRSAV 141


>gi|332702440|ref|ZP_08422528.1| ROSMUCR transcriptional regulator [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332552589|gb|EGJ49633.1| ROSMUCR transcriptional regulator [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 138

 Score =  126 bits (318), Expect = 8e-28,   Method: Composition-based stats.
 Identities = 31/132 (23%), Positives = 55/132 (41%), Gaps = 4/132 (3%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
            E +LE  + IV A      +   +I S++  +   ++        +     ++ +    
Sbjct: 1   MESYLEDALGIVKAQAGVRHMTEEEIVSMVRTLAEGIKNATEGIVIEGEG--DKGEIPSD 58

Query: 70  IRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
             K+I    + CLE G +FK L KRHL   H +TP EY+ K        ++++  A  R 
Sbjct: 59  PSKAIRERSVQCLECGKKFKVLTKRHL-ALHGLTPKEYKAKHGYKKGTSLIAKGLARDRR 117

Query: 129 KLAKNMGLGRGR 140
              + + L   R
Sbjct: 118 NKMRELKLWEKR 129


>gi|298505978|gb|ADI84701.1| transcriptional regulator, Ros/MucR family [Geobacter
           sulfurreducens KN400]
          Length = 167

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 69/131 (52%), Gaps = 1/131 (0%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +   LE+T  IV+++ +   +   ++   I  VHS LQ++   A   +    E   PA+ 
Sbjct: 2   APTLLELTASIVSSHAAVSELSTEELVQEIQKVHSTLQQLEGGAAAPEAAAEEAKAPAMT 61

Query: 70  IRKSIENGCLYCLEDGM-QFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++K+ +   + C+  G    K+L RHL   H M P EYR ++N+ S  P+ +++++  R 
Sbjct: 62  LKKAFQADQVCCMICGKGGMKTLTRHLAQVHQMKPGEYRKQFNIPSSQPLTAKKFSEARK 121

Query: 129 KLAKNMGLGRG 139
           ++AK+ GL   
Sbjct: 122 QMAKDRGLAEN 132


>gi|78222519|ref|YP_384266.1| MucR family transcriptional regulator [Geobacter metallireducens
           GS-15]
 gi|78193774|gb|ABB31541.1| transcriptional regulator, MucR family [Geobacter metallireducens
           GS-15]
          Length = 166

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 36/134 (26%), Positives = 69/134 (51%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +   LE+T  IV+++ +   +   ++   I  V++ LQ++   AP     + E   P + 
Sbjct: 2   ASTLLELTAGIVSSHAAMSELSTEELVQEIQKVYTTLQQLEGGAPEAAQAE-ETKAPVIS 60

Query: 70  IRKSIENGCLYCLEDGMQ-FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
           ++K+ +   + C+  G    K+L RHL   H+M P EYR ++N+ S   + +R+++  R 
Sbjct: 61  LKKAFQADQVVCMICGKGGMKTLTRHLAQVHDMKPREYRKQFNIPSSQALTARKFSEARK 120

Query: 129 KLAKNMGLGRGRKK 142
           K+A+  GL     K
Sbjct: 121 KMAQERGLADNLAK 134


>gi|297568261|ref|YP_003689605.1| transcriptional regulator, MucR family [Desulfurivibrio
           alkaliphilus AHT2]
 gi|296924176|gb|ADH84986.1| transcriptional regulator, MucR family [Desulfurivibrio
           alkaliphilus AHT2]
          Length = 182

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 40/140 (28%), Positives = 66/140 (47%), Gaps = 4/140 (2%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV- 68
           ++  +EM  ++V A  S+  +   ++   +   ++ L  +               KPA+ 
Sbjct: 2   AKSLVEMAAELVQAQCSSTSLTAEEMAQSLQATYNVLHNLQQDESRGVAADVGLAKPALT 61

Query: 69  -PIRKSIENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
               KSI+   + CLE G +FK+L  +HL+T H +T  EYR KW L+   P+ +RE    
Sbjct: 62  GSPEKSIQKHKIVCLECGEEFKTLSSKHLQT-HGLTGREYRQKWGLSLRQPLCARELTDR 120

Query: 127 RSKLAKNMGLGRGRKKRVLT 146
           R KL K  GL    +K +  
Sbjct: 121 RKKLGKARGLPDNLRKSIAA 140


>gi|218459461|ref|ZP_03499552.1| putative nodulation competitiveness transcriptional regulator
           [Rhizobium etli Kim 5]
          Length = 67

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 40/64 (62%), Positives = 51/64 (79%)

Query: 79  LYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGR 138
           + CLE G  FKSLKRHL THH+++P+EYR KW+L +DYPMV+  YA  RS+LAK MGLG+
Sbjct: 1   MTCLECGGNFKSLKRHLMTHHSLSPEEYREKWDLPTDYPMVAPAYAEARSRLAKEMGLGQ 60

Query: 139 GRKK 142
            RK+
Sbjct: 61  RRKR 64


>gi|163744357|ref|ZP_02151717.1| transcriptional regulator [Oceanibulbus indolifex HEL-45]
 gi|161381175|gb|EDQ05584.1| transcriptional regulator [Oceanibulbus indolifex HEL-45]
          Length = 155

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 42/132 (31%), Positives = 68/132 (51%), Gaps = 6/132 (4%)

Query: 18  VDIVAAYVSNHVVPMADIGSLITDVHS--ALQRVVSRAPCQDNVQPERLKP----AVPIR 71
             IV+ + S   V + DI +L+  + +  A   V + A     V P   K     A P  
Sbjct: 16  ATIVSGFASRSDVTIDDILTLVERLRASPAESAVTALANIPATVTPIAPKASGMSAAPGE 75

Query: 72  KSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           + + +  ++CL  G  FK LKRHL   H +T  EYR+ +NLA+D P+V+  Y+  +++ A
Sbjct: 76  QPMTDDTIFCLCCGKGFKMLKRHLGAEHGLTEAEYRVMFNLAADAPLVAPSYSKRKAEYA 135

Query: 132 KNMGLGRGRKKR 143
           K  GLG+  + +
Sbjct: 136 KRAGLGKYSRDK 147


>gi|94263369|ref|ZP_01287184.1| transcriptional regulator-like [delta proteobacterium MLMS-1]
 gi|93456324|gb|EAT06454.1| transcriptional regulator-like [delta proteobacterium MLMS-1]
          Length = 200

 Score =  119 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 59/139 (42%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           +   EM  ++V A +S+  +   D+   + +  S L+ + +               A   
Sbjct: 3   KSLTEMAAELVCAQLSSTSMSQEDVSKALHETFSTLKSLKNAEVGGATETSHVSPLAETP 62

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
            KSI+   + CLE G +F+SL       H +T  EYR KW  +   P+ ++E    R + 
Sbjct: 63  MKSIQKHKIICLECGEEFRSLSSKHLQGHELTGKEYRRKWGFSMRQPLCAKELTAQRKEA 122

Query: 131 AKNMGLGRGRKKRVLTSKV 149
            K  GL    +K +L  K 
Sbjct: 123 GKKRGLPENLRKSMLAKKA 141


>gi|116747798|ref|YP_844485.1| MucR family transcriptional regulator [Syntrophobacter fumaroxidans
           MPOB]
 gi|116696862|gb|ABK16050.1| transcriptional regulator, MucR family [Syntrophobacter
           fumaroxidans MPOB]
          Length = 177

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 46/155 (29%), Positives = 73/155 (47%), Gaps = 20/155 (12%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL------ 64
           ++ LE+ V+IV A VS   +   +I S++  V++AL R+         V  E +      
Sbjct: 3   KKLLELAVEIVQAQVSIGKMTGEEIESVLVRVYNALHRMRRAEEEGRPVAMEEIGYGAAD 62

Query: 65  --KPAV--PIRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMV 119
             +P      R SI+   + C+E G QF+ L   HL+T H +TP EY+ KW      P+ 
Sbjct: 63  EHEPPGKGDPRDSIQEDQVICMECGSQFRQLTANHLRT-HQLTPREYKRKWGFPLKQPLA 121

Query: 120 SREYATTRSKLAKNMGLGRG--------RKKRVLT 146
           +R     RS+ AK  GL +         R+++ L 
Sbjct: 122 ARVLTKLRSRSAKKRGLPQKLQQYLEDQRRRKGLA 156


>gi|332703655|ref|ZP_08423743.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
 gi|332553804|gb|EGJ50848.1| transcriptional regulator, MucR family [Desulfovibrio africanus
           str. Walvis Bay]
          Length = 133

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 55/132 (41%), Gaps = 5/132 (3%)

Query: 12  RFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIR 71
             L+  ++IVAA      +   +I ++   +  +L +++  +        +  +P +   
Sbjct: 3   DALKEALEIVAAQARVRHMTEDEIVAMTRSLVISLNQILGESSTDST---QDQEPVIDPA 59

Query: 72  KSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           K      + CLE G  FKS+  RHLK  H +    Y  KW+L     +  +  A  R   
Sbjct: 60  KHRREKSITCLECGKSFKSITSRHLK-LHGLDKKTYLAKWDLPKGTSLTCKALARERRDR 118

Query: 131 AKNMGLGRGRKK 142
            K M L   R+K
Sbjct: 119 MKEMKLWNYREK 130


>gi|163849488|ref|YP_001637531.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
 gi|163661093|gb|ABY28460.1| ROSMUCR transcriptional regulator [Methylobacterium extorquens PA1]
          Length = 145

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 48/107 (44%), Gaps = 3/107 (2%)

Query: 7   FDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKP 66
            D S     +T  I+ AYV N+ +P A +  LI  VH  L  + +           R  P
Sbjct: 3   TDDSCGLEAVTASIIIAYVRNNRLPGAILPDLIRTVHQTLLSLGTTT-APPAPDSARPTP 61

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLA 113
           A  +RKSI    L    DG  +K+LKRHL T   +    YR ++ L 
Sbjct: 62  A-EVRKSITPDALISFIDGRPYKTLKRHL-TSRGLDAYSYRARFGLP 106


>gi|94266495|ref|ZP_01290185.1| transcriptional regulator-like [delta proteobacterium MLMS-1]
 gi|93452882|gb|EAT03396.1| transcriptional regulator-like [delta proteobacterium MLMS-1]
          Length = 199

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 35/139 (25%), Positives = 59/139 (42%)

Query: 11  ERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPI 70
           +   EM  ++V A +S+  +   D+   + +  S L+ + +               A   
Sbjct: 3   KSLTEMAAELVCAQLSSTSMSQEDVSKALHETFSTLKSLKNAEVGGATETSHVSPLAETP 62

Query: 71  RKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
            KSI+   + CLE G +F+SL       H +T  EYR KW  +   P+ ++E    R + 
Sbjct: 63  MKSIQKHKIICLECGEEFRSLSSKHLQGHELTGKEYRRKWGFSMRQPLCAKELTAQRKEA 122

Query: 131 AKNMGLGRGRKKRVLTSKV 149
            K  GL    +K +L  K 
Sbjct: 123 GKKRGLPENLRKSMLAKKA 141


>gi|116747683|ref|YP_844370.1| MucR family transcriptional regulator [Syntrophobacter fumaroxidans
           MPOB]
 gi|116696747|gb|ABK15935.1| transcriptional regulator, MucR family [Syntrophobacter
           fumaroxidans MPOB]
          Length = 181

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 39/158 (24%), Positives = 68/158 (43%), Gaps = 18/158 (11%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQR----------VVSRAPCQDNV 59
           S++ LE+T +IV A  +   +   +I   +    + LQR          +   APC+D+ 
Sbjct: 2   SKKLLEITAEIVQAQATVGKMSPEEIELTLVRTFATLQRMQTAEDGGKPLDPGAPCEDSR 61

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMV 119
             +R         SI+   + CLE G++ + L       HN+ P EY+ KW L     + 
Sbjct: 62  LEDRTGDKGGPMDSIQENKVVCLECGVEMRQLTAKHLGSHNLNPREYKRKWGLPLKQSLS 121

Query: 120 SREYATTRSKLAKNMGLG--------RGRKKRVLTSKV 149
           ++  +  RSK A+  GL           ++K+   S+ 
Sbjct: 122 AKSLSKARSKAARKRGLPANLVKFQEERKRKKAEASRA 159


>gi|116748961|ref|YP_845648.1| MucR family transcriptional regulator [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698025|gb|ABK17213.1| transcriptional regulator, MucR family [Syntrophobacter
           fumaroxidans MPOB]
          Length = 181

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 39/149 (26%), Positives = 65/149 (43%), Gaps = 11/149 (7%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSR---------APCQDNVQ 60
           + + +E++ DI+   VS   +   ++   +  V  ALQ +            A   +   
Sbjct: 2   TRKLVEISADIIQNQVSTTPMSPDELVLSLQKVFRALQDMQKSETDGTVLDLARPLEEGS 61

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMV 119
            E   P +  R+SI+   + CLE G + + L  RHL + H +TP EYR K+      P+ 
Sbjct: 62  EESGPPQLSPRESIQQDKIVCLECGAEMRQLTARHLVS-HELTPREYRKKYGFTMRTPLS 120

Query: 120 SREYATTRSKLAKNMGLGRGRKKRVLTSK 148
           ++     RSK AK  GL     + +   K
Sbjct: 121 AKSLTKARSKAAKKRGLPEKLVQFLEAKK 149


>gi|116747952|ref|YP_844639.1| MucR family transcriptional regulator [Syntrophobacter fumaroxidans
           MPOB]
 gi|116697016|gb|ABK16204.1| transcriptional regulator, MucR family [Syntrophobacter
           fumaroxidans MPOB]
          Length = 183

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/150 (24%), Positives = 62/150 (41%), Gaps = 12/150 (8%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQR----------VVSRAPCQDNV 59
           +++ L++  +I+ A  S   +    I   +    S LQ+          +   A  +   
Sbjct: 2   TKKLLDIAAEIIQAQASVGQMTPTQIEEALIKTFSTLQKMQKAEEKGLFLDVAAIGEGVA 61

Query: 60  QPERLKPAVPIRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPM 118
                      + SI++  + CLE G Q + L  RHL + H +TP EY+ KW  +   P+
Sbjct: 62  LEGGASLKQDPKSSIQDDKITCLECGTQMRQLTARHL-SAHGLTPREYKKKWGFSFKQPL 120

Query: 119 VSREYATTRSKLAKNMGLGRGRKKRVLTSK 148
            ++     RSK AK  GL     K +   K
Sbjct: 121 SAKSLTKARSKAAKKRGLPENLVKFLEQKK 150


>gi|94268728|ref|ZP_01291266.1| transcriptional regulator, Ros/MucR family [delta proteobacterium
           MLMS-1]
 gi|93451484|gb|EAT02315.1| transcriptional regulator, Ros/MucR family [delta proteobacterium
           MLMS-1]
          Length = 166

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 59/134 (44%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S+  +EM  ++V +  +   +   ++   +   ++ L  +                 A  
Sbjct: 2   SKTLVEMAAELVQSQCAATSMTADEVAQSLQATYNVLHNLQRDEARGVAADAGGSPFAEQ 61

Query: 70  IRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
             KSI+   + CLE G +FK +  +HL++ H++T  EYR KW L     + SRE +  R 
Sbjct: 62  PEKSIQKHKIVCLECGEEFKMISPKHLRS-HDLTGREYRRKWGLPLRQALCSRELSERRK 120

Query: 129 KLAKNMGLGRGRKK 142
           K  K  GL    +K
Sbjct: 121 KAGKERGLPDNLRK 134


>gi|94265272|ref|ZP_01289031.1| transcriptional regulator, Ros/MucR family [delta proteobacterium
           MLMS-1]
 gi|93454253|gb|EAT04569.1| transcriptional regulator, Ros/MucR family [delta proteobacterium
           MLMS-1]
          Length = 166

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 34/134 (25%), Positives = 59/134 (44%), Gaps = 2/134 (1%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           S+  +EM  ++V +  +   +   ++   +   ++ L  +                 A  
Sbjct: 2   SKTLVEMAAELVQSQCAATSMTADEVAQSLQATYNVLHNLQRDEARGVAADAGGSPFADQ 61

Query: 70  IRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
             KSI+   + CLE G +FK +  +HL++ H++T  EYR KW L     + SRE +  R 
Sbjct: 62  PEKSIQKHKIVCLECGEEFKMISPKHLRS-HDLTGREYRRKWGLPLRQALCSRELSERRK 120

Query: 129 KLAKNMGLGRGRKK 142
           K  K  GL    +K
Sbjct: 121 KAGKERGLPDNLRK 134


>gi|218782445|ref|YP_002433763.1| MucR family transcriptional regulator [Desulfatibacillum
           alkenivorans AK-01]
 gi|218763829|gb|ACL06295.1| transcriptional regulator, MucR family [Desulfatibacillum
           alkenivorans AK-01]
          Length = 173

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 36/145 (24%), Positives = 60/145 (41%), Gaps = 18/145 (12%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV- 68
           ++   E+  +IVAA V +  +   ++G  +  V   L ++   A   +  +     PA  
Sbjct: 2   AKTLTEIAAEIVAAQVGSTSMTSEEVGEALKSVFKTLVQL-RMAEGGEEAEALTQVPAAL 60

Query: 69  ---------------PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLA 113
                          PIR SI    + CLE G +FK L +     H+M   EYR K+   
Sbjct: 61  GEEGVSDQLAELRQRPIR-SIRKNKVICLECGAEFKQLTKGHLKEHDMDAKEYRKKYGFK 119

Query: 114 SDYPMVSREYATTRSKLAKNMGLGR 138
           +  P+ ++  +  R + AK   LG 
Sbjct: 120 ARQPLSAQSLSAKRRQSAKERNLGE 144


>gi|330990682|ref|ZP_08314638.1| Putative mucR family transcriptional regulatory protein y4pD
           [Gluconacetobacter sp. SXCC-1]
 gi|329762122|gb|EGG78610.1| Putative mucR family transcriptional regulatory protein y4pD
           [Gluconacetobacter sp. SXCC-1]
          Length = 98

 Score =  111 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 46/75 (61%)

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           +    + CLEDG + K LKRHL + ++MTP +YR KW+L   YPMV+  YA  RS LA+ 
Sbjct: 1   MFPDYIVCLEDGKKLKMLKRHLHSAYDMTPQQYREKWSLPESYPMVAPTYAVRRSALAQE 60

