RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780783|ref|YP_003065196.1| transcription regulator protein [Candidatus Liberibacter asiaticus str. psy62] (149 letters) >d2gmya1 a.152.1.3 (A:2-148) Hypothetical protein Atu0492 {Agrobacterium tumefaciens [TaxId: 358]} Length = 147 Score = 27.8 bits (61), Expect = 0.40 Identities = 12/74 (16%), Positives = 27/74 (36%), Gaps = 2/74 (2%) Query: 61 PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120 R + +R SI NGC +C+ M K + + + + + ++ Sbjct: 30 EHRFIHLIKLRASIINGCAFCV--DMHVKESRHDGLSEQWINLMSVWRESPVYTEQERAL 87 Query: 121 REYATTRSKLAKNM 134 + +K+A+ Sbjct: 88 LGWVDAVTKIAETG 101 >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Score = 27.3 bits (61), Expect = 0.66 Identities = 6/23 (26%), Positives = 9/23 (39%), Gaps = 3/23 (13%) Query: 81 CLEDGMQFK---SLKRHLKTHHN 100 C F+ L H K +H+ Sbjct: 11 CSHCDKTFRQKQLLDMHFKRYHD 33 >d1wira_ g.37.1.5 (A:) Protein arginine N-methyltransferase 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 121 Score = 26.7 bits (59), Expect = 0.78 Identities = 9/35 (25%), Positives = 11/35 (31%) Query: 78 CLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNL 112 CL+C + H K H D K L Sbjct: 18 CLFCDRLFASAEETFSHCKLEHQFNIDSMVHKHGL 52 >d2frha1 a.4.5.28 (A:102-216) Pleiotropic regulator of virulence genes, SarA {Staphylococcus aureus [TaxId: 1280]} Length = 115 Score = 26.9 bits (59), Expect = 0.87 Identities = 8/70 (11%), Positives = 26/70 (37%), Gaps = 5/70 (7%) Query: 76 NGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMG 135 N C L LK +K +++ +E+ + ++ + +E + ++ Sbjct: 6 NDCFELLSMVTYADKLKSLIKKEFSISFEEFAVLTYISEN-----KEKEYYLKDIINHLN 60 Query: 136 LGRGRKKRVL 145 + + + + Sbjct: 61 YKQPQVVKAV 70 >d1pj5a4 d.250.1.1 (A:428-742) N,N-dimethylglycine oxidase domain 3 {Arthrobacter globiformis [TaxId: 1665]} Length = 315 Score = 25.3 bits (54), Expect = 2.5 Identities = 9/44 (20%), Positives = 15/44 (34%) Query: 86 MQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSK 129 F++ LK R W+ P+ + E TR+ Sbjct: 29 YWFEANAALLKEMPAEWLPPARDAWSGMFSSPIAAAEAWKTRTA 72 >d2o4da1 a.152.1.3 (A:2-145) Hypothetical protein PA0269 {Pseudomonas aeruginosa [TaxId: 287]} Length = 144 Score = 25.1 bits (54), Expect = 2.7 Identities = 12/74 (16%), Positives = 26/74 (35%), Gaps = 2/74 (2%) Query: 61 PERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDYPMVS 120 L V +R S NGC YC+ M ++ +T + + + + Sbjct: 30 ERPLIELVYLRTSQINGCAYCV--NMHANDARKAGETEQRLQALCVWQETPYFTPRERAA 87 Query: 121 REYATTRSKLAKNM 134 + ++L++ Sbjct: 88 LAWTEQLARLSQGA 101 >d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 123 Score = 24.3 bits (52), Expect = 4.4 Identities = 5/31 (16%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Query: 89 KSLKRHLKTHHNMTPDEYRIKW-NLASDYPM 118 K +++ + N+ +E +K+ + S Sbjct: 92 KLIQQTFRQFANLNREESILKFFEILSPVYR 122 >d1h76a2 c.94.1.2 (A:342-687) Transferrin {Pig (Sus scrofa) [TaxId: 9823]} Length = 346 Score = 24.3 bits (52), Expect = 4.7 Identities = 18/127 (14%), Positives = 33/127 (25%), Gaps = 11/127 (8%) Query: 25 VSNHVVPMADIGSLITDVHSALQRVVSRAPCQDNVQP--ERLKPAVPIRKSIENGCLYCL 82 GS AL C + + R G CL Sbjct: 141 FDQFFGEGCAPGSQRNSSLCAL--------CIGSERAPGRECLANNHERYYGYTGAFRCL 192 Query: 83 EDGMQFKSLKRH-LKTHHNMTPDEYRIKWNLASDYPMVSREYATTRSKLAKNMGLGRGRK 141 + +K ++ + + + K D+ ++ + A A+N L R Sbjct: 193 VEKGDVAFVKDQVVQQNTDGKNKDDWAKDLKQMDFELLCQNGAREPVDNAENCHLARAPN 252 Query: 142 KRVLTSK 148 V+ Sbjct: 253 HAVVARD 259 >d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Length = 271 Score = 24.1 bits (51), Expect = 4.8 Identities = 15/67 (22%), Positives = 23/67 (34%), Gaps = 2/67 (2%) Query: 57 DNVQPERLKPAVPIRKSIENGCLYCLEDGMQFKSLKRHLKTHHNMTPDEYRIKWNLASDY 116 D+ +K A I + G L G + + +LK H P +Y I +N A Sbjct: 19 DHTISPAVKNA--IAAARARGVNVVLTTGRPYAGVHNYLKELHMEQPGDYCITYNGALVQ 76 Query: 117 PMVSREY 123 Sbjct: 77 KAADGST 83 >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Score = 24.4 bits (53), Expect = 4.9 Identities = 8/21 (38%), Positives = 10/21 (47%), Gaps = 3/21 (14%) Query: 81 CLEDGMQFK---SLKRHLKTH 98 C E G F L +H +TH Sbjct: 15 CDECGKSFSHSSDLSKHRRTH 35 >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Score = 24.3 bits (52), Expect = 5.2 Identities = 8/32 (25%), Positives = 12/32 (37%), Gaps = 3/32 (9%) Query: 70 IRKSIENGCLYCLEDGMQFK---SLKRHLKTH 98 + + C G +FK L H+K H Sbjct: 22 MSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53 >d1fc3a_ a.4.6.3 (A:) Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 119 Score = 23.9 bits (52), Expect = 6.2 Identities = 6/19 (31%), Positives = 14/19 (73%) Query: 116 YPMVSREYATTRSKLAKNM 134 YP ++++Y TT S++ + + Sbjct: 51 YPDIAKKYNTTASRVERAI 69 >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Score = 23.5 bits (51), Expect = 7.3 Identities = 6/24 (25%), Positives = 8/24 (33%), Gaps = 3/24 (12%) Query: 81 CLEDGMQFK---SLKRHLKTHHNM 101 C + F L H K H + Sbjct: 14 CPDCDRSFSRSDHLALHRKRHMLV 37 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.319 0.132 0.386 Gapped Lambda K H 0.267 0.0499 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 528,015 Number of extensions: 22697 Number of successful extensions: 71 Number of sequences better than 10.0: 1 Number of HSP's gapped: 71 Number of HSP's successfully gapped: 20 Length of query: 149 Length of database: 2,407,596 Length adjustment: 77 Effective length of query: 72 Effective length of database: 1,350,386 Effