RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780783|ref|YP_003065196.1| transcription regulator protein [Candidatus Liberibacter asiaticus str. psy62] (149 letters) >gnl|CDD|106740 PRK13799, PRK13799, unknown domain/N-carbamoyl-L-amino acid hydrolase fusion protein; Provisional. Length = 591 Score = 29.2 bits (65), Expect = 0.44 Identities = 21/79 (26%), Positives = 30/79 (37%), Gaps = 9/79 (11%) Query: 39 ITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKS-LKRHLKT 97 I + AL V+ A + R P + K+ E G L G Q K+ L Sbjct: 43 IAAIKQALAGVLDAADRAAKLDLIRAHPELA-GKAAEAGELTAESTGEQAKAGLNL---- 97 Query: 98 HHNMTPDEYRIKWNLASDY 116 TP+E+ L +DY Sbjct: 98 ---CTPEEFAAIQKLNADY 113 >gnl|CDD|139033 PRK12518, PRK12518, RNA polymerase sigma factor; Provisional. Length = 175 Score = 27.4 bits (61), Expect = 1.7 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 10/57 (17%) Query: 82 LEDGMQ------FKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAK 132 L+D +Q +K L + L+ + YRI WN+A+D R++A S++ Sbjct: 37 LDDLVQEVFLRVWKGLPK-LRNPAYFSTWLYRITWNVATDA---RRQFAQRPSRIQD 89 >gnl|CDD|179962 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional. Length = 443 Score = 27.0 bits (61), Expect = 2.2 Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Query: 3 DDASFDSSERFLEMTVDIVAAYVSNHV 29 +D SF++ + E TV I AAYV + Sbjct: 404 EDISFEAPDMSGE-TVTIDAAYVDEKL 429 >gnl|CDD|152448 pfam12013, DUF3505, Protein of unknown function (DUF3505). This family of proteins is functionally uncharacterized. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. Length = 174 Score = 26.7 bits (59), Expect = 2.8 Identities = 16/84 (19%), Positives = 29/84 (34%), Gaps = 9/84 (10%) Query: 27 NHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQPERLKPAVPIRKSIENGCLYCLEDGM 86 +H +P A L + + Q P L P +P + +G G Sbjct: 34 HHHLPRATTQQLRQAIRQWDDLIRDPEAVQ---LPSALSPPIPGL-PVYDGYRCRAPPGC 89 Query: 87 QF-----KSLKRHLKTHHNMTPDE 105 + K++++H + HH T Sbjct: 90 PYITRSLKTMRKHWREHHGWTRAA 113 >gnl|CDD|132039 TIGR02994, ectoine_eutE, ectoine utilization protein EutE. Members of this family, part of the succinylglutamate desuccinylase / aspartoacylase family (pfam04952), belong to ectoine utilization operons, as found in Sinorhizobium meliloti 1021 (where it the operon is known to be induced by ectoine), Mesorhizobium loti, Silicibacter pomeroyi, Agrobacterium tumefaciens, and Pseudomonas putida. Length = 325 Score = 25.9 bits (57), Expect = 3.9 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 3/24 (12%) Query: 21 VAAYVSNHVVPMADIGSLITDVHS 44 +A Y H++P+ADI + D HS Sbjct: 124 IADYFQRHLLPLADI---VLDFHS 144 >gnl|CDD|80125 pfam05865, Cypo_polyhedrin, Cypovirus polyhedrin protein. This family consists of several Cypovirus polyhedrin protein. Polyhedrin is known to form a crystalline matrix (polyhedra) in infected insect cells. Length = 247 Score = 25.5 bits (55), Expect = 5.7 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Query: 88 FKSLKRHLKTHHNMTPDEYRIKWNLASDYP 117 FK+LK + + HN + DEY + N + YP Sbjct: 64 FKALKEYREGQHNDSYDEYEV--NQSIYYP 91 >gnl|CDD|182715 PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional. Length = 413 Score = 25.5 bits (56), Expect = 5.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Query: 18 VDIVAAYVSNHVVPMADIGSLITDV 42 VD VAA V+N VV +D+ L+ V Sbjct: 7 VDKVAAVVNNGVVLESDVDGLMQSV 31 >gnl|CDD|162544 TIGR01817, nifA, Nif-specific regulatory protein. This model represents NifA, a DNA-binding regulatory protein for nitrogen fixation. The model produces scores between the trusted and noise cutoffs for a well-described NifA homolog in Aquifex aeolicus (which lacks nitrogenase), for transcriptional activators of alternative nitrogenases (VFe or FeFe instead of MoFe), and truncated forms. Length = 534 Score = 25.4 bits (56), Expect = 5.9 Identities = 11/54 (20%), Positives = 21/54 (38%) Query: 2 DDDASFDSSERFLEMTVDIVAAYVSNHVVPMADIGSLITDVHSALQRVVSRAPC 55 + RFLEM +++ V H + LI + +++ +AP Sbjct: 133 RSRERLEEEVRFLEMVANLIGQTVRLHRLVAQRRERLIAEAVQLSKQLRDKAPE 186 >gnl|CDD|183826 PRK12904, PRK12904, preprotein translocase subunit SecA; Reviewed. Length = 830 Score = 25.0 bits (56), Expect = 7.2 Identities = 10/49 (20%), Positives = 21/49 (42%), Gaps = 8/49 (16%) Query: 1 MDDDASFDSSERFLEMTVDIVAAYVSNHVVP-----MADIGSLITDVHS 44 ++ + D SE L+M D++ V ++ P D+ L + + Sbjct: 649 LEGE---DLSETILDMREDVIEDLVDAYIPPGSYEEDWDLEGLEEALKT 694 >gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional. Length = 989 Score = 24.7 bits (53), Expect = 9.5 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 4/40 (10%) Query: 31 PMADIGSLITDVHSALQRVVSRA----PCQDNVQPERLKP 66 P D+ +L D+ V+RA P DNVQP R P Sbjct: 600 PEPDVVALRQDIPLETLHYVARAAMQAPSGDNVQPWRFVP 639 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.319 0.132 0.386 Gapped Lambda K H 0.267 0.0644 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,351,436 Number of extensions: 133875 Number of successful extensions: 255 Number of sequences better than 10.0: 1 Number of HSP's gapped: 255 Number of HSP's successfully gapped: 17 Length of query: 149 Length of database: 5,994,473 Length adjustment: 85 Effective length of query: 64 Effective length of database: 4,157,793 Effective search space: 266098752 Effective search space used: 266098752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (24.4 bits)