Query: 134 MGLGRGRKKRVLTSK 148
           +GL R  K     S+
Sbjct: 61  IGLQRATKAPAEISE 75


>gi|46204048|ref|ZP_00050577.2| hypothetical protein Magn03004453 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 121

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/61 (47%), Positives = 44/61 (72%), Gaps = 1/61 (1%)

Query: 82  LEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRK 141
            EDG  +K+L+RHL T   ++P++YR KW L +DYPM S  Y+  RS+LA+ +GLG+ R+
Sbjct: 26  FEDGKPYKTLRRHL-TLRGLSPEQYRAKWGLPNDYPMTSASYSEQRSELARALGLGQQRR 84

Query: 142 K 142
           +
Sbjct: 85  R 85


>gi|170739063|ref|YP_001767718.1| MucR family transcriptional regulator [Methylobacterium sp. 4-46]
 gi|168193337|gb|ACA15284.1| transcriptional regulator, MucR family [Methylobacterium sp. 4-46]
          Length = 168

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 38/148 (25%), Positives = 64/148 (43%), Gaps = 5/148 (3%)

Query: 2   DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP 61
           DD          + +  D+V+AY     +    + + +     ++    + A      QP
Sbjct: 5   DDKVGRPDPLDLMGLASDLVSAY---SRLTAEIVSTCLER-SLSMAGFPAAAQPDAPPQP 60

Query: 62  ERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSR 121
           ER  P VPI  ++    +  LE+G  ++SLKRHL     +TP++YR KW L  DYPM + 
Sbjct: 61  ERPVPPVPIESTVTPEHIVSLENGKPYRSLKRHLAAR-GLTPEQYRAKWGLPPDYPMTAA 119

Query: 122 EYATTRSKLAKNMGLGRGRKKRVLTSKV 149
             +  R     +  +  G + R    + 
Sbjct: 120 AASGGRPAAGPDPAVPVGPRARRPKGRA 147


>gi|209545591|ref|YP_002277820.1| MucR family transcriptional regulator [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209533268|gb|ACI53205.1| transcriptional regulator, MucR family [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 299

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 1/90 (1%)

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            +R  P  P++ S+    L CL  G  F  LKRH++  H  TP+ YR+ W L ++YPM S
Sbjct: 200 AKRDHPTHPVQNSVREDSLTCLHCGEAFTMLKRHIENKHRQTPEAYRVYWGLPANYPMAS 259

Query: 121 REYATTRSKLAKNMGLGR-GRKKRVLTSKV 149
             Y+  +   A+    G   R+KR    + 
Sbjct: 260 EAYSEMKKAEAEISKFGSYDRRKRNQKKEA 289


>gi|163849546|ref|YP_001637589.1| transcriptional regulator protein-like protein [Methylobacterium
           extorquens PA1]
 gi|163661151|gb|ABY28518.1| transcriptional regulator protein-like protein [Methylobacterium
           extorquens PA1]
          Length = 125

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 40/62 (64%), Gaps = 1/62 (1%)

Query: 79  LYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGR 138
           +   EDG  +K+L RHL T   +TP+ YR KW L  DYPM++  Y+  RS+ A ++GLGR
Sbjct: 1   MISFEDGKAYKTLPRHL-TKQGLTPEAYRAKWGLPVDYPMIAPAYSAQRSRPALDLGLGR 59

Query: 139 GR 140
            R
Sbjct: 60  QR 61


>gi|162147484|ref|YP_001601945.1| transcriptional regulator protein [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|161786061|emb|CAP55643.1| putative transcriptional regulator protein [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 171

 Score = 99.5 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 1/90 (1%)

Query: 61  PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120
            +R  P  P++ S+    L CL  G  F  LKRH++  H  TP+ YR+ W L ++YPM S
Sbjct: 72  AKRDHPTHPVQNSVREDSLTCLHCGEAFTMLKRHIENKHRQTPEAYRVYWGLPANYPMAS 131

Query: 121 REYATTRSKLAKNMGLGR-GRKKRVLTSKV 149
             Y+  +   A+    G   R+KR    + 
Sbjct: 132 EAYSEMKKAEAEISKFGSYDRRKRNQKKEA 161


>gi|84502389|ref|ZP_01000525.1| Transcriptional regulator [Oceanicola batsensis HTCC2597]
 gi|84389201|gb|EAQ01998.1| Transcriptional regulator [Oceanicola batsensis HTCC2597]
          Length = 98

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPM 118
                L+PAV I  S+    L CLE G +   L+RHL+    MTP+EYR +W L  +YPM
Sbjct: 20  APGIALRPAVRIEDSVTPNFLVCLETGSRQVLLRRHLRETLRMTPEEYRDRWGLPPEYPM 79

Query: 119 VSREYATTRSKLAKN 133
           V+  Y   R   A+ 
Sbjct: 80  VAANYLR-RKAAARQ 93


>gi|240142212|ref|YP_002966722.1| hypothetical protein MexAM1_META2p0534 [Methylobacterium extorquens
           AM1]
 gi|240012156|gb|ACS43381.1| Hypothetical protein MexAM1_META2p0534 [Methylobacterium extorquens
           AM1]
          Length = 322

 Score = 87.6 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 31/94 (32%), Positives = 46/94 (48%), Gaps = 9/94 (9%)

Query: 56  QDNVQPERLKPAVPIRKSI--------ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYR 107
           Q    P   K    IRK++          G + CLEDG   + LK+HLK    + P EY 
Sbjct: 195 QPTYAPRSAKEVEKIRKAVFVNDYEGKTGGFVRCLEDGQIRRMLKKHLK-FLEIPPAEYL 253

Query: 108 IKWNLASDYPMVSREYATTRSKLAKNMGLGRGRK 141
            KW L +D+P+V  +++ +R+   K  GL   R+
Sbjct: 254 AKWGLPADFPLVHPDFSASRANQIKTAGLWEQRR 287



 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/60 (23%), Positives = 28/60 (46%)

Query: 9  SSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAV 68
          S    ++MT DI  +Y+ N+ +    +  +I  +H AL+ V + A        + +  +V
Sbjct: 16 SPSTHVKMTADIATSYLGNNSIAPERVKDVILSIHDALREVHTTASVGAPSLKDEITSSV 75


>gi|218671088|ref|ZP_03520759.1| putative nodulation competitiveness transcriptional regulator
           [Rhizobium etli GR56]
          Length = 48

 Score = 84.1 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 37/45 (82%)

Query: 98  HHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKK 142
           HH+++P+EYR KW+L +DYPMV+  YA  RS+LAK MGLG+ RK+
Sbjct: 1   HHSLSPEEYREKWDLPTDYPMVAPAYAEARSRLAKEMGLGQRRKR 45


>gi|163747564|ref|ZP_02154913.1| GAF sensor hybrid histidine kinase [Oceanibulbus indolifex HEL-45]
 gi|161379161|gb|EDQ03581.1| GAF sensor hybrid histidine kinase [Oceanibulbus indolifex HEL-45]
          Length = 476

 Score = 83.7 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 31/58 (53%)

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
              L CLE G +   L+RHL+  H M+P+ YR KW L  D+ + S  Y   R+   ++
Sbjct: 418 PSQLTCLECGAKLSLLRRHLRQEHGMSPEVYRAKWGLPEDFELSSGAYRAMRAAAKRD 475


>gi|239904790|ref|YP_002951528.1| hypothetical protein DMR_01510 [Desulfovibrio magneticus RS-1]
 gi|239794653|dbj|BAH73642.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 179

 Score = 77.5 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 2/100 (2%)

Query: 50  VSRAPCQDNVQPERLK-PA-VPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYR 107
            S A      QP+ +K PA V  + +I+   + C E G + K L       H +    Y 
Sbjct: 49  GSPAQAGSGNQPDGVKSPAGVDPKMAIQEDYVQCCECGAKMKMLGDAHLAKHGLNKTSYL 108

Query: 108 IKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKKRVLTS 147
           +K+  A    +VS E +  R + AK+  LG  + +   ++
Sbjct: 109 LKYGYAPKTALVSGELSKKRKESAKDNKLGHQKTEDAPSA 148


>gi|218508298|ref|ZP_03506176.1| transcriptional regulator protein - nodulation competitiveness
          determinant [Rhizobium etli Brasil 5]
          Length = 166

 Score = 75.2 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 30/79 (37%), Positives = 43/79 (54%)

Query: 1  MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
          M D A+ +  E  +E+T DIVAAYVSNHVVP++D+ +LI+DVH AL       P    V+
Sbjct: 1  MTDMATGNGPELLVELTADIVAAYVSNHVVPVSDLANLISDVHLALSNTSVPQPAAAVVE 60

Query: 61 PERLKPAVPIRKSIENGCL 79
                  P  ++     +
Sbjct: 61 KPEACSLCPQVRTGRADYV 79


>gi|163849545|ref|YP_001637588.1| transcriptional regulator protein-like protein [Methylobacterium
          extorquens PA1]
 gi|163661150|gb|ABY28517.1| transcriptional regulator protein-like protein [Methylobacterium
          extorquens PA1]
          Length = 80

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 6/82 (7%)

Query: 1  MDDD----ASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQ 56
          M +D    A     +R + +T +IV AYV+ + V  A++  L+  VH+ L R+ S     
Sbjct: 1  MAEDVQMAADIVEQDRLVTLTTEIVTAYVTRNHVQAAELPGLLRSVHAGLLRLSSG--SG 58

Query: 57 DNVQPERLKPAVPIRKSIENGC 78
          +  +  R   A  IR+SI    
Sbjct: 59 EPTEERRTLTAAEIRRSIRPEA 80


>gi|169825353|ref|YP_001691246.1| hypothetical protein M446_6989 [Methylobacterium sp. 4-46]
 gi|168199275|gb|ACA21221.1| hypothetical protein M446_6989 [Methylobacterium sp. 4-46]
          Length = 318

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 67  AVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEY 106
           AV + K++    +  LEDG  +KSL+RHL T   +TP++Y
Sbjct: 28  AVQVEKTVTPDAIISLEDGKPYKSLRRHLNTR-GLTPEQY 66


>gi|239907856|ref|YP_002954597.1| hypothetical protein DMR_32200 [Desulfovibrio magneticus RS-1]
 gi|239797722|dbj|BAH76711.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 178

 Score = 67.9 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 51/129 (39%), Gaps = 9/129 (6%)

Query: 14  LEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKS 73
           +E T D+   Y+++       +  +  D+ +        +   DNV P +LK  V    +
Sbjct: 20  VEQTTDLAGKYLTS-------LAKMRVDIANGQVASSPVSGVSDNVAPMKLK--VNPHNA 70

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKN 133
           I+   + C   G +FK+L +     H +T D Y      A + P++ R+    R    + 
Sbjct: 71  IQADKIVCCICGGEFKTLTKGHLAEHGLTRDTYLDLCGYAKNTPLMCRDQIAARKASVQE 130

Query: 134 MGLGRGRKK 142
                  K+
Sbjct: 131 SKPWEKTKR 139


>gi|240142394|ref|YP_002966904.1| hypothetical protein MexAM1_META2p0719 [Methylobacterium extorquens
           AM1]
 gi|240012338|gb|ACS43563.1| Hypothetical protein MexAM1_META2p0719 [Methylobacterium extorquens
           AM1]
          Length = 242

 Score = 67.5 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 36/84 (42%)

Query: 44  SALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTP 103
           +A +      P      PE  +PAVP  +S+    +  L  G    +L R +       P
Sbjct: 127 AARRTRAVSVPPPLPAPPEDDEPAVPPSRSLTPDAVIDLAGGKPHGNLGRFIADARGEDP 186

Query: 104 DEYRIKWNLASDYPMVSREYATTR 127
           + YR ++ L  +YP+++     TR
Sbjct: 187 ETYRRRFGLPKEYPLMAPRLIRTR 210



 Score = 52.9 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 28/68 (41%)

Query: 1  MDDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQ 60
          M D          +++T D+V A+VS   VP   + +LI +VH  L+ +    P      
Sbjct: 5  MQDTGQGAPYVDIMDLTADLVRAHVSKSDVPPEMLRTLILEVHGTLRALSEPQPPGAAGP 64

Query: 61 PERLKPAV 68
                AV
Sbjct: 65 IPMSPGAV 72


>gi|114765234|ref|ZP_01444366.1| Predicted transcriptional regulator [Pelagibaca bermudensis
           HTCC2601]
 gi|114542369|gb|EAU45397.1| Predicted transcriptional regulator [Roseovarius sp. HTCC2601]
          Length = 91

 Score = 61.0 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 5/75 (6%)

Query: 46  LQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDE 105
           L+R++ R     + +P +++ A         G L CLE G +   L+RHL+    MTP+E
Sbjct: 5   LRRILQRLIGDRHAKPAQVQWADD-----RPGTLLCLETGQRRPLLRRHLRETLGMTPEE 59

Query: 106 YRIKWNLASDYPMVS 120
           YR KW L  DYPMVS
Sbjct: 60  YRKKWGLPDDYPMVS 74


>gi|320182274|gb|EFW57177.1| hypothetical protein SGB_00646 [Shigella boydii ATCC 9905]
          Length = 182

 Score = 59.4 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 25/58 (43%)

Query: 77  GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
             + CLE G     L RH+   H +  DEYR KWN+     +    Y   +S+  K  
Sbjct: 23  EKIPCLECGKLLIFLPRHIWFVHGIRADEYREKWNIPKHIALAGISYLEKQSEYMKAR 80


>gi|332087364|gb|EGI92492.1| transcriptional regulatory protein [Shigella boydii 5216-82]
          Length = 182

 Score = 59.4 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 25/58 (43%)

Query: 77  GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
             + CLE G     L RH+   H +  DEYR KWN+     +    Y   +S+  K  
Sbjct: 23  EKIPCLECGKLLIFLPRHIWFVHGIRADEYREKWNIPKHIALAGISYLEKQSEYMKAR 80


>gi|227505817|ref|ZP_03935866.1| hypothetical protein HMPREF0308_2087 [Corynebacterium striatum ATCC
           6940]
 gi|227197573|gb|EEI77621.1| hypothetical protein HMPREF0308_2087 [Corynebacterium striatum ATCC
           6940]
          Length = 217

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 27/56 (48%)

Query: 76  NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           +  + C E G  +++L  HL   H+MT  EY+    L     +V+ E    +S+ A
Sbjct: 19  DERIICHECGGLYRALAPHLIKAHDMTAAEYKQAHGLPRGMGLVAPETRRAKSRQA 74


>gi|239907883|ref|YP_002954624.1| hypothetical protein DMR_32470 [Desulfovibrio magneticus RS-1]
 gi|239797749|dbj|BAH76738.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 210

 Score = 58.3 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 30/71 (42%), Gaps = 1/71 (1%)

Query: 73  SIENGCLYCLEDGMQFKSLKR-HLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLA 131
           +++     C   G QF  + + HL+  H +TP+EYR     +    +++  Y   R+   
Sbjct: 76  ALQGDKATCCLCGKQFDIITKPHLRESHGITPEEYRNLCGYSPTQRLMTETYRQQRANKL 135

Query: 132 KNMGLGRGRKK 142
           K     +   +
Sbjct: 136 KGNEPWKQTNR 146


>gi|191168600|ref|ZP_03030383.1| hypothetical protein EcB7A_3290 [Escherichia coli B7A]
 gi|190901346|gb|EDV61112.1| hypothetical protein EcB7A_3290 [Escherichia coli B7A]
          Length = 182

 Score = 57.9 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 27/60 (45%)

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
           +   + CLE G     L RH+   H +  DEYR+KWN+     +    Y   +S+  K  
Sbjct: 21  KREKIPCLECGKLLIFLPRHIWFVHGIRADEYRVKWNIPKHIALAGISYLEKQSEYMKAR 80


>gi|157158496|ref|YP_001464151.1| hypothetical protein EcE24377A_3136 [Escherichia coli E24377A]
 gi|193065111|ref|ZP_03046185.1| hypothetical protein EcE22_1583 [Escherichia coli E22]
 gi|194426189|ref|ZP_03058744.1| hypothetical protein EcB171_1784 [Escherichia coli B171]
 gi|256019388|ref|ZP_05433253.1| hypothetical protein ShiD9_10771 [Shigella sp. D9]
 gi|307310574|ref|ZP_07590222.1| transcriptional regulator, MucR family [Escherichia coli W]
 gi|309793863|ref|ZP_07688288.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|332280507|ref|ZP_08392920.1| conserved hypothetical protein [Shigella sp. D9]
 gi|157080526|gb|ABV20234.1| hypothetical protein EcE24377A_3136 [Escherichia coli E24377A]
 gi|192927242|gb|EDV81862.1| hypothetical protein EcE22_1583 [Escherichia coli E22]
 gi|194415497|gb|EDX31764.1| hypothetical protein EcB171_1784 [Escherichia coli B171]
 gi|306909469|gb|EFN39964.1| transcriptional regulator, MucR family [Escherichia coli W]
 gi|308122270|gb|EFO59532.1| conserved hypothetical protein [Escherichia coli MS 145-7]
 gi|315062122|gb|ADT76449.1| conserved hypothetical protein [Escherichia coli W]
 gi|323159989|gb|EFZ45954.1| transcriptional regulatory protein [Escherichia coli E128010]
 gi|323377298|gb|ADX49566.1| hypothetical protein EKO11_0925 [Escherichia coli KO11]
 gi|332102859|gb|EGJ06205.1| conserved hypothetical protein [Shigella sp. D9]
          Length = 182

 Score = 57.9 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 27/60 (45%)

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
           +   + CLE G     L RH+   H +  DEYR+KWN+     +    Y   +S+  K  
Sbjct: 21  KREKIPCLECGKLLIFLPRHIWFVHGIRADEYRVKWNIPKHIALAGISYLEKQSEYMKAR 80


>gi|300923201|ref|ZP_07139256.1| hypothetical protein HMPREF9548_01408 [Escherichia coli MS 182-1]
 gi|301326144|ref|ZP_07219530.1| conserved hypothetical protein [Escherichia coli MS 78-1]
 gi|300420510|gb|EFK03821.1| hypothetical protein HMPREF9548_01408 [Escherichia coli MS 182-1]
 gi|300847109|gb|EFK74869.1| conserved hypothetical protein [Escherichia coli MS 78-1]
          Length = 182

 Score = 57.9 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 27/60 (45%)

Query: 75  ENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNM 134
           +   + CLE G     L RH+   H +  DEYR+KWN+     +    Y   +S+  K  
Sbjct: 21  KREKIPCLECGKLLIFLPRHIWFVHGIRADEYRVKWNIPKHIALAGISYLEKQSEYMKAR 80


>gi|27383526|ref|NP_775059.1| putative transcriptional regulator [Citrobacter freundii]
 gi|216967805|ref|YP_002333313.1| hypothetical protein pCTXM360_p31 [Klebsiella pneumoniae]
 gi|27261379|gb|AAN87720.1| putative transcriptional regulator [Citrobacter freundii]
 gi|215397977|gb|ACJ65254.1| hypothetical protein [Klebsiella pneumoniae]
 gi|323700902|gb|ADY00055.1| hypothetical protein [Escherichia coli]
          Length = 169

 Score = 57.1 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 23/53 (43%)

Query: 77  GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
             + CLE G  F  L  HL   H M   EYR +W +    P+ S  ++    +
Sbjct: 9   EKIQCLECGKYFSFLAPHLNKTHQMNAREYRERWAIPLHTPLASVSHSRQCRE 61


>gi|239908287|ref|YP_002955028.1| hypothetical protein DMR_36510 [Desulfovibrio magneticus RS-1]
 gi|239798153|dbj|BAH77142.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 185

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 31/144 (21%), Positives = 62/144 (43%), Gaps = 13/144 (9%)

Query: 15  EMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSI 74
              V++    + +  +  +D+ ++   ++  L  + S        +P +   A   R   
Sbjct: 8   SEAVNLAKDQLRHGKIHFSDLETVAKSIYEKLDSLRSGPVIDITAEPMKQIEA--PRHEK 65

Query: 75  ENGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNL-ASDYPM-VSREYA------- 124
              C+ C   G +FK+L K+HL T H +T +EY  K+++   D  + V+R+         
Sbjct: 66  TRKCVKCALCGAEFKTLTKKHLAT-HGLTREEYMKKFDVSKKDMSVKVARKTTSGEDNPL 124

Query: 125 TTRSKLAKNMGLGRGRKKRVLTSK 148
                + K+ G+ RG  K+ +  K
Sbjct: 125 KQMQMIMKDFGIARGEVKKFVMDK 148


>gi|283852293|ref|ZP_06369565.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
 gi|283572375|gb|EFC20363.1| transcriptional regulator, MucR family [Desulfovibrio sp. FW1012B]
          Length = 186

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 42/100 (42%), Gaps = 3/100 (3%)

Query: 17  TVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIEN 76
            +++    + +  V  +++  +   ++  L  +          +  +   A   +     
Sbjct: 10  ALNLAKDQLRHGKVHFSELEVVTKSIYEKLCSLRCGPALDIEPEALKQVDASQ-KHEKTR 68

Query: 77  GCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWNLASD 115
             + C   G +FKSL KRHL + H +T +EY  K++++  
Sbjct: 69  KGVKCAICGAEFKSLGKRHLAS-HGLTREEYMAKFDVSKK 107


>gi|212704542|ref|ZP_03312670.1| hypothetical protein DESPIG_02601 [Desulfovibrio piger ATCC 29098]
 gi|212671941|gb|EEB32424.1| hypothetical protein DESPIG_02601 [Desulfovibrio piger ATCC 29098]
          Length = 176

 Score = 54.8 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/103 (20%), Positives = 38/103 (36%), Gaps = 15/103 (14%)

Query: 59  VQPERLKPAVPIRK-------------SIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPD 104
              E  KPA   +K             +I +  + C   G    SL  RHL  +H +  +
Sbjct: 75  PVEEEKKPAPAPKKIFTKADLVFNPAEAITDNTITCCLCGKAACSLTSRHL-ANHGINVE 133

Query: 105 EYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKKRVLTS 147
           EY+      S+  ++SR +     +  +     R  K++   +
Sbjct: 134 EYKYLCGYPSEQKLMSRNFEAKMRRNVQRAQQARKEKRQAENA 176


>gi|239907894|ref|YP_002954635.1| hypothetical protein DMR_32580 [Desulfovibrio magneticus RS-1]
 gi|239797760|dbj|BAH76749.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 199

 Score = 52.1 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/97 (17%), Positives = 42/97 (43%), Gaps = 6/97 (6%)

Query: 17  TVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERL-KPAVPIRKSIE 75
            +++    + +  V  +++  +   ++  L  + +        +P +  + A  ++    
Sbjct: 31  ALNLAKDQLRHGKVHFSELEVVTKSIYEKLTALSAGPIIDVQPEPMKQIETAQHVK---T 87

Query: 76  NGCLYCLEDGMQFKSL-KRHLKTHHNMTPDEYRIKWN 111
              + C   G++FK L  +HL+T H +T  EY  K+ 
Sbjct: 88  KKGVKCAVCGVEFKVLGTKHLET-HGLTRKEYMNKFG 123


>gi|283851748|ref|ZP_06369026.1| hypothetical protein DFW101DRAFT_1596 [Desulfovibrio sp. FW1012B]
 gi|283572868|gb|EFC20850.1| hypothetical protein DFW101DRAFT_1596 [Desulfovibrio sp. FW1012B]
          Length = 186

 Score = 51.4 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 13/94 (13%), Positives = 33/94 (35%), Gaps = 1/94 (1%)

Query: 17  TVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIEN 76
            +++    + +  V  +++  +   ++  L  +         V+  +   A   +     
Sbjct: 10  ALNLAKDQLRHGKVHFSELEVVTKSIYEKLCSLRCGPVIDIEVEGPKQLEATQ-KHEKTK 68

Query: 77  GCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKW 110
             + C   G + K+L       H +T  EY  K+
Sbjct: 69  KYVKCAICGKEVKTLTERHTRSHGLTRKEYMDKF 102


>gi|239904721|ref|YP_002951459.1| hypothetical protein DMR_00820 [Desulfovibrio magneticus RS-1]
 gi|239794584|dbj|BAH73573.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 190

 Score = 49.4 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 42/117 (35%), Gaps = 11/117 (9%)

Query: 10  SERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP 69
           +++     VDI      +  V  +D+      +++ L  +      + N  PE    A  
Sbjct: 3   NKKLWSEAVDIAKDQARHGKVHYSDLQKATETIYNDLLLLEQGPVFETNPIPEPSTQAAL 62

Query: 70  IRKS--IEN-----GCLYCLEDGMQFKSLK-RHLKTHHNMTP-DEYRIKWN-LASDY 116
              S  I         + C E G Q KS+   HLK  H +   +EY  K   L  D 
Sbjct: 63  PAPSAGIFKHERVGDFVTCAECGEQMKSISIAHLK-KHGINSREEYMQKHGVLKKDM 118


>gi|317487244|ref|ZP_07946040.1| hypothetical protein HMPREF0179_03403 [Bilophila wadsworthia 3_1_6]
 gi|316921499|gb|EFV42789.1| hypothetical protein HMPREF0179_03403 [Bilophila wadsworthia 3_1_6]
          Length = 159

 Score = 49.4 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/94 (14%), Positives = 32/94 (34%)

Query: 30  VPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFK 89
           +    +   +     A +      P     +  R    V   ++I    + C   G  F+
Sbjct: 45  MDSEALSESLCCAEDAQKEETVSEPSAPKKKYTRRNLVVKPEEAISEQEIACCICGKTFQ 104

Query: 90  SLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREY 123
           +L       H++T +EY+       +  ++S + 
Sbjct: 105 NLTTKHIQSHDLTVEEYKKLCGYGPEQKLISSKL 138


>gi|317486452|ref|ZP_07945277.1| hypothetical protein HMPREF0179_02635 [Bilophila wadsworthia 3_1_6]
 gi|316922255|gb|EFV43516.1| hypothetical protein HMPREF0179_02635 [Bilophila wadsworthia 3_1_6]
          Length = 163

 Score = 49.0 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 32/78 (41%), Gaps = 11/78 (14%)

Query: 68  VPIRKSIENGCLYCLEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMVSREY--- 123
           V   ++I +  + C   G  F++L  +HL + H ++ DEY+       +  ++ +     
Sbjct: 83  VRPEEAIGDDVVQCCLCGRGFQNLTAKHLLS-HGISVDEYKKLCGYVPEQKLICKNLLEK 141

Query: 124 ------ATTRSKLAKNMG 135
                    RS+  K  G
Sbjct: 142 LQENVQKAQRSREQKLSG 159


>gi|212703133|ref|ZP_03311261.1| hypothetical protein DESPIG_01172 [Desulfovibrio piger ATCC 29098]
 gi|212673399|gb|EEB33882.1| hypothetical protein DESPIG_01172 [Desulfovibrio piger ATCC 29098]
          Length = 168

 Score = 47.5 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/106 (16%), Positives = 43/106 (40%), Gaps = 7/106 (6%)

Query: 27  NHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVP-----IRKSIENGCLYC 81
             ++  A+  + +  V + +++V      +    P++ +            +I +  + C
Sbjct: 40  KRLMEQAEPVAPVKPVAAPVKQVALIPEIEKKPVPQKKQYTQADLKFAPATAITDKSITC 99

Query: 82  LEDGMQFKSLK-RHLKTHHNMTPDEYRIKWNLASDYPMVSREYATT 126
              G Q  +L  RHL  HH ++ ++Y+          +++REY   
Sbjct: 100 CLCGKQALTLTARHL-AHHEISVEDYKKLCGYEPTQKLMAREYLAK 144


>gi|308456807|ref|XP_003090820.1| hypothetical protein CRE_22722 [Caenorhabditis remanei]
 gi|308260388|gb|EFP04341.1| hypothetical protein CRE_22722 [Caenorhabditis remanei]
          Length = 580

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 81  CLEDGMQFKS---LKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG-L 136
           C +    F++   +KRH  + H+M+  + + +  +  DY MV       R +  + M   
Sbjct: 38  CKKCAKSFRTAKEVKRHFWSEHSMSSADNKSR--MKVDYEMVKPS-TKQRKEEVRKMKEE 94

Query: 137 GRGRKKRVLT 146
           GR R+ +   
Sbjct: 95  GRKRRAKEEA 104


>gi|326445186|ref|ZP_08219920.1| hypothetical protein SclaA2_29167 [Streptomyces clavuligerus ATCC
           27064]
          Length = 249

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 5/63 (7%)

Query: 79  LYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS----REYATTR-SKLAKN 133
           + CL  G +F+SL  HL   H+ T  EYR +  LA+   +++       +  R S +A +
Sbjct: 85  VTCLSCGRRFRSLGPHLARAHHTTAAEYRAEHRLAATTALMATDVRTALSRARTSAMADD 144

Query: 134 MGL 136
             L
Sbjct: 145 PSL 147


>gi|85084471|ref|XP_957313.1| hypothetical protein NCU06422 [Neurospora crassa OR74A]
 gi|28918403|gb|EAA28077.1| predicted protein [Neurospora crassa OR74A]
          Length = 562

 Score = 44.4 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 51  SRAPCQDNVQPERLKP-AVPIRKSIENGCLYCLEDGMQFK---SLKRHLKTHHNMTPDEY 106
           +R    D  +PE +KP A  I++  +     C+  G +F+    L RHL T  +  P EY
Sbjct: 479 AREESSDATEPELVKPDAERIKRVKKELKTICMVCGEKFQHFGQLFRHLNTERHRMPKEY 538

Query: 107 RIKWN 111
              W 
Sbjct: 539 ---WG 540


>gi|239908335|ref|YP_002955076.1| hypothetical protein DMR_36990 [Desulfovibrio magneticus RS-1]
 gi|239798201|dbj|BAH77190.1| hypothetical protein [Desulfovibrio magneticus RS-1]
          Length = 408

 Score = 44.0 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 15/66 (22%), Positives = 26/66 (39%), Gaps = 4/66 (6%)

Query: 69  PIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRS 128
               +I   C+ CLE G  F  +       H +T + Y  K+   S   +    +A  + 
Sbjct: 341 QPESAIGFDCVACLECGKIFSEITNSHLRKHELTRETYLEKYKCGSRKIL----FAEKKR 396

Query: 129 KLAKNM 134
            L+K+ 
Sbjct: 397 ALSKSR 402


>gi|239502673|ref|ZP_04661983.1| putative porphyrin biosynthetic protein [Acinetobacter baumannii
           AB900]
          Length = 414

 Score = 42.5 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 35/78 (44%), Gaps = 11/78 (14%)

Query: 74  IENGCLYCLEDGMQFKSLKRHLKTHH-NMTPDEYRIKWNLASDYPMVSREYATTRS---- 128
           + N  + C   G +   + +HLK  H   T +EY+ ++    D P++S   A  +     
Sbjct: 1   MSNDPIICEICGGKTHVIAKHLKEKHPETTYEEYKEQY---PDSPLLSP-LAQKKMQEQA 56

Query: 129 --KLAKNMGLGRGRKKRV 144
             K AK   L + ++++ 
Sbjct: 57  ELKRAKEAELAKAQQEKA 74


>gi|327281862|ref|XP_003225664.1| PREDICTED: zinc finger protein 84-like [Anolis carolinensis]
          Length = 645

 Score = 42.1 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 3/27 (11%)

Query: 80  YCLEDGMQF---KSLKRHLKTHHNMTP 103
            CLE G  F   K L RHL TH    P
Sbjct: 198 ICLECGKSFTLKKYLTRHLATHTGEKP 224



 Score = 36.3 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 12/28 (42%), Positives = 14/28 (50%), Gaps = 3/28 (10%)

Query: 81  CLEDGMQFK---SLKRHLKTHHNMTPDE 105
           CLE G  F    +L RH+ TH    P E
Sbjct: 535 CLECGKSFSQKITLNRHITTHTGEKPFE 562



 Score = 35.9 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 12/26 (46%), Gaps = 3/26 (11%)

Query: 81  CLEDGMQFKS---LKRHLKTHHNMTP 103
           CLE G  F     L RHL TH    P
Sbjct: 283 CLECGKTFAQKAGLSRHLATHTGEKP 308


>gi|189519248|ref|XP_001921563.1| PREDICTED: hypothetical protein LOC327438 [Danio rerio]
          Length = 573

 Score = 42.1 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 27/70 (38%), Gaps = 16/70 (22%)

Query: 45  ALQRVVSRAPCQDNVQPERLKPAVPIRKSIEN--------GCLYCLEDGMQFK---SLKR 93
            L     R+P      PE      PIR+SI              CLE G  F+   SLK+
Sbjct: 354 GLGMSTRRSPGVGGSSPEE-----PIRRSISELMGEAPGERPHLCLECGKTFRLISSLKK 408

Query: 94  HLKTHHNMTP 103
           HL+ H    P
Sbjct: 409 HLRIHTGEKP 418


>gi|220915026|ref|YP_002490334.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
 gi|219952777|gb|ACL63167.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 56

 Score = 41.7 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 19/45 (42%), Positives = 24/45 (53%)

Query: 102 TPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKKRVLT 146
           +P+ YR KW L   Y M +  YA  RS+LAK  GLGR    +   
Sbjct: 12  SPERYREKWGLPLAYLMAAAAYAAQRSELAKLHGLGRRAAAKTAA 56


>gi|327281860|ref|XP_003225663.1| PREDICTED: zinc finger protein 84-like [Anolis carolinensis]
          Length = 858

 Score = 41.7 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 3/27 (11%)

Query: 80  YCLEDGMQF---KSLKRHLKTHHNMTP 103
            CLE G  F   K+L RHL TH    P
Sbjct: 299 ICLECGKTFAVKKNLTRHLATHTGEKP 325



 Score = 37.5 bits (86), Expect = 0.68,   Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 3/26 (11%)

Query: 81  CLEDGMQF--KS-LKRHLKTHHNMTP 103
           CLE G  F  K+ L RHL TH    P
Sbjct: 384 CLECGKTFSQKTGLSRHLATHTGEKP 409


>gi|9623258|gb|AAF90083.1| zinc finger protein Zfy [Leopardus colocolo]
          Length = 384

 Score = 41.3 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRHL+ H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHLENHPEHLTKKKYR 45


>gi|313117470|ref|YP_004044453.1| ROS/MUCR transcriptional regulator protein [Halogeometricum
           borinquense DSM 11551]
 gi|312294361|gb|ADQ68792.1| ROS/MUCR transcriptional regulator protein [Halogeometricum
           borinquense DSM 11551]
          Length = 79

 Score = 41.3 bits (96), Expect = 0.050,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 4/44 (9%)

Query: 76  NGCLYCLEDGMQFKSLKR-HLKTHHNMTPDEYRIKWNLASDYPM 118
            G + CL  G  ++++   HL+T H+MT  EYR ++    D P+
Sbjct: 33  EGMIQCLVCGEYYQAITEPHLQT-HDMTIQEYREEYG--EDMPL 73


>gi|329664398|ref|NP_001192643.1| zinc finger protein 449 [Bos taurus]
 gi|297492483|ref|XP_002699610.1| PREDICTED: zinc finger protein 197-like [Bos taurus]
 gi|296471248|gb|DAA13363.1| zinc finger protein 197-like [Bos taurus]
          Length = 519

 Score = 41.0 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 410 CLECGKSFCHGSSLKRHLKTHSGEKPH 436


>gi|194044179|ref|XP_001927064.1| PREDICTED: zinc finger protein 42 homolog [Sus scrofa]
          Length = 294

 Score = 41.0 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 32/99 (32%), Gaps = 17/99 (17%)

Query: 22  AAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPA-----------VPI 70
           + YV    +P   I S       AL       P ++   PE++                +
Sbjct: 134 SEYVPGKKLPPGKIPSTDFSDPEALTECARTKPSKNKSAPEKIVCPESGCTREFISRASL 193

Query: 71  RK--SI-ENGCLYCLEDGMQFK---SLKRHLKTHHNMTP 103
           RK  S+       C E G  FK    LKRH   H    P
Sbjct: 194 RKHLSVHSPRDHVCAECGKAFKESAKLKRHFLVHTGEKP 232


>gi|149755753|ref|XP_001491017.1| PREDICTED: similar to Zinc finger protein 449 (Zinc finger and SCAN
           domain-containing protein 19) [Equus caballus]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHSGEKPH 435


>gi|125490349|ref|NP_001074958.1| zinc finger protein 449 [Pan troglodytes]
 gi|146328570|sp|A2T6W2|ZN449_PANTR RecName: Full=Zinc finger protein 449
 gi|124111086|gb|ABM91917.1| ZNF449 [Pan troglodytes]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|297711106|ref|XP_002832194.1| PREDICTED: zinc finger protein 449-like isoform 1 [Pongo abelii]
 gi|297711108|ref|XP_002832195.1| PREDICTED: zinc finger protein 449-like isoform 2 [Pongo abelii]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|190689791|gb|ACE86670.1| zinc finger protein 449 protein [synthetic construct]
 gi|190691159|gb|ACE87354.1| zinc finger protein 449 protein [synthetic construct]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|189067276|dbj|BAG36986.1| unnamed protein product [Homo sapiens]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|121503136|gb|ABM55114.1| ZNF449 [Macaca mulatta]
          Length = 170

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 61  CLECGKSFCHGSSLKRHLKTHTGEKPH 87


>gi|146328569|sp|A1YFW6|ZN449_PANPA RecName: Full=Zinc finger protein 449
 gi|121483799|gb|ABM54191.1| ZNF449 [Pan paniscus]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|146328568|sp|A1YEQ3|ZN449_GORGO RecName: Full=Zinc finger protein 449
 gi|120974030|gb|ABM46621.1| ZNF449 [Gorilla gorilla]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|109514250|ref|XP_001072386.1| PREDICTED: zinc finger protein 37 homolog [Rattus norvegicus]
 gi|149027048|gb|EDL82812.1| rCG44245 [Rattus norvegicus]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|109132425|ref|XP_001099897.1| PREDICTED: zinc finger protein 449-like isoform 1 [Macaca mulatta]
 gi|297304850|ref|XP_002806450.1| PREDICTED: zinc finger protein 449-like isoform 2 [Macaca mulatta]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|31874447|emb|CAD97794.1| hypothetical protein [Homo sapiens]
          Length = 324

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 215 CLECGKSFCHGSSLKRHLKTHTGEKPH 241


>gi|194239638|ref|NP_689908.3| zinc finger protein 449 [Homo sapiens]
 gi|92090580|sp|Q6P9G9|ZN449_HUMAN RecName: Full=Zinc finger protein 449; AltName: Full=Zinc finger
           and SCAN domain-containing protein 19
 gi|38174496|gb|AAH60768.1| Zinc finger protein 449 [Homo sapiens]
 gi|57162488|emb|CAI39873.1| zinc finger protein 449 [Homo sapiens]
 gi|119632133|gb|EAX11728.1| zinc finger protein 449 [Homo sapiens]
 gi|167773555|gb|ABZ92212.1| zinc finger protein 449 [synthetic construct]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|21734046|emb|CAD38639.1| hypothetical protein [Homo sapiens]
 gi|33355912|gb|AAQ16305.1| zinc finger protein 449 [Homo sapiens]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|332246901|ref|XP_003272593.1| PREDICTED: zinc finger protein 449 [Nomascus leucogenys]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|296236481|ref|XP_002763345.1| PREDICTED: zinc finger protein 449 isoform 1 [Callithrix jacchus]
 gi|296236483|ref|XP_002763346.1| PREDICTED: zinc finger protein 449 isoform 2 [Callithrix jacchus]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.055,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|301789794|ref|XP_002930312.1| PREDICTED: zinc finger protein 449-like [Ailuropoda melanoleuca]
 gi|281347871|gb|EFB23455.1| hypothetical protein PANDA_020713 [Ailuropoda melanoleuca]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.056,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHSGEKPH 435


>gi|332853074|ref|XP_003316173.1| PREDICTED: zinc finger protein 136 [Pan troglodytes]
          Length = 540

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 81  CLEDGMQFKSLKR---HLKTHHNMTPDEYRIK-WNLASDYP 117
           C E G  F SLKR   H+ TH   TP  Y+ K    A DYP
Sbjct: 170 CKECGKTFFSLKRIRRHIITHSGYTP--YKCKVCGKAFDYP 208


>gi|332253391|ref|XP_003275826.1| PREDICTED: zinc finger protein 136 isoform 2 [Nomascus leucogenys]
          Length = 474

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 81  CLEDGMQFKSLKR---HLKTHHNMTPDEYRIK-WNLASDYP 117
           C E G  F SLKR   H+ TH   TP  Y+ K    A DYP
Sbjct: 104 CKECGKTFFSLKRIRRHIITHSGYTP--YKCKVCGKAFDYP 142


>gi|332253389|ref|XP_003275825.1| PREDICTED: zinc finger protein 136 isoform 1 [Nomascus leucogenys]
          Length = 540

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 81  CLEDGMQFKSLKR---HLKTHHNMTPDEYRIK-WNLASDYP 117
           C E G  F SLKR   H+ TH   TP  Y+ K    A DYP
Sbjct: 170 CKECGKTFFSLKRIRRHIITHSGYTP--YKCKVCGKAFDYP 208


>gi|297276203|ref|XP_002801132.1| PREDICTED: zinc finger protein 136-like [Macaca mulatta]
          Length = 452

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 81  CLEDGMQFKSLKR---HLKTHHNMTPDEYRIK-WNLASDYP 117
           C E G  F SLKR   H+ TH   TP  Y+ K    A DYP
Sbjct: 170 CKECGKTFFSLKRIRRHIITHSGYTP--YKCKVCGKAFDYP 208


>gi|296232991|ref|XP_002761850.1| PREDICTED: zinc finger protein 136 [Callithrix jacchus]
          Length = 595

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 81  CLEDGMQFKSLKR---HLKTHHNMTPDEYRIK-WNLASDYP 117
           C E G  F SLKR   H+ TH   TP  Y+ K    A DYP
Sbjct: 225 CKECGKTFFSLKRIRRHIITHSGYTP--YKCKVCGKAFDYP 263


>gi|194389030|dbj|BAG61532.1| unnamed protein product [Homo sapiens]
          Length = 474

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 81  CLEDGMQFKSLKR---HLKTHHNMTPDEYRIK-WNLASDYP 117
           C E G  F SLKR   H+ TH   TP  Y+ K    A DYP
Sbjct: 104 CKECGKTFFSLKRIRRHIITHSGYTP--YKCKVCGKAFDYP 142


>gi|158255920|dbj|BAF83931.1| unnamed protein product [Homo sapiens]
          Length = 540

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 81  CLEDGMQFKSLKR---HLKTHHNMTPDEYRIK-WNLASDYP 117
           C E G  F SLKR   H+ TH   TP  Y+ K    A DYP
Sbjct: 170 CKECGKTFFSLKRIRRHIITHSGYTP--YKCKVCGKAFDYP 208


>gi|310132642|ref|XP_002347961.2| PREDICTED: zinc finger protein 136-like [Homo sapiens]
 gi|119604670|gb|EAW84264.1| hCG1818459 [Homo sapiens]
          Length = 400

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 81  CLEDGMQFKSLKR---HLKTHHNMTPDEYRIK-WNLASDYP 117
           C E G  F SLKR   H+ TH   TP  Y+ K    A DYP
Sbjct: 170 CKECGKTFFSLKRIRRHIITHSGYTP--YKCKVCGKAFDYP 208


>gi|197099016|ref|NP_001124834.1| zinc finger protein 136 [Pongo abelii]
 gi|75070953|sp|Q5REK1|ZN136_PONAB RecName: Full=Zinc finger protein 136
 gi|55726061|emb|CAH89806.1| hypothetical protein [Pongo abelii]
          Length = 540

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 81  CLEDGMQFKSLKR---HLKTHHNMTPDEYRIK-WNLASDYP 117
           C E G  F SLKR   H+ TH   TP  Y+ K    A DYP
Sbjct: 170 CKECGKTFFSLKRIRRHIITHSGYTP--YKCKVCGKAFDYP 208


>gi|4507987|ref|NP_003428.1| zinc finger protein 136 [Homo sapiens]
 gi|1731412|sp|P52737|ZN136_HUMAN RecName: Full=Zinc finger protein 136
 gi|487785|gb|AAC50261.1| zinc finger protein ZNF136 [Homo sapiens]
 gi|13623607|gb|AAH06421.1| Zinc finger protein 136 [Homo sapiens]
 gi|208968097|dbj|BAG73887.1| zinc finger protein 136 [synthetic construct]
 gi|325463303|gb|ADZ15422.1| zinc finger protein 136 [synthetic construct]
 gi|1582216|prf||2118244B ZNF136 protein
          Length = 540

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 81  CLEDGMQFKSLKR---HLKTHHNMTPDEYRIK-WNLASDYP 117
           C E G  F SLKR   H+ TH   TP  Y+ K    A DYP
Sbjct: 170 CKECGKTFFSLKRIRRHIITHSGYTP--YKCKVCGKAFDYP 208


>gi|57112793|ref|XP_549280.1| PREDICTED: similar to zinc finger protein 449 [Canis familiaris]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHSGEKPH 435


>gi|291408275|ref|XP_002720366.1| PREDICTED: zinc finger protein 449 [Oryctolagus cuniculus]
          Length = 518

 Score = 41.0 bits (95), Expect = 0.062,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKSFCHGSSLKRHLKTHTGEKPH 435


>gi|124013502|gb|ABM87994.1| ZNF449 [Macaca nemestrina]
          Length = 290

 Score = 41.0 bits (95), Expect = 0.063,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 181 CLECGKSFCHGSSLKRHLKTHTGEKPH 207


>gi|224042673|ref|XP_002195536.1| PREDICTED: zinc finger protein, X-linked [Taeniopygia guttata]
          Length = 794

 Score = 40.6 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 5/32 (15%)

Query: 81  CLEDGMQFKS---LKRHLKTH--HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  H +T  +YR
Sbjct: 415 CMICGKKFKSRGFLKRHMKNHPEHLLTKKKYR 446


>gi|118083994|ref|XP_416795.2| PREDICTED: similar to Zinc finger X-chromosomal protein [Gallus
           gallus]
          Length = 794

 Score = 40.6 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 5/32 (15%)

Query: 81  CLEDGMQFKS---LKRHLKTH--HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  H +T  +YR
Sbjct: 415 CMICGKKFKSRGFLKRHMKNHPEHLLTKKKYR 446


>gi|122934842|gb|ABM68159.1| ZNF449 [Lagothrix lagotricha]
          Length = 287

 Score = 40.6 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 178 CLECGKSFCHGSSLKRHLKTHTGEKPH 204


>gi|62416|emb|CAA43883.1| Azf-1 [Alligator mississippiensis]
          Length = 395

 Score = 40.6 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 5/32 (15%)

Query: 81  CLEDGMQFKS---LKRHLKTH--HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  H +T  +YR
Sbjct: 16  CMICGKKFKSRGFLKRHMKNHPEHLLTKKKYR 47


>gi|122938166|gb|ABM68937.1| ZNF449 [Lemur catta]
          Length = 215

 Score = 40.6 bits (94), Expect = 0.074,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 178 CLECGKSFCHGSSLKRHLKTHTGEKPH 204


>gi|149882849|ref|YP_001294826.1| hypothetical protein MPMin1_gp68 [Microbacterium phage Min1]
 gi|148763480|gb|ABR10498.1| hypothetical protein [Microbacterium phage Min1]
          Length = 188

 Score = 40.6 bits (94), Expect = 0.080,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 19/50 (38%)

Query: 80  YCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129
            C   G     L  H +  H +T  EYR ++ L +   +VS   +     
Sbjct: 27  LCHVCGDARDQLATHARQTHGITAAEYRDRYGLGATTRLVSTAASARMRA 76


>gi|122053816|gb|ABM65887.1| ZNF449 [Ateles geoffroyi]
          Length = 216

 Score = 40.6 bits (94), Expect = 0.082,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 179 CLECGKSFCHGSSLKRHLKTHTGEKPH 205


>gi|30794208|ref|NP_084415.1| zinc finger protein 449 [Mus musculus]
 gi|26331538|dbj|BAC29499.1| unnamed protein product [Mus musculus]
 gi|52221219|gb|AAH82594.1| Zinc finger protein 449 [Mus musculus]
 gi|123234129|emb|CAM23440.1| zinc finger protein 449 [Mus musculus]
 gi|148710196|gb|EDL42142.1| zinc finger protein 449 [Mus musculus]
 gi|148877692|gb|AAI45937.1| Zinc finger protein 449 [Mus musculus]
 gi|148877931|gb|AAI45939.1| Zinc finger protein 449 [Mus musculus]
          Length = 518

 Score = 40.6 bits (94), Expect = 0.082,   Method: Composition-based stats.
 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPD 104
           CLE G  F    SLKRHLKTH    P 
Sbjct: 409 CLECGKTFCHGSSLKRHLKTHTGEKPH 435


>gi|321461279|gb|EFX72313.1| hypothetical protein DAPPUDRAFT_216151 [Daphnia pulex]
          Length = 381

 Score = 40.2 bits (93), Expect = 0.088,   Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 14/27 (51%), Gaps = 3/27 (11%)

Query: 80  YCLEDGMQFKS---LKRHLKTHHNMTP 103
            C E G  FK    LKRHL  H+ + P
Sbjct: 47  ICPECGKVFKKPEYLKRHLTFHNGLKP 73


>gi|301629290|ref|XP_002943776.1| PREDICTED: oocyte zinc finger protein XlCOF6-like [Xenopus
           (Silurana) tropicalis]
          Length = 577

 Score = 40.2 bits (93), Expect = 0.096,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 10/42 (23%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTP-------DEYRIKWNL 112
           C E G  F   KSL+RHL  H    P         YR K +L
Sbjct: 516 CTECGKHFYDNKSLRRHLMVHTGEKPFVCTECGKRYRDKCSL 557


>gi|297464720|ref|XP_001788443.2| PREDICTED: zinc finger protein 300-like [Bos taurus]
 gi|297491415|ref|XP_002698863.1| PREDICTED: zinc finger protein 300-like [Bos taurus]
 gi|296472210|gb|DAA14325.1| zinc finger protein 300-like [Bos taurus]
          Length = 496

 Score = 40.2 bits (93), Expect = 0.098,   Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 81  CLEDGMQFK---SLKRHLKTHHNMTPDEY 106
           C E G  F    +L +HL+TH    P EY
Sbjct: 398 CSECGKSFSEKSTLTKHLRTHTGEKPYEY 426


>gi|111224395|ref|YP_715189.1| caffeoyl O-methyltransferase [Frankia alni ACN14a]
 gi|111151927|emb|CAJ63649.1| caffeoyl O-methyltransferase (partial match) [Frankia alni ACN14a]
          Length = 271

 Score = 40.2 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/100 (18%), Positives = 39/100 (39%), Gaps = 18/100 (18%)

Query: 21  VAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSI------ 74
           +AAY++ H  P  ++   ++ V +AL     + P +       L  A+  R+++      
Sbjct: 59  IAAYLTEHSSPPDEVLDDLSAVTAALPEAEMQVPAEQGTLLTILTAAIAPRRAVEVGTFT 118

Query: 75  ------------ENGCLYCLEDGMQFKSLKRHLKTHHNMT 102
                        +G L CL+   ++ ++ R       +T
Sbjct: 119 GYSALCIARGLPTDGRLLCLDVSEEWTTIARKHWARAGVT 158


>gi|26325460|dbj|BAC26484.1| unnamed protein product [Mus musculus]
          Length = 742

 Score = 39.8 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLY-CLEDGMQFKS---LKRHLKTH 98
            + L R+  + P +      + + A+ I        +Y C+  G +FKS   LKRH+K H
Sbjct: 325 SAGLGRLAKQKPKKRRPDSRQYQTAIIIGPDGHPLTVYPCMICGKKFKSRGFLKRHMKNH 384

Query: 99  -HNMTPDEYR 107
             ++   +YR
Sbjct: 385 PEHLAKKKYR 394


>gi|141626|sp|P23607|ZFA_MOUSE RecName: Full=Zinc finger autosomal protein
 gi|55469|emb|CAA37338.1| Zfa [Mus musculus]
 gi|151556692|gb|AAI48595.1| Zinc finger protein, autosomal [synthetic construct]
 gi|157170124|gb|AAI53159.1| Zinc finger protein, autosomal [synthetic construct]
          Length = 742

 Score = 39.8 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 33/70 (47%), Gaps = 5/70 (7%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLY-CLEDGMQFKS---LKRHLKTH 98
            + L R+  + P +      + + A+ I        +Y C+  G +FKS   LKRH+K H
Sbjct: 325 SAGLGRLAKQKPKKRRPDSRQYQTAIIIGPDGHPLTVYPCMICGKKFKSRGFLKRHMKNH 384

Query: 99  -HNMTPDEYR 107
             ++   +YR
Sbjct: 385 PEHLAKKKYR 394


>gi|327266588|ref|XP_003218086.1| PREDICTED: zinc finger protein 167-like [Anolis carolinensis]
          Length = 705

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 19/40 (47%), Gaps = 4/40 (10%)

Query: 71  RKSIENGCLY-CLEDGMQFKS---LKRHLKTHHNMTPDEY 106
           R+S     LY CL+ G  F S   L RH   HH   P EY
Sbjct: 382 RQSQTGEKLYGCLDCGKSFSSKNCLFRHHNIHHGEKPHEY 421


>gi|311276054|ref|XP_003135029.1| PREDICTED: zinc finger X-chromosomal protein [Sus scrofa]
          Length = 800

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 382 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 438

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 439 MKNHPEHLTKKKYR 452


>gi|301784334|ref|XP_002927582.1| PREDICTED: zinc finger X-chromosomal protein-like [Ailuropoda
           melanoleuca]
          Length = 800

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 382 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 438

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 439 MKNHPEHLTKKKYR 452


>gi|291407241|ref|XP_002720030.1| PREDICTED: Zinc finger X-chromosomal protein-like isoform 3
           [Oryctolagus cuniculus]
          Length = 747

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 329 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 385

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 386 MKNHPEHLTKKKYR 399


>gi|291407239|ref|XP_002720029.1| PREDICTED: Zinc finger X-chromosomal protein-like isoform 2
           [Oryctolagus cuniculus]
          Length = 723

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 305 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 361

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 362 MKNHPEHLTKKKYR 375


>gi|291407237|ref|XP_002720028.1| PREDICTED: Zinc finger X-chromosomal protein-like isoform 1
           [Oryctolagus cuniculus]
          Length = 798

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 380 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 436

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 437 MKNHPEHLTKKKYR 450


>gi|281349402|gb|EFB24986.1| hypothetical protein PANDA_017361 [Ailuropoda melanoleuca]
          Length = 780

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 362 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 418

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 419 MKNHPEHLTKKKYR 432


>gi|194227739|ref|XP_001916379.1| PREDICTED: similar to Zinc finger X-chromosomal protein [Equus
           caballus]
          Length = 800

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 382 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 438

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 439 MKNHPEHLTKKKYR 452


>gi|126325555|ref|XP_001362448.1| PREDICTED: similar to Zinc finger X-chromosomal protein
           [Monodelphis domestica]
          Length = 794

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 376 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 432

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 433 MKNHPEHLTKKKYR 446


>gi|115502479|sp|O62836|ZFX_BOVIN RecName: Full=Zinc finger X-chromosomal protein
          Length = 800

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 382 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 438

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 439 MKNHPEHLTKKKYR 452


>gi|16416471|gb|AAL18260.1|AF032866_1 X-linked zinc finger protein [Bos taurus]
          Length = 800

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 382 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 438

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 439 MKNHPEHLTKKKYR 452


>gi|74006622|ref|XP_859644.1| PREDICTED: similar to Zinc finger X-chromosomal protein isoform 4
           [Canis familiaris]
          Length = 792

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 374 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 430

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 431 MKNHPEHLTKKKYR 444


>gi|74006620|ref|XP_859614.1| PREDICTED: similar to Zinc finger X-chromosomal protein isoform 3
           [Canis familiaris]
          Length = 750

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 332 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 388

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 389 MKNHPEHLTKKKYR 402


>gi|74006616|ref|XP_548898.2| PREDICTED: similar to Zinc finger X-chromosomal protein isoform 1
           [Canis familiaris]
          Length = 800

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 382 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 438

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 439 MKNHPEHLTKKKYR 452


>gi|74006624|ref|XP_859673.1| PREDICTED: similar to Zinc finger X-chromosomal protein isoform 5
           [Canis familiaris]
          Length = 769

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 351 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 407

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 408 MKNHPEHLTKKKYR 421


>gi|41386733|ref|NP_803456.1| zinc finger X-chromosomal protein [Bos taurus]
 gi|3142141|dbj|BAA28278.1| Zfx [Bos taurus]
 gi|296470523|gb|DAA12638.1| zinc finger X-chromosomal protein [Bos taurus]
          Length = 800

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 382 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 438

Query: 95  LKTH-HNMTPDEYR 107
           +K H  ++T  +YR
Sbjct: 439 MKNHPEHLTKKKYR 452


>gi|220927344|ref|YP_002502646.1| MucR family transcriptional regulator [Methylobacterium nodulans
           ORS 2060]
 gi|219951951|gb|ACL62343.1| transcriptional regulator, MucR family [Methylobacterium nodulans
           ORS 2060]
          Length = 61

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 18/22 (81%)

Query: 118 MVSREYATTRSKLAKNMGLGRG 139
           MV+  YA  RS+LAK++GLG+G
Sbjct: 1   MVAANYAAQRSELAKSIGLGQG 22


>gi|296470524|gb|DAA12639.1| zinc finger Y-chromosomal protein [Bos taurus]
          Length = 800

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 423 CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 453


>gi|166210370|gb|ABC67505.2| Y-linked zinc finger protein [Bubalus bubalis]
          Length = 152

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|166210360|gb|ABC67496.2| Y-linked zinc finger protein [Bos taurus]
 gi|166210362|gb|ABC67498.2| Y-linked zinc finger protein [Bos javanicus]
 gi|166210364|gb|ABC67499.2| Y-linked zinc finger protein [Bos gaurus]
 gi|166210366|gb|ABC67503.2| Y-linked zinc finger protein [Bison bonasus]
          Length = 152

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|161598425|gb|ABX74956.1| ZFX [Diceros bicornis michaeli]
          Length = 201

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 8   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 38


>gi|84872904|gb|ABC67497.1| Y-linked zinc finger protein [Bos indicus]
 gi|84872910|gb|ABC67500.1| Y-linked zinc finger protein [Bos frontalis]
 gi|84872912|gb|ABC67501.1| Y-linked zinc finger protein [Bos grunniens]
 gi|84872914|gb|ABC67502.1| Y-linked zinc finger protein [Bison bison]
          Length = 159

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|51318106|gb|AAU00121.1| zinc finger protein [Ovis aries]
          Length = 51

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|29135277|ref|NP_803457.1| zinc finger Y-chromosomal protein [Bos taurus]
 gi|75073824|sp|Q95LI3|ZFY_BOVIN RecName: Full=Zinc finger Y-chromosomal protein
 gi|16416473|gb|AAL18261.1|AF032867_1 Y-linked zinc finger protein [Bos taurus]
          Length = 801

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 423 CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 453


>gi|17933059|gb|AAL48189.1| Y-linked zinc finger protein [Bos taurus]
          Length = 208

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|13991125|gb|AAK51213.1|AF260793_1 zinc finger protein [Kogia breviceps]
          Length = 201

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 8   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 38


>gi|9623242|gb|AAF90075.1| zinc finger protein Zfx [Puma concolor]
          Length = 393

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|74006626|ref|XP_859705.1| PREDICTED: similar to Zinc finger X-chromosomal protein isoform 6
           [Canis familiaris]
          Length = 753

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 375 CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 405


>gi|112379645|gb|ABI16633.1| zinc finger protein [Lobodon carcinophaga]
 gi|112379647|gb|ABI16634.1| zinc finger protein [Ommatophoca rossii]
 gi|112379649|gb|ABI16635.1| zinc finger protein [Leptonychotes weddellii]
          Length = 48

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|9623208|gb|AAF90058.1| zinc finger protein Zfx [Leopardus tigrinus]
          Length = 393

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|9623250|gb|AAF90079.1| zinc finger protein Zfx [Caracal caracal]
          Length = 393

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|9623222|gb|AAF90065.1| zinc finger protein Zfx [Prionailurus viverrinus]
          Length = 393

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|9623220|gb|AAF90064.1| zinc finger protein Zfx [Prionailurus bengalensis]
          Length = 389

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|13991105|gb|AAK51203.1|AF260783_1 zinc finger protein [Balaena mysticetus]
 gi|13991107|gb|AAK51204.1|AF260784_1 zinc finger protein [Balaena mysticetus]
 gi|13991109|gb|AAK51205.1|AF260785_1 zinc finger protein [Balaena mysticetus]
 gi|13991111|gb|AAK51206.1|AF260786_1 zinc finger protein [Delphinapterus leucas]
 gi|13991115|gb|AAK51208.1|AF260788_1 zinc finger protein [Delphinapterus leucas]
 gi|13991117|gb|AAK51209.1|AF260789_1 zinc finger protein [Eschrichtius robustus]
 gi|13991119|gb|AAK51210.1|AF260790_1 zinc finger protein [Eschrichtius robustus]
 gi|13991123|gb|AAK51212.1|AF260792_1 zinc finger protein [Kogia breviceps]
 gi|13991129|gb|AAK51215.1|AF260795_1 zinc finger protein [Kogia sima]
 gi|13991133|gb|AAK51217.1|AF260797_1 zinc finger protein [Kogia sima]
 gi|13991135|gb|AAK51218.1|AF260798_1 zinc finger protein [Neophocaena phocaenoides]
 gi|13991139|gb|AAK51220.1|AF260800_1 zinc finger protein [Neophocaena phocaenoides]
 gi|13991141|gb|AAK51221.1|AF260801_1 zinc finger protein [Physeter catodon]
 gi|13991143|gb|AAK51222.1|AF260802_1 zinc finger protein [Physeter catodon]
 gi|13991147|gb|AAK51224.1|AF260804_1 zinc finger protein [Phocoena phocoena]
 gi|13991149|gb|AAK51225.1|AF260805_1 zinc finger protein [Phocoena phocoena]
 gi|13991153|gb|AAK51227.1|AF260807_1 zinc finger protein [Stenella longirostris]
 gi|13991155|gb|AAK51228.1|AF260808_1 zinc finger protein [Stenella longirostris]
 gi|13991159|gb|AAK51230.1|AF260810_1 zinc finger protein [Stenella longirostris orientalis]
 gi|13991163|gb|AAK51232.1|AF260812_1 zinc finger protein [Stenella longirostris orientalis]
 gi|161598427|gb|ABX74957.1| ZFY [Diceros bicornis michaeli]
          Length = 201

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 8   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 38


>gi|9623224|gb|AAF90066.1| zinc finger protein Zfx [Neofelis nebulosa]
          Length = 393

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|254072154|gb|ACT64777.1| ZFY protein [Bubalus carabanensis]
          Length = 390

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|9623204|gb|AAF90056.1| zinc finger protein Zfx [Leopardus colocolo]
          Length = 393

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|112379653|gb|ABI16637.1| zinc finger protein [Mirounga angustirostris]
          Length = 46

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|9623236|gb|AAF90072.1| zinc finger protein Zfx [Profelis aurata]
          Length = 393

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|9623218|gb|AAF90063.1| zinc finger protein Zfx [Prionailurus planiceps]
          Length = 393

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45



 Score = 36.3 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 18/36 (50%), Gaps = 8/36 (22%)

Query: 80  YCLEDGMQFK---SLKRHLKTHHNMTPD-----EYR 107
            C+E G  F+    LK+H++ H  + P      EYR
Sbjct: 137 ICVECGKGFRHPSELKKHMRIHTGVKPYQCQYCEYR 172


>gi|13991121|gb|AAK51211.1|AF260791_1 zinc finger protein [Eschrichtius robustus]
          Length = 201

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 8   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 38


>gi|9623206|gb|AAF90057.1| zinc finger protein Zfx [Leopardus pardalis]
 gi|9623210|gb|AAF90059.1| zinc finger protein Zfx [Leopardus wiedii]
 gi|9623216|gb|AAF90062.1| zinc finger protein Zfx [Lynx rufus]
 gi|9623226|gb|AAF90067.1| zinc finger protein Zfx [Panthera leo]
 gi|9623230|gb|AAF90069.1| zinc finger protein Zfx [Panthera pardus]
 gi|9623232|gb|AAF90070.1| zinc finger protein Zfx [Panthera tigris]
 gi|9623234|gb|AAF90071.1| zinc finger protein Zfx [Catopuma temminckii]
 gi|9623238|gb|AAF90073.1| zinc finger protein Zfx [Acinonyx jubatus]
 gi|9623240|gb|AAF90074.1| zinc finger protein Zfx [Herpailurus yaguarondi]
 gi|9623244|gb|AAF90076.1| zinc finger protein Zfx [Felis catus]
 gi|9623246|gb|AAF90077.1| zinc finger protein Zfx [Felis chaus]
 gi|9623248|gb|AAF90078.1| zinc finger protein Zfx [Felis silvestris]
 gi|9623252|gb|AAF90080.1| zinc finger protein Zfx [Leptailurus serval]
 gi|9623254|gb|AAF90081.1| zinc finger protein Zfx [Otocolobus manul]
 gi|9623256|gb|AAF90082.1| zinc finger protein Zfy [Otocolobus manul]
          Length = 393

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|260794553|ref|XP_002592273.1| hypothetical protein BRAFLDRAFT_207121 [Branchiostoma floridae]
 gi|229277489|gb|EEN48284.1| hypothetical protein BRAFLDRAFT_207121 [Branchiostoma floridae]
          Length = 334

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 5/30 (16%)

Query: 80  YCLEDGMQF---KSLKRHLKTHHNMTPDEY 106
            C+E G +F     LKRHL TH    P+ Y
Sbjct: 137 ICVECGAEFLSLAMLKRHLATHRG--PNSY 164


>gi|37543406|gb|AAM18771.1| ZFY protein [Capra aegagrus]
 gi|37543408|gb|AAM18772.1| ZFY protein [Capra hircus]
 gi|37543410|gb|AAM18773.1| ZFY protein [Capra cylindricornis]
 gi|37543412|gb|AAM18774.1| ZFY protein [Capra falconeri]
 gi|37543414|gb|AAM18775.1| ZFY protein [Capra falconeri]
 gi|37543416|gb|AAM18776.1| ZFY protein [Capra hircus]
 gi|37543418|gb|AAM18777.1| ZFY protein [Capra ibex ibex]
 gi|37543420|gb|AAM18778.1| ZFY protein [Capra nubiana]
 gi|37543422|gb|AAM18779.1| ZFY protein [Capra nubiana]
 gi|37543424|gb|AAM18780.1| ZFY protein [Capra nubiana]
 gi|37543426|gb|AAM18781.1| ZFY protein [Capra pyrenaica]
 gi|37543428|gb|AAM18782.1| ZFY protein [Capra sibirica]
 gi|37543430|gb|AAM18783.1| ZFY protein [Capra sibirica]
 gi|37543432|gb|AAM18784.1| ZFY protein [Capra sibirica]
 gi|37543434|gb|AAM18785.1| ZFY protein [Capra sibirica]
 gi|37543436|gb|AAM18786.1| ZFY protein [Hemitragus sp.]
 gi|37543438|gb|AAM18787.1| ZFY protein [Ovis aries]
          Length = 47

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|9623212|gb|AAF90060.1| zinc finger protein Zfx [Leopardus geoffroyi]
          Length = 393

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|9623260|gb|AAF90084.1| zinc finger protein Zfy [Leopardus pardalis]
 gi|9623266|gb|AAF90087.1| zinc finger protein Zfy [Leopardus geoffroyi]
          Length = 392

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|9623262|gb|AAF90085.1| zinc finger protein Zfy [Leopardus tigrinus]
          Length = 387

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|254072156|gb|ACT64778.1| ZFY protein [Bubalus bubalis]
          Length = 390

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|9623228|gb|AAF90068.1| zinc finger protein Zfx [Panthera onca]
          Length = 393

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|45387701|ref|NP_991207.1| insulinoma-associated 1a [Danio rerio]
 gi|41351454|gb|AAH65636.1| Insulinoma-associated 1a [Danio rerio]
          Length = 383

 Score = 39.4 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 51  SRAPCQDNVQPERLKPAVPIRKSIENGCLY-CLEDGMQFKS---LKRHLKTHHN 100
           + AP ++    +R  P+  + +S     LY C   G +FK    LK+H+  HH+
Sbjct: 242 TPAPEKEETSSDRDTPSPGLSESGSEDGLYDCQHCGKKFKRQAYLKKHVTAHHD 295


>gi|9623214|gb|AAF90061.1| zinc finger protein Zfx [Lynx lynx]
          Length = 393

 Score = 39.4 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|9623264|gb|AAF90086.1| zinc finger protein Zfy [Leopardus wiedii]
          Length = 392

 Score = 39.4 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|74027059|gb|AAZ94623.1| insulinoma-associated 1-like protein a [Danio rerio]
          Length = 383

 Score = 39.4 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 27/54 (50%), Gaps = 4/54 (7%)

Query: 51  SRAPCQDNVQPERLKPAVPIRKSIENGCLY-CLEDGMQFKS---LKRHLKTHHN 100
           + AP ++    +R  P+  + +S     LY C   G +FK    LK+H+  HH+
Sbjct: 242 TPAPEKEETSSDRDTPSPGLSESGSEDGLYDCQHCGKKFKRQAYLKKHVTAHHD 295


>gi|242240141|ref|YP_002988322.1| AraC family transcriptional regulator [Dickeya dadantii Ech703]
 gi|242132198|gb|ACS86500.1| transcriptional regulator, AraC family [Dickeya dadantii Ech703]
          Length = 331

 Score = 39.0 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 19/96 (19%), Positives = 33/96 (34%), Gaps = 20/96 (20%)

Query: 27  NHVVPMADIGSLI----TDVHSALQRVVSRAPCQ-------DNVQPERLKPAVPIRKSIE 75
           N  +   D+ S +      +H  L+ + + +P         +        PA  I++   
Sbjct: 239 NPSMTAEDLASALNFSDRTLHRKLKELTNESPKNFITRVRIETACMLLENPAASIKQ--- 295

Query: 76  NGCLYCLEDGMQFKS-LKRHLKTHHNMTPDEYRIKW 110
                  E G    +  +R       MTP +YR KW
Sbjct: 296 ----VAEECGYSEDTAFRRAFSQLMGMTPTQYR-KW 326


>gi|327278596|ref|XP_003224047.1| PREDICTED: sal-like protein 1-like [Anolis carolinensis]
          Length = 1332

 Score = 39.0 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 34/93 (36%), Gaps = 18/93 (19%)

Query: 26   SNHVVPMADIGSLITD-----VHSALQ-------RVVSRAPCQDNVQPERLKPAVPIRKS 73
            S+  +P   +  LI       VH + Q        +++  P   +     L PA+P R  
Sbjct: 1080 SSSAIPTISLPCLIKTEVNGFVHGSPQDSKETSPGLLASGPFPPSATSPVLLPALPRR-- 1137

Query: 74   IENGCLYCLEDGMQFKS---LKRHLKTHHNMTP 103
                  YC   G  F S   L+ H +TH    P
Sbjct: 1138 -TPKQHYCNACGKTFSSSSALQIHERTHTGEKP 1169


>gi|112379651|gb|ABI16636.1| zinc finger protein [Zalophus californianus]
          Length = 45

 Score = 39.0 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 15  CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 45


>gi|399836|sp|Q02228|GVPC_HALME RecName: Full=Gas vesicle protein C
 gi|58349|emb|CAA45944.1| gvpC [Haloferax mediterranei ATCC 33500]
 gi|447332|prf||1914181C gas vesicle protein
          Length = 381

 Score = 39.0 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 4/44 (9%)

Query: 76  NGCLYCLEDGMQFKSLKR-HLKTHHNMTPDEYRIKWNLASDYPM 118
              + CL  G  ++++   HL+T H+MT  +YR ++    D P+
Sbjct: 335 EDMVQCLVCGEYYQAITEPHLQT-HDMTIKKYREEYG--EDVPL 375


>gi|195396244|ref|XP_002056742.1| GJ10049 [Drosophila virilis]
 gi|194143451|gb|EDW59854.1| GJ10049 [Drosophila virilis]
          Length = 1284

 Score = 39.0 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 25/67 (37%), Gaps = 10/67 (14%)

Query: 49  VVSRAPCQDNVQPERLKPAVPIRKS-----IENGCL-YCLEDGMQFKS---LKRHLKTHH 99
           +   AP            A+P++ S     IE   +  C   G  +K+    +RH+   H
Sbjct: 759 LEEEAPAAPIAVTTAAT-ALPVKNSAGASTIEQNYIFLCPSCGKAYKTQFEWRRHINEEH 817

Query: 100 NMTPDEY 106
           N    +Y
Sbjct: 818 NFDKRQY 824


>gi|118374619|ref|XP_001020497.1| Zinc finger, C2H2 type family protein [Tetrahymena thermophila]
 gi|89302264|gb|EAS00252.1| Zinc finger, C2H2 type family protein [Tetrahymena thermophila
           SB210]
          Length = 741

 Score = 39.0 bits (90), Expect = 0.25,   Method: Composition-based stats.
 Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 2/31 (6%)

Query: 69  PIRKSIENGCLYCLEDGMQF--KSLKRHLKT 97
           P+++ +    L C   G ++  KSLK HLKT
Sbjct: 205 PMKQPLRPKSLVCYICGREYGTKSLKIHLKT 235


>gi|327287644|ref|XP_003228538.1| PREDICTED: zinc finger protein 135-like, partial [Anolis
           carolinensis]
          Length = 388

 Score = 38.6 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 3/26 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTP 103
           CLE G  F   K L+RH +TH    P
Sbjct: 8   CLECGKSFTEAKVLRRHQRTHTGEKP 33


>gi|187607087|ref|NP_001120344.1| zinc finger and SCAN domain containing 20 [Xenopus (Silurana)
           tropicalis]
 gi|157423025|gb|AAI53425.1| Zgc:110821 [Danio rerio]
 gi|170285176|gb|AAI60979.1| LOC100145411 protein [Xenopus (Silurana) tropicalis]
          Length = 279

 Score = 38.6 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 3/35 (8%)

Query: 73  SIENGCLYCLEDGMQFK---SLKRHLKTHHNMTPD 104
           S+E   L C + G  FK   +LKRH+  H+   P 
Sbjct: 43  SVEGTGLICPQCGRSFKNSVTLKRHMMIHNGEKPH 77


>gi|61651724|ref|NP_001013303.1| zinc finger and SCAN domain containing 20-like [Danio rerio]
 gi|59862073|gb|AAH90307.1| Zgc:110821 [Danio rerio]
          Length = 279

 Score = 38.6 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 3/35 (8%)

Query: 73  SIENGCLYCLEDGMQFK---SLKRHLKTHHNMTPD 104
           S+E   L C + G  FK   +LKRH+  H+   P 
Sbjct: 43  SVEGTGLICPQCGRSFKNSVTLKRHMMIHNGEKPH 77


>gi|311256507|ref|XP_003126680.1| PREDICTED: zinc finger protein 641-like [Sus scrofa]
          Length = 424

 Score = 38.6 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 24/63 (38%), Gaps = 8/63 (12%)

Query: 40  TDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHH 99
             VH+  +    +   +     +R + AVP+       C  C E G  F   +RH    H
Sbjct: 325 QRVHAEGKSCKGQEAGESPGARKRQR-AVPV-----PKCHVCTECGKSFG--RRHHLVRH 376

Query: 100 NMT 102
            +T
Sbjct: 377 WLT 379


>gi|291245157|ref|XP_002742458.1| PREDICTED: novel KRAB box and zinc finger, C2H2 type domain
           containing protein-like, partial [Saccoglossus
           kowalevskii]
          Length = 149

 Score = 38.6 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 28/72 (38%), Gaps = 10/72 (13%)

Query: 35  IGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQF---KSL 91
           I  ++T VH               V  E  KP   +RK +      C + G  F   K L
Sbjct: 37  IIGMMTSVHRYPSGFWRAQTSLPVVTKETPKP---LRKVLFK----CKQCGKCFTRSKYL 89

Query: 92  KRHLKTHHNMTP 103
           K+H+ TH  + P
Sbjct: 90  KQHMLTHTGLKP 101


>gi|327294331|ref|XP_003231861.1| hypothetical protein TERG_07481 [Trichophyton rubrum CBS 118892]
 gi|326465806|gb|EGD91259.1| hypothetical protein TERG_07481 [Trichophyton rubrum CBS 118892]
          Length = 311

 Score = 38.6 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 46/129 (35%), Gaps = 23/129 (17%)

Query: 24  YVSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSI------ENG 77
           Y++N ++P  D  +      +A +    R      +Q    +PA+   +S+         
Sbjct: 81  YLANSILPPDDAAAFSLTCRAAYKATSGR----RILQRLNKEPALYRARSLEHLELDFPK 136

Query: 78  CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSRE----YATTRSKLAKN 133
            + C E G     L   L+    +TP +      +  DY   +      Y     +LA +
Sbjct: 137 YVLCYECGKYHDRL---LQGFFGLTPCDLN---GIQLDY---APNFRRLYYRQIKELANH 187

Query: 134 MGLGRGRKK 142
             LG   K+
Sbjct: 188 YRLGLRYKR 196


>gi|148232134|ref|NP_001089997.1| zinc finger and BTB domain containing 17 [Xenopus laevis]
 gi|60648181|gb|AAH91717.1| MGC85135 protein [Xenopus laevis]
          Length = 778

 Score = 38.6 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 3/33 (9%)

Query: 74  IENGCLYCLEDGMQFKS---LKRHLKTHHNMTP 103
           I +G L C E G QF +   LKRHL+ H    P
Sbjct: 475 ITDGPLKCRECGKQFTTTGNLKRHLRIHSGEKP 507


>gi|12700571|gb|AAG38820.1| zinc finger protein ZFX [Hippopotamus amphibius]
          Length = 68

 Score = 38.6 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 6   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 36


>gi|170725434|ref|YP_001759460.1| AraC family transcriptional regulator [Shewanella woodyi ATCC
           51908]
 gi|169810781|gb|ACA85365.1| transcriptional regulator, AraC family [Shewanella woodyi ATCC
           51908]
          Length = 316

 Score = 38.6 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 30/69 (43%), Gaps = 1/69 (1%)

Query: 80  YCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRG 139
            C E GM   SL+R  K   +++P  Y   W LA  Y +V +  + T   +A  +G    
Sbjct: 233 ICNEAGMSRASLQRKFKAELDLSPMAYLGSWRLAKAYQLV-KNSSLTLDNIADRIGYADA 291

Query: 140 RKKRVLTSK 148
           R  R    +
Sbjct: 292 RTLRAAFKR 300


>gi|326674478|ref|XP_003200144.1| PREDICTED: zinc finger protein 658B-like [Danio rerio]
          Length = 603

 Score = 38.6 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 5/34 (14%)

Query: 81  CLEDGMQFKS---LKRHLKTHHNMTPD--EYRIK 109
           CLE G  F +   LKRH + H    P    Y  K
Sbjct: 40  CLECGKSFTTAGHLKRHQRIHTGEKPHKCSYCEK 73


>gi|315259093|ref|NP_001186743.1| putative zinc finger protein 812 [Homo sapiens]
 gi|206557846|sp|P0C7V5|ZN812_HUMAN RecName: Full=Putative zinc finger protein 812
          Length = 454

 Score = 38.6 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 14/36 (38%), Gaps = 3/36 (8%)

Query: 75  ENGCLYCLEDGMQFKS---LKRHLKTHHNMTPDEYR 107
               L C E G  F     L RH + H    P EY+
Sbjct: 413 REKALICKECGKAFAVSSHLSRHERIHTGEEPYEYK 448


>gi|119604454|gb|EAW84048.1| hCG2042872 [Homo sapiens]
          Length = 381

 Score = 38.6 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 14/36 (38%), Gaps = 3/36 (8%)

Query: 75  ENGCLYCLEDGMQFKS---LKRHLKTHHNMTPDEYR 107
               L C E G  F     L RH + H    P EY+
Sbjct: 340 REKALICKECGKAFAVSSHLSRHERIHTGEEPYEYK 375


>gi|327291135|ref|XP_003230277.1| PREDICTED: zinc finger protein 850-like [Anolis carolinensis]
          Length = 675

 Score = 38.6 bits (89), Expect = 0.30,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 4/39 (10%)

Query: 71  RKS-IENGCLYCLEDGMQF---KSLKRHLKTHHNMTPDE 105
           +KS I      CLE G  F   + L+RH +TH    P +
Sbjct: 445 KKSHIGEKPYTCLECGKGFSENRDLRRHQRTHTGEKPYQ 483


>gi|12700545|gb|AAG38807.1| zinc finger protein ZFX [Ochotona hyperborea]
          Length = 68

 Score = 38.6 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 6   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 36


>gi|313240576|emb|CBY32905.1| unnamed protein product [Oikopleura dioica]
          Length = 1127

 Score = 38.6 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 15/66 (22%), Positives = 27/66 (40%), Gaps = 5/66 (7%)

Query: 43   HSALQRVVSRAPCQDNVQPERLKPAVPIR-KSIENGC-LYCLEDGMQF---KSLKRHLKT 97
              A++ +      +  V  +   P    + K+++      C + G  F    SL+RHL T
Sbjct: 948  SRAIEVLQGDFVEEIEVSYDDPPPPKNQKLKNLKMEYPRICPKCGKSFPWASSLRRHLLT 1007

Query: 98   HHNMTP 103
            H  + P
Sbjct: 1008 HSGLKP 1013


>gi|198415022|ref|XP_002121256.1| PREDICTED: zinc finger (CCHC)-26 [Ciona intestinalis]
          Length = 1441

 Score = 38.6 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 17/93 (18%), Positives = 37/93 (39%), Gaps = 6/93 (6%)

Query: 25  VSNHVVPM-ADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCL---- 79
           VS +      ++   + ++      ++      +N   E+ + A  +   +    L    
Sbjct: 126 VSVNGTSKWPELPKFVNNMDDMDGYLLRFERYAENSGWEKTQWATWLSALLTGKALGVFS 185

Query: 80  -YCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWN 111
               E+G  ++ LKR L+  + +  D YR K+N
Sbjct: 186 RLSAEEGRDYEILKRALRERYGLREDGYRNKFN 218


>gi|12700495|gb|AAG38782.1| zinc finger protein ZFX [Erinaceus concolor]
 gi|12700497|gb|AAG38783.1| zinc finger protein ZFX [Talpa altaica]
 gi|12700543|gb|AAG38806.1| zinc finger protein ZFX [Sylvilagus floridanus]
 gi|12700597|gb|AAG38833.1| zinc finger protein ZFX [Manis pentadactyla]
          Length = 68

 Score = 38.6 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 6   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 36


>gi|195157172|ref|XP_002019470.1| GL12206 [Drosophila persimilis]
 gi|194116061|gb|EDW38104.1| GL12206 [Drosophila persimilis]
          Length = 312

 Score = 38.6 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 26/66 (39%), Gaps = 8/66 (12%)

Query: 48  RVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQF--KSLKRHLKTHHNMTPDE 105
           ++    P   N   +        +K      + C E GM+F  K++ RH++ H    P E
Sbjct: 158 KLTDPEPAISNPTKKDCTTECLPKK----RNITCQECGMKFTYKNMTRHMRVHTGERPFE 213

Query: 106 --YRIK 109
             Y  K
Sbjct: 214 CTYCEK 219


>gi|170052464|ref|XP_001862234.1| zinc finger protein 39 [Culex quinquefasciatus]
 gi|167873389|gb|EDS36772.1| zinc finger protein 39 [Culex quinquefasciatus]
          Length = 803

 Score = 38.6 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 6/53 (11%)

Query: 54  PCQDNVQPERLKPAV-PIRKSIENG--CLYCLEDGMQF---KSLKRHLKTHHN 100
           PC+   +    KP +   R+S       L C E G  F    +L RHL+TH  
Sbjct: 678 PCETCGEQFEQKPLLLKHRRSAHPELSHLVCQECGKLFSSSSTLNRHLETHSG 730


>gi|149470002|ref|XP_001520165.1| PREDICTED: similar to hCG21167, partial [Ornithorhynchus anatinus]
          Length = 286

 Score = 38.6 bits (89), Expect = 0.32,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 6/43 (13%)

Query: 80  YCLEDGMQF---KSLKRHLKTHHNMTPD---EYRIKWNLASDY 116
            CL+ G  F    +L +H +TH    P    EYR  + L SD+
Sbjct: 231 VCLDCGKAFARSSNLIQHQRTHRGERPYKGPEYREDFGLGSDF 273


>gi|147906526|ref|NP_001089395.1| zinc finger protein 572 [Xenopus laevis]
 gi|62739359|gb|AAH94128.1| MGC115356 protein [Xenopus laevis]
          Length = 487

 Score = 38.3 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 15/76 (19%), Positives = 29/76 (38%), Gaps = 4/76 (5%)

Query: 31  PMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKS 90
             +++  L   VH++ +    +    +   P++  PA+     +      C + G  F S
Sbjct: 288 SESEMLLLHQTVHAS-RTCNPQEGGGEVYIPQQPSPALLGGCPVVPAPYICGDCGKGFSS 346

Query: 91  ---LKRHLKTHHNMTP 103
              LK H + H    P
Sbjct: 347 SYKLKIHHRIHTGERP 362


>gi|12700547|gb|AAG38808.1| zinc finger protein ZFX [Tupaia minor]
          Length = 68

 Score = 38.3 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 6   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 36


>gi|12700509|gb|AAG38789.1| zinc finger protein ZFX [Macroscelides proboscideus]
 gi|12700511|gb|AAG38790.1| zinc finger protein ZFX [Elephantulus rufescens]
          Length = 68

 Score = 38.3 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 6   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 36


>gi|12700499|gb|AAG38784.1| zinc finger protein ZFX [Condylura cristata]
          Length = 67

 Score = 38.3 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 5   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 35


>gi|326674783|ref|XP_003200202.1| PREDICTED: zinc finger and SCAN domain-containing protein 2-like
           [Danio rerio]
          Length = 344

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 15/36 (41%), Gaps = 5/36 (13%)

Query: 80  YCLEDGMQFKS---LKRHLKTHHNMTPD--EYRIKW 110
            CLE G  F +   +KRHL  H    P    Y  K 
Sbjct: 151 VCLECGKSFTTAGHVKRHLLIHTGEKPYKCSYCDKC 186


>gi|313234287|emb|CBY10354.1| unnamed protein product [Oikopleura dioica]
          Length = 1138

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 15/66 (22%), Positives = 27/66 (40%), Gaps = 5/66 (7%)

Query: 43   HSALQRVVSRAPCQDNVQPERLKPAVPIR-KSIENGC-LYCLEDGMQF---KSLKRHLKT 97
              A++ +      +  V  +   P    + K+++      C + G  F    SL+RHL T
Sbjct: 963  SRAIEVLQGDFVEEIEVSYDDPPPPKNQKLKNLKMEYPRICPKCGKSFPWASSLRRHLLT 1022

Query: 98   HHNMTP 103
            H  + P
Sbjct: 1023 HSGLKP 1028


>gi|292624003|ref|XP_002665498.1| PREDICTED: zinc finger protein 436-like [Danio rerio]
          Length = 207

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 5/35 (14%)

Query: 80  YCLEDGMQF---KSLKRHLKTHHNMTPD--EYRIK 109
            CLE G  F    SLKRH + H    P    Y  K
Sbjct: 126 VCLECGKSFCQSGSLKRHQRIHTGEKPHKCSYCEK 160


>gi|12700489|gb|AAG38779.1| zinc finger protein ZFX [Euphractus sexcinctus]
 gi|12700493|gb|AAG38781.1| zinc finger protein ZFX [Tamandua tetradactyla]
 gi|12700503|gb|AAG38786.1| zinc finger protein ZFX [Trichechus manatus]
 gi|12700507|gb|AAG38788.1| zinc finger protein ZFX [Loxodonta africana]
 gi|12700513|gb|AAG38791.1| zinc finger protein ZFX [Orycteropus afer]
 gi|12700549|gb|AAG38809.1| zinc finger protein ZFX [Lemur catta]
 gi|12700565|gb|AAG38817.1| zinc finger protein ZFX [Pteropus giganteus]
 gi|12700567|gb|AAG38818.1| zinc finger protein ZFX [Rousettus lanosus]
 gi|12700573|gb|AAG38821.1| zinc finger protein ZFX [Lama glama]
 gi|12700575|gb|AAG38822.1| zinc finger protein ZFX [Tragelaphus eurycerus]
 gi|12700577|gb|AAG38823.1| zinc finger protein ZFX [Sus scrofa]
 gi|12700579|gb|AAG38824.1| zinc finger protein ZFX [Okapia johnstoni]
 gi|12700581|gb|AAG38825.1| zinc finger protein ZFX [Equus caballus]
 gi|12700583|gb|AAG38826.1| zinc finger protein ZFX [Ceratotherium simum]
 gi|12700585|gb|AAG38827.1| zinc finger protein ZFX [Tapirus indicus]
 gi|12700587|gb|AAG38828.1| zinc finger protein ZFX [Felis catus]
 gi|12700589|gb|AAG38829.1| zinc finger protein ZFX [Leopardus pardalis]
 gi|12700591|gb|AAG38830.1| zinc finger protein ZFX [Panthera onca]
 gi|12700595|gb|AAG38832.1| zinc finger protein ZFX [Ursus arctos]
          Length = 68

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 6   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 36


>gi|301628997|ref|XP_002943633.1| PREDICTED: oocyte zinc finger protein XlCOF7.1-like [Xenopus
            (Silurana) tropicalis]
          Length = 1389

 Score = 38.3 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 79   LYCLEDGMQFKS---LKRHLKTHHNMTP 103
            + CL+ G  FK+   L+RH  TH    P
Sbjct: 1294 ITCLQCGKHFKTQRYLQRHFITHSGKKP 1321


>gi|56548241|gb|AAV93127.1| zinc finger protein Zfx [Nyctimene albiventer]
 gi|56548243|gb|AAV93128.1| zinc finger protein Zfx [Rhinolophus creaghi]
 gi|140429082|gb|ABO87391.1| zinc finger protein Zfx [Miniopterus natalensis]
          Length = 66

 Score = 38.3 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 5   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 35


>gi|301627514|ref|XP_002942919.1| PREDICTED: zinc finger protein Xfin [Xenopus (Silurana) tropicalis]
          Length = 1062

 Score = 38.3 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 23/55 (41%), Gaps = 14/55 (25%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132
           C++ G +F   + L  HL+TH  + P           D   V       RS+LAK
Sbjct: 570 CIQCGKRFVQQQHLTTHLRTHTGIKP--------FPCD---VCGNSYRWRSELAK 613


>gi|198411731|ref|XP_002121039.1| PREDICTED: similar to zinc finger protein [Ciona intestinalis]
          Length = 661

 Score = 38.3 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 80  YCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWN 111
              E+G  ++ LKR L+  + +  D YR K+N
Sbjct: 162 LSAEEGKDYEVLKRALRERYGLREDGYRNKFN 193


>gi|12700551|gb|AAG38810.1| zinc finger protein ZFX [Tarsius bancanus]
          Length = 68

 Score = 38.3 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 6   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 36


>gi|12700491|gb|AAG38780.1| zinc finger protein ZFX [Chaetophractus villosus]
          Length = 67

 Score = 38.3 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 5   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 35


>gi|327266684|ref|XP_003218134.1| PREDICTED: zinc finger protein 208-like [Anolis carolinensis]
          Length = 1279

 Score = 38.3 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 17/35 (48%), Gaps = 3/35 (8%)

Query: 74   IENGCLYCLEDGMQFK---SLKRHLKTHHNMTPDE 105
            I+     CLE G  F+   SLK H K+H    P E
Sbjct: 988  IKEKLHTCLECGKSFRWRASLKAHQKSHTGEKPHE 1022


>gi|307186118|gb|EFN71843.1| Broad-complex core protein isoform 6 [Camponotus floridanus]
          Length = 476

 Score = 38.3 bits (88), Expect = 0.39,   Method: Composition-based stats.
 Identities = 10/37 (27%), Positives = 18/37 (48%), Gaps = 4/37 (10%)

Query: 76  NGCLYCLEDGMQFKS---LKRHLKTHHNMTPDEYRIK 109
              + C      FK+   LKRHL + H+++  + R +
Sbjct: 319 PQSVTCPLCNKPFKTKLYLKRHLVSFHDLSVAD-RQR 354


>gi|56548249|gb|AAV93131.1| zinc finger protein Zfx [Rhinopoma hardwickii]
          Length = 64

 Score = 38.3 bits (88), Expect = 0.39,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 4/31 (12%)

Query: 81  CLEDGMQFKS---LKRHLKTH-HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  ++T  +YR
Sbjct: 3   CMICGKKFKSRGFLKRHMKNHPEHLTKKKYR 33


>gi|327289543|ref|XP_003229484.1| PREDICTED: zinc finger protein 658-like [Anolis carolinensis]
          Length = 453

 Score = 38.3 bits (88), Expect = 0.42,   Method: Composition-based stats.
 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 5/30 (16%)

Query: 81  CLEDGMQFK---SLKRHLKTHHNMTPDEYR 107
           CLE G  F    SL+ HL+TH    P  YR
Sbjct: 169 CLECGKSFTQKGSLRSHLRTHTGEKP--YR 196


>gi|327289892|ref|XP_003229658.1| PREDICTED: zinc finger protein 729-like [Anolis carolinensis]
          Length = 1261

 Score = 37.9 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 15/25 (60%), Gaps = 1/25 (4%)

Query: 81  CLEDGMQFKSLKRHLKTHHNMTPDE 105
           CLE G  F   KRHL+THH +   E
Sbjct: 532 CLECGKSF-IQKRHLQTHHRIHTGE 555



 Score = 37.5 bits (86), Expect = 0.70,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 27/71 (38%), Gaps = 9/71 (12%)

Query: 38  LITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKS---LKRH 94
            I ++H+  ++        ++          P++K  E     CLE G  F     L+RH
Sbjct: 299 FIQEIHTG-KKPECGKSFTESGSVHSYPRTHPVKKPYE-----CLECGKSFTQRAYLQRH 352

Query: 95  LKTHHNMTPDE 105
            + H    P E
Sbjct: 353 HRIHTGEKPYE 363


>gi|327281878|ref|XP_003225672.1| PREDICTED: zinc finger protein 729-like [Anolis carolinensis]
          Length = 1376

 Score = 37.9 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 3/31 (9%)

Query: 76   NGCLYCLEDGMQFKS---LKRHLKTHHNMTP 103
                 CLE G  F     LKRH KTH    P
Sbjct: 1260 EKSYTCLECGKSFSQGILLKRHQKTHTGEKP 1290


>gi|149638244|ref|XP_001515796.1| PREDICTED: similar to Zinc finger X-chromosomal protein
           [Ornithorhynchus anatinus]
          Length = 814

 Score = 37.9 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGC--LY---CLEDGMQFKS---LKRH 94
            + L R+  + P +      R      I   I      L    C+  G +FKS   LKRH
Sbjct: 388 SAGLGRLAKQKPKKRRRPDSRQYQTAII---IGPDGHPLTVYPCMICGKKFKSRGFLKRH 444

Query: 95  LKTH-HNMTPDEYR 107
           +K H  +++  +YR
Sbjct: 445 MKNHPEHLSKKKYR 458


>gi|149408539|ref|XP_001512748.1| PREDICTED: similar to Zinc finger protein 366 [Ornithorhynchus
           anatinus]
          Length = 704

 Score = 37.9 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 5/31 (16%)

Query: 80  YCLEDGMQFKSL---KRHLKTHHNMTPDEYR 107
            C+E G+ F +L   KRHL +H    P +YR
Sbjct: 326 VCVECGLDFPTLAQLKRHLTSHRG--PVQYR 354


>gi|327279775|ref|XP_003224631.1| PREDICTED: zinc finger protein 628-like [Anolis carolinensis]
          Length = 1249

 Score = 37.9 bits (87), Expect = 0.46,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 21/62 (33%), Gaps = 9/62 (14%)

Query: 46  LQRVVSRAPCQDNVQPERL-KPAVPIRKSIENGCLYCLEDGMQFK---SLKRHLKTHHNM 101
           L+      P Q    P     PA P  +        C E G  FK    L+ HL+ H   
Sbjct: 431 LEEAEVTCPAQAEPVPTATVTPAPPPERPY-----VCGECGKAFKGSSGLRYHLRDHTGE 485

Query: 102 TP 103
            P
Sbjct: 486 RP 487


>gi|2982495|emb|CAA05160.1| D19A [Drosophila melanogaster]
          Length = 845

 Score = 37.9 bits (87), Expect = 0.47,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 22/52 (42%), Gaps = 6/52 (11%)

Query: 76  NGCLYCLEDGMQF---KSLKRHLKTH--HNMTPDE-YRIKWNLASDYPMVSR 121
             C  C   G  F   KSL +HLKTH   ++ P E  R + N+     M   
Sbjct: 514 EKCCVCKICGKIFLCEKSLTKHLKTHEKRDLPPAEPLRQQLNIPMPGQMSVP 565


>gi|260778226|ref|ZP_05887119.1| transcriptional regulator AraC family [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260606239|gb|EEX32524.1| transcriptional regulator AraC family [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 300

 Score = 37.9 bits (87), Expect = 0.48,   Method: Composition-based stats.
 Identities = 24/101 (23%), Positives = 36/101 (35%), Gaps = 13/101 (12%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDG-MQFKSLKRHLKTHHNM 101
           H   + V          +      A  + KS +      LE G    +SL +  K H+ +
Sbjct: 41  HRTFKAVQGETLADYIRRLRLAAAADDLFKSKQPILNIALEYGFSSSQSLAKAFKQHYGV 100

Query: 102 TPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKK 142
           TP E+R               Y    SKLA+N  +G   +K
Sbjct: 101 TPTEFRD-----------CENYQEF-SKLARNSKIGHTLRK 129


>gi|27374375|gb|AAO01113.1| CG5245-like-PA [Drosophila pseudoobscura]
          Length = 465

 Score = 37.9 bits (87), Expect = 0.48,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 26/66 (39%), Gaps = 8/66 (12%)

Query: 48  RVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQF--KSLKRHLKTHHNMTPDE 105
           ++    P   N   +        +K      + C E GM+F  K++ RH++ H    P E
Sbjct: 309 KLTDPEPAISNPTKKDCTTESLPKK----RNITCQECGMKFTYKNMTRHMRVHTGERPFE 364

Query: 106 --YRIK 109
             Y  K
Sbjct: 365 CTYCEK 370


>gi|327288318|ref|XP_003228875.1| PREDICTED: zinc finger protein 84-like [Anolis carolinensis]
          Length = 526

 Score = 37.9 bits (87), Expect = 0.48,   Method: Composition-based stats.
 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 5/29 (17%)

Query: 81  CLEDGMQFKSLKR----HLKTHHNMTPDE 105
           C+E G  F SLKR    HL+TH    P E
Sbjct: 343 CMECGKSF-SLKRNLESHLRTHTGEKPYE 370


>gi|307169086|gb|EFN61930.1| Zinc finger protein Xfin [Camponotus floridanus]
          Length = 2028

 Score = 37.9 bits (87), Expect = 0.50,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 21/59 (35%), Gaps = 14/59 (23%)

Query: 75  ENGCLYCLEDGMQFK---SLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKL 130
           +   + C E G  F    S KRH+  H    P              M+ ++    RS+L
Sbjct: 617 KRDKIVCAECGKTFTKKDSFKRHMVVHTGCKPHS-----------CMICKKPFARRSQL 664


>gi|126632736|emb|CAM56608.1| novel protein [Danio rerio]
          Length = 124

 Score = 37.9 bits (87), Expect = 0.52,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 5/38 (13%)

Query: 71  RKSIENGCLYCLEDGMQFK---SLKRHLKTHHNMTPDE 105
           RK+++  CL C + G  FK   +L RH+K H    P +
Sbjct: 56  RKAVK--CLTCTQCGKSFKNKVTLSRHVKIHTGEKPYQ 91


>gi|242022079|ref|XP_002431469.1| protein glass, putative [Pediculus humanus corporis]
 gi|212516757|gb|EEB18731.1| protein glass, putative [Pediculus humanus corporis]
          Length = 266

 Score = 37.9 bits (87), Expect = 0.53,   Method: Composition-based stats.
 Identities = 12/40 (30%), Positives = 16/40 (40%), Gaps = 5/40 (12%)

Query: 71  RKSIENGCLYCLEDGMQF---KSLKRHLKTHHNMTPDEYR 107
             S+      C   G  +    +LK HL+TH    P  YR
Sbjct: 118 EDSLFPHSNLCRICGKTYARPSTLKTHLRTHSGEKP--YR 155


>gi|327281850|ref|XP_003225658.1| PREDICTED: zinc finger protein 91-like [Anolis carolinensis]
          Length = 1374

 Score = 37.9 bits (87), Expect = 0.54,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 3/31 (9%)

Query: 81   CLEDGMQF--K-SLKRHLKTHHNMTPDEYRI 108
            CLE G  F  K SL RHL  H    P +Y  
Sbjct: 1012 CLECGKGFIHKISLTRHLAVHTGWKPFKYLE 1042


>gi|312380485|gb|EFR26464.1| hypothetical protein AND_07455 [Anopheles darlingi]
          Length = 428

 Score = 37.9 bits (87), Expect = 0.55,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 24/62 (38%), Gaps = 9/62 (14%)

Query: 46  LQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQF---KSLKRHLKTHHNMT 102
           L  + + A    +    + +PA    +++      C   G  F     LKRH++TH    
Sbjct: 158 LASIGTGASSSRSSP--KARPAARSERAMLP----CEVCGKAFDRPSLLKRHMRTHTGEK 211

Query: 103 PD 104
           P 
Sbjct: 212 PH 213


>gi|327268294|ref|XP_003218933.1| PREDICTED: zinc finger X-chromosomal protein-like [Anolis
           carolinensis]
          Length = 811

 Score = 37.5 bits (86), Expect = 0.56,   Method: Composition-based stats.
 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 5/32 (15%)

Query: 81  CLEDGMQFKS---LKRHLKTH--HNMTPDEYR 107
           C+  G +FKS   LKRH+K H  H +   +YR
Sbjct: 414 CMICGKKFKSRGFLKRHMKNHPEHLLAKKKYR 445


>gi|327289561|ref|XP_003229493.1| PREDICTED: zinc finger protein 135-like [Anolis carolinensis]
          Length = 399

 Score = 37.5 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 3/31 (9%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPDEYRI 108
           CLE G  F    SL+RH +TH    P + R 
Sbjct: 288 CLECGKSFAHSTSLRRHQRTHTGEKPYKCRE 318


>gi|326678150|ref|XP_002666163.2| PREDICTED: zinc finger protein 234-like [Danio rerio]
          Length = 299

 Score = 37.5 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 12/30 (40%), Positives = 13/30 (43%), Gaps = 3/30 (10%)

Query: 77  GCLYCLEDGMQFK---SLKRHLKTHHNMTP 103
            C  C + G  FK    LKRHL  H    P
Sbjct: 70  KCFTCTQCGKSFKKKTILKRHLMIHTGEKP 99


>gi|62122919|ref|NP_001014384.1| zinc finger protein 502-like [Danio rerio]
 gi|61402629|gb|AAH91933.1| Zgc:113343 [Danio rerio]
 gi|182890990|gb|AAI64174.1| Zgc:113343 protein [Danio rerio]
          Length = 356

 Score = 37.5 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 27/74 (36%), Gaps = 5/74 (6%)

Query: 30  VPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFK 89
           +   +    I +     +++ +      +   +  +P    R ++  G   C E G  +K
Sbjct: 1   METEEEPCRIKE-EETEEQIDADENAVSSQTEDTSRPKQAGRTAV-EGSFICSECGKSYK 58

Query: 90  ---SLKRHLKTHHN 100
              SL RH + H  
Sbjct: 59  SKDSLYRHTRFHSG 72


>gi|10803573|ref|NP_045971.1| gas vesicle protein GvpC [Halobacterium sp. NRC-1]
 gi|16120004|ref|NP_395592.1| GvpC protein, cluster A [Halobacterium sp. NRC-1]
 gi|169237185|ref|YP_001690391.1| gas-vesicle protein gvpC1 [Halobacterium salinarum R1]
 gi|121867|sp|P24574|GVPC1_HALSA RecName: Full=Gas vesicle protein C 1
 gi|81047|pir||JQ1122 gas-vesicle protein gvpC - Halobacterium salinarum plasmids pHH1
           and pNRC100
 gi|43531|emb|CAA40451.1| gvpC [Halobacterium salinarum]
 gi|43654|emb|CAA45981.1| p-gvpC [Halobacterium salinarum]
 gi|150418|gb|AAA98197.1| gas vesicle protein [Halobacterium salinarum]
 gi|2822304|gb|AAC82810.1| GvpC [Halobacterium sp. NRC-1]
 gi|10584094|gb|AAG20727.1| GvpC protein, cluster A [Halobacterium sp. NRC-1]
 gi|167728251|emb|CAP15043.1| gas-vesicle protein gvpC1 [Halobacterium salinarum R1]
          Length = 382

 Score = 37.5 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query: 76  NGCLYCLEDGMQFKSLKR-HLKTHHNMTPDEYRIKWNLASDYPM 118
              + C   G  ++++   HL+T H+MT  EYR ++    D P+
Sbjct: 336 EDMVQCRVCGEYYQAITEPHLQT-HDMTIQEYRDEYG--EDVPL 376


>gi|326674470|ref|XP_003200142.1| PREDICTED: zinc finger protein 271-like [Danio rerio]
          Length = 634

 Score = 37.5 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 13/35 (37%), Gaps = 5/35 (14%)

Query: 80  YCLEDGMQFKS---LKRHLKTHHNMTPD--EYRIK 109
            CLE G  F     LKRH   H    P    Y  K
Sbjct: 553 VCLECGKSFTQSGHLKRHQMIHTGEKPHKCSYCEK 587


>gi|194671262|ref|XP_596267.3| PREDICTED: zinc finger and BTB domain containing 37 [Bos taurus]
 gi|297480742|ref|XP_002691632.1| PREDICTED: zinc finger and BTB domain containing 37-like [Bos
           taurus]
 gi|296482198|gb|DAA24313.1| zinc finger and BTB domain containing 37-like [Bos taurus]
          Length = 502

 Score = 37.5 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 10/76 (13%)

Query: 37  SLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIE------NGCLYCLEDGMQFK- 89
           +L   +HS LQ +V  +  +  V     + + P  +S        N  L C+  G  F  
Sbjct: 327 ALSVHLHSDLQGLVQGSDSEAVVSNPGFE-SSPRERSARGHWYPYNERLICIYCGKSFNQ 385

Query: 90  --SLKRHLKTHHNMTP 103
             SL RH++ H  +TP
Sbjct: 386 KGSLDRHMRLHMGITP 401


>gi|327286286|ref|XP_003227862.1| PREDICTED: zinc finger protein 585A-like [Anolis carolinensis]
          Length = 1173

 Score = 37.5 bits (86), Expect = 0.59,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 26/76 (34%), Gaps = 13/76 (17%)

Query: 37  SLITDVHSALQRVVSRAPCQDNVQPE-----RLKPAVPIRKSIENGCLYCLEDGMQF--- 88
             I   H    +   +     N +       R  P++ I++  +     CLE G  F   
Sbjct: 898 GFIQKAHHTQHQATHKGKKPPNARSVEKFSLRRHPSLGIKQPFK-----CLECGKSFTSK 952

Query: 89  KSLKRHLKTHHNMTPD 104
           KSL  H   H+   P 
Sbjct: 953 KSLTWHQANHNGKKPH 968



 Score = 35.9 bits (82), Expect = 1.8,   Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 3/27 (11%)

Query: 81   CLEDGMQFKS---LKRHLKTHHNMTPD 104
            CLE G  F     LKRH  TH    P 
Sbjct: 1082 CLECGKSFNQKGDLKRHQATHTGKKPH 1108


>gi|158257966|dbj|BAF84956.1| unnamed protein product [Homo sapiens]
          Length = 473

 Score = 37.5 bits (86), Expect = 0.60,   Method: Composition-based stats.
 Identities = 14/61 (22%), Positives = 24/61 (39%), Gaps = 3/61 (4%)

Query: 46  LQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQF---KSLKRHLKTHHNMT 102
           L+      P       ++ + +VP + +    C  C E G  F    +L +H +TH    
Sbjct: 244 LENEKGTKPPLQEAGSKKGRESVPTKPTPGERCYICAECGKAFSNSSNLTKHRRTHTGEK 303

Query: 103 P 103
           P
Sbjct: 304 P 304


>gi|260831678|ref|XP_002610785.1| hypothetical protein BRAFLDRAFT_126318 [Branchiostoma floridae]
 gi|229296154|gb|EEN66795.1| hypothetical protein BRAFLDRAFT_126318 [Branchiostoma floridae]
          Length = 1482

 Score = 37.5 bits (86), Expect = 0.62,   Method: Composition-based stats.
 Identities = 16/64 (25%), Positives = 22/64 (34%), Gaps = 5/64 (7%)

Query: 50  VSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQF---KSLKRHLKTHHNMTPDEY 106
                      P   + A P+ +        C   G  F    +L RHL+TH    P  Y
Sbjct: 760 GGGMMPVSEFPPMASQLADPVVRGKGKDRYTCRYCGKLFPRSANLTRHLRTHTGEQP--Y 817

Query: 107 RIKW 110
           R K+
Sbjct: 818 RCKY 821


>gi|260784850|ref|XP_002587477.1| hypothetical protein BRAFLDRAFT_238246 [Branchiostoma floridae]
 gi|229272624|gb|EEN43488.1| hypothetical protein BRAFLDRAFT_238246 [Branchiostoma floridae]
          Length = 385

 Score = 37.5 bits (86), Expect = 0.66,   Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 5/30 (16%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPDEYR 107
           C E G QF    SLKRH++TH    P  YR
Sbjct: 74  CKECGKQFSELTSLKRHMRTHTGEKP--YR 101


>gi|260782425|ref|XP_002586288.1| hypothetical protein BRAFLDRAFT_109288 [Branchiostoma floridae]
 gi|229271388|gb|EEN42299.1| hypothetical protein BRAFLDRAFT_109288 [Branchiostoma floridae]
          Length = 308

 Score = 37.5 bits (86), Expect = 0.66,   Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 5/30 (16%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPDEYR 107
           C E G QF    SLKRH++TH    P  YR
Sbjct: 112 CKECGKQFSELTSLKRHIRTHTGEKP--YR 139


>gi|110667735|ref|YP_657546.1| gas-vesicle protein gvpC [Haloquadratum walsbyi DSM 16790]
 gi|109625482|emb|CAJ51909.1| gas-vesicle protein gvpC [Haloquadratum walsbyi DSM 16790]
          Length = 384

 Score = 37.5 bits (86), Expect = 0.66,   Method: Composition-based stats.
 Identities = 11/45 (24%), Positives = 21/45 (46%), Gaps = 5/45 (11%)

Query: 76  NGCLY-CLEDGMQFKSLKR-HLKTHHNMTPDEYRIKWNLASDYPM 118
              +  C   G  + ++   HL+T H M+  +YR ++    D P+
Sbjct: 336 PDGMVTCRVCGEHYHAITEPHLQT-HGMSIQDYRAEYG--EDVPL 377


>gi|242821440|ref|XP_002487681.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500]
 gi|218712602|gb|EED12027.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500]
          Length = 695

 Score = 37.5 bits (86), Expect = 0.69,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 32/73 (43%), Gaps = 3/73 (4%)

Query: 30  VPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFK 89
           V  + I SL TD  +AL R+     C ++ +     PA     +I      C+  G  F 
Sbjct: 575 VEPSPITSLATDTRTALGRIYKGCHCPEHQEIYSDWPAHNAELTIVQCMKICVYCGKDFA 634

Query: 90  S---LKRHLKTHH 99
               L++H++ HH
Sbjct: 635 VAAELRKHMRKHH 647


>gi|194384456|dbj|BAG59388.1| unnamed protein product [Homo sapiens]
          Length = 350

 Score = 37.5 bits (86), Expect = 0.69,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 14/36 (38%), Gaps = 3/36 (8%)

Query: 75  ENGCLYCLEDGMQF---KSLKRHLKTHHNMTPDEYR 107
               L C E G  F     L RH + H    P EY+
Sbjct: 309 REKALICKECGKAFAGSSHLSRHERIHTGEEPYEYK 344


>gi|322800585|gb|EFZ21571.1| hypothetical protein SINV_10834 [Solenopsis invicta]
          Length = 1606

 Score = 37.5 bits (86), Expect = 0.70,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 18/37 (48%), Gaps = 4/37 (10%)

Query: 74   IENGCLYCLEDGMQFK---SLKRHLKTHHNM-TPDEY 106
            ++   L CLE G  F    SL+ HLK  H +  P  Y
Sbjct: 1466 LKGRYLICLECGENFVVAPSLQMHLKAFHGIEDPATY 1502


>gi|47227238|emb|CAG00600.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 493

 Score = 37.5 bits (86), Expect = 0.71,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 22/57 (38%), Gaps = 6/57 (10%)

Query: 50  VSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFK---SLKRHLKTHHNMTP 103
           VS    +D+  P     A             CLE G  F+   SLK+H++ H    P
Sbjct: 329 VSPGRAEDSAGPSAPDAASEPSGD-RPHH--CLECGKTFRLISSLKKHIRIHTGEKP 382


>gi|297485192|ref|XP_002694900.1| PREDICTED: KIAA1858 protein-like [Bos taurus]
 gi|296478133|gb|DAA20248.1| KIAA1858 protein-like [Bos taurus]
          Length = 3416

 Score = 37.5 bits (86), Expect = 0.72,   Method: Composition-based stats.
 Identities = 23/90 (25%), Positives = 34/90 (37%), Gaps = 12/90 (13%)

Query: 50   VSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDG----MQFKSLKRHLKTHHNMTPDE 105
               A  + +   E   PAVP+ +  ++    C   G      FK L+RHL  H   +P  
Sbjct: 2773 AGGASPEAHPHGEPPLPAVPVHQDCKDPARDCHHCGKRFPKPFK-LQRHLAVH---SP-- 2826

Query: 106  YRIKWNLASDYPMVSREYATTRSKLAKNMG 135
               +  L    P V  E+   R+ L    G
Sbjct: 2827 --QRVYLCPQCPRVYPEHQELRAHLGSEHG 2854


>gi|254227391|ref|ZP_04920823.1| DNA gyrase inhibitor [Vibrio sp. Ex25]
 gi|262396344|ref|YP_003288197.1| transcriptional regulator AraC family [Vibrio sp. Ex25]
 gi|151940003|gb|EDN58829.1| DNA gyrase inhibitor [Vibrio sp. Ex25]
 gi|262339938|gb|ACY53732.1| transcriptional regulator AraC family [Vibrio sp. Ex25]
          Length = 299

 Score = 37.5 bits (86), Expect = 0.72,   Method: Composition-based stats.
 Identities = 22/101 (21%), Positives = 36/101 (35%), Gaps = 13/101 (12%)

Query: 43  HSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDG-MQFKSLKRHLKTHHNM 101
           H   + V          +      A  + KS +      LE G    +SL +  K H+ +
Sbjct: 41  HRTFKAVQGETLADFIRRLRLEAAADDLFKSKQPVLNIALEYGFSSSQSLAKAFKQHYGV 100

Query: 102 TPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRKK 142
           TP  +R             + Y    S+LA+N  +G   +K
Sbjct: 101 TPTAFRD-----------CKNYQ-QFSELARNSKIGHALRK 129


>gi|332030135|gb|EGI69929.1| Broad-complex core protein isoform 6 [Acromyrmex echinatior]
          Length = 473

 Score = 37.1 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 10/37 (27%), Positives = 17/37 (45%), Gaps = 4/37 (10%)

Query: 76  NGCLYCLEDGMQFKS---LKRHLKTHHNMTPDEYRIK 109
              + C      FK+   LKRHL + H ++  + R +
Sbjct: 319 PQSVTCPLCNKPFKTKLYLKRHLVSFHELSVAD-RQR 354


>gi|327290853|ref|XP_003230136.1| PREDICTED: zinc finger protein 2-like, partial [Anolis
           carolinensis]
          Length = 418

 Score = 37.1 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 13/28 (46%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTPDE 105
           CL  G  F   K+L+RH KTH    P E
Sbjct: 224 CLVCGKTFGFKKTLRRHQKTHTGEKPYE 251


>gi|322786994|gb|EFZ13218.1| hypothetical protein SINV_06487 [Solenopsis invicta]
          Length = 473

 Score = 37.1 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 10/37 (27%), Positives = 17/37 (45%), Gaps = 4/37 (10%)

Query: 76  NGCLYCLEDGMQFKS---LKRHLKTHHNMTPDEYRIK 109
              + C      FK+   LKRHL + H ++  + R +
Sbjct: 319 PQSVTCPLCNKPFKTKLYLKRHLVSFHELSVAD-RQR 354


>gi|307205693|gb|EFN83955.1| Broad-complex core protein isoform 6 [Harpegnathos saltator]
          Length = 467

 Score = 37.1 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 10/37 (27%), Positives = 17/37 (45%), Gaps = 4/37 (10%)

Query: 76  NGCLYCLEDGMQFKS---LKRHLKTHHNMTPDEYRIK 109
              + C      FK+   LKRHL + H ++  + R +
Sbjct: 318 PQSVTCPLCNKPFKTKLYLKRHLVSFHELSVAD-RQR 353


>gi|114675246|ref|XP_512353.2| PREDICTED: hypothetical protein isoform 4 [Pan troglodytes]
 gi|114675248|ref|XP_001161760.1| PREDICTED: hypothetical protein isoform 3 [Pan troglodytes]
          Length = 483

 Score = 37.1 bits (85), Expect = 0.73,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 16/43 (37%), Gaps = 3/43 (6%)

Query: 68  VPIRKSIENGCLYCLEDGMQFKS---LKRHLKTHHNMTPDEYR 107
           V +R         C E G  F     L RH + H    P EY+
Sbjct: 435 VHLRTHTREKAFICKECGKAFAVSSHLSRHERIHTGEEPYEYK 477


>gi|114675250|ref|XP_001161717.1| PREDICTED: hypothetical protein isoform 2 [Pan troglodytes]
          Length = 492

 Score = 37.1 bits (85), Expect = 0.73,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 16/43 (37%), Gaps = 3/43 (6%)

Query: 68  VPIRKSIENGCLYCLEDGMQFKS---LKRHLKTHHNMTPDEYR 107
           V +R         C E G  F     L RH + H    P EY+
Sbjct: 444 VHLRTHTREKAFICKECGKAFAVSSHLSRHERIHTGEEPYEYK 486


>gi|114675252|ref|XP_001161581.1| PREDICTED: hypothetical protein isoform 1 [Pan troglodytes]
          Length = 491

 Score = 37.1 bits (85), Expect = 0.73,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 16/43 (37%), Gaps = 3/43 (6%)

Query: 68  VPIRKSIENGCLYCLEDGMQFKS---LKRHLKTHHNMTPDEYR 107
           V +R         C E G  F     L RH + H    P EY+
Sbjct: 443 VHLRTHTREKAFICKECGKAFAVSSHLSRHERIHTGEEPYEYK 485


>gi|326674480|ref|XP_001333186.4| PREDICTED: zinc finger protein 729-like [Danio rerio]
          Length = 1344

 Score = 37.1 bits (85), Expect = 0.76,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 5/34 (14%)

Query: 81  CLEDGMQFK---SLKRHLKTHHNMTPD--EYRIK 109
           CL+ G  F    SLKRH   H    P    Y  K
Sbjct: 313 CLQCGKSFTRAGSLKRHHMIHTGEKPHKCSYCEK 346


>gi|47222841|emb|CAF96508.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 848

 Score = 37.1 bits (85), Expect = 0.76,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 3/42 (7%)

Query: 67  AVPIRKSIENGCLYCLEDGMQFKS---LKRHLKTHHNMTPDE 105
           AV + +S+E     CL+ G  FK    LK HL+ H    P E
Sbjct: 204 AVALDQSMETRKFKCLQCGKAFKYKHHLKEHLRIHSGEKPYE 245


>gi|24647786|ref|NP_650660.1| CG17801 [Drosophila melanogaster]
 gi|23171583|gb|AAF55473.2| CG17801 [Drosophila melanogaster]
 gi|113204947|gb|ABI34207.1| RT01034p [Drosophila melanogaster]
 gi|113205011|gb|ABI34239.1| RT01134p [Drosophila melanogaster]
          Length = 345

 Score = 37.1 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 28/63 (44%), Gaps = 5/63 (7%)

Query: 41  DVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKS---LKRHLKT 97
             + +++ V   A   ++V  E + PA    + ++   L C + G  FK+   LK H+  
Sbjct: 194 TTYPSIKVVKPLALAPEDVAAENVPPAKRTARKMQ--SLVCPKCGRVFKTPYNLKTHMVR 251

Query: 98  HHN 100
           H  
Sbjct: 252 HTG 254


>gi|93003286|tpd|FAA00226.1| TPA: zinc finger protein [Ciona intestinalis]
          Length = 1297

 Score = 37.1 bits (85), Expect = 0.80,   Method: Composition-based stats.
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 80  YCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWN 111
              E+G  ++ LKR L+  + +  D YR K+N
Sbjct: 43  LSAEEGRDYEILKRALRERYGLREDGYRNKFN 74


>gi|327287656|ref|XP_003228544.1| PREDICTED: zinc finger protein 850-like [Anolis carolinensis]
          Length = 788

 Score = 37.1 bits (85), Expect = 0.81,   Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 3/26 (11%)

Query: 81  CLEDGMQF---KSLKRHLKTHHNMTP 103
           CLE G  F   K L+RH +TH    P
Sbjct: 680 CLECGKSFTEAKGLRRHQRTHTGEKP 705


>gi|327287844|ref|XP_003228638.1| PREDICTED: zinc finger protein 658-like [Anolis carolinensis]
          Length = 572

 Score = 37.1 bits (85), Expect = 0.83,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 3/49 (6%)

Query: 59  VQPERLKPAVPIRKSIENGCLYCLEDGMQFK---SLKRHLKTHHNMTPD 104
             PERL+PA+P R         C+E G  F    SL+ H  TH    P 
Sbjct: 50  SAPERLRPALPSRIHTGEKPYKCVECGKSFTHSLSLRTHQMTHTGEKPH 98


>gi|326667477|ref|XP_003198606.1| PREDICTED: zinc finger protein 37 [Danio rerio]
          Length = 366

 Score = 37.1 bits (85), Expect = 0.83,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 27/75 (36%), Gaps = 3/75 (4%)

Query: 32  MADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQF--- 88
             ++  +        Q+V++             + +   +KS  +    C + G  F   
Sbjct: 37  PQELIEMEEKHQCETQQVLATEEPHTEATQTSPRTSKSPQKSKPSSLFICCQCGKSFTRK 96

Query: 89  KSLKRHLKTHHNMTP 103
           +SL+ H+  H+   P
Sbjct: 97  QSLEGHMNLHNGEKP 111


>gi|327291693|ref|XP_003230555.1| PREDICTED: zinc finger and SCAN domain-containing protein 2-like,
           partial [Anolis carolinensis]
          Length = 406

 Score = 37.1 bits (85), Expect = 0.83,   Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 14/26 (53%), Gaps = 3/26 (11%)

Query: 81  CLEDGMQFKS---LKRHLKTHHNMTP 103
           CLE G  F     L+RHL+TH    P
Sbjct: 339 CLECGQSFTQSSGLRRHLRTHTGEKP 364


>gi|194743470|ref|XP_001954223.1| GF18167 [Drosophila ananassae]
 gi|190627260|gb|EDV42784.1| GF18167 [Drosophila ananassae]
          Length = 358

 Score = 37.1 bits (85), Expect = 0.83,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 3/35 (8%)

Query: 74  IENGCLYCLEDGMQFKS---LKRHLKTHHNMTPDE 105
           I +    C E G QF +   LKRHL  H    P  
Sbjct: 287 IRDKRYQCDECGKQFNTPTFLKRHLFAHTGQKPHS 321


>gi|326678048|ref|XP_003200970.1| PREDICTED: zinc finger protein 726-like isoform 2 [Danio rerio]
          Length = 389

 Score = 37.1 bits (85), Expect = 0.85,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 19/44 (43%), Gaps = 10/44 (22%)

Query: 77  GCLYCLEDGMQFK---SLKRHLKTHHNMTPDEYR-----IKWNL 112
             L C + G  FK   +LK H+ TH    P  Y+      ++ L
Sbjct: 56  NGLICTQCGKTFKNKHTLKTHVMTHSGEKP--YKCSHCDKRFGL 97


>gi|260800289|ref|XP_002595066.1| hypothetical protein BRAFLDRAFT_60125 [Branchiostoma floridae]
 gi|229280308|gb|EEN51077.1| hypothetical protein BRAFLDRAFT_60125 [Branchiostoma floridae]
          Length = 548

 Score = 37.1 bits (85), Expect = 0.85,   Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 3/26 (11%)

Query: 81  CLEDGMQFKS---LKRHLKTHHNMTP 103
           C E G QF+    LKRH++TH    P
Sbjct: 124 CGECGKQFRQVGHLKRHMRTHTGEKP 149


>gi|268562870|ref|XP_002646797.1| C. briggsae CBR-SEA-2 protein [Caenorhabditis briggsae]
 gi|187025000|emb|CAP35900.1| CBR-SEA-2 protein [Caenorhabditis briggsae AF16]
          Length = 2311

 Score = 37.1 bits (85), Expect = 0.85,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 45/130 (34%), Gaps = 19/130 (14%)

Query: 35   IGSLITDVHSAL----QRVVSRAPCQDNVQ-----PERLKPA---VPIRKSIENGCL--Y 80
            + S+IT V  ++    +   +  P  D  Q     PE   P+      R SI    +   
Sbjct: 1446 LDSIITSVPLSIDTNQKSAATNGPTADQGQSSIDSPETEDPSPTDGSSRGSISKRLIPYI 1505

Query: 81   CLEDGMQF---KSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLG 137
            C E    +   K++KRH    H M+ DE   K  L +   +         +        G
Sbjct: 1506 CPECDKIYSCRKNVKRHRMAVHKMSLDEVLAKPELPAPQELS--NVTRRHTVAGLESSEG 1563

Query: 138  RGRKKRVLTS 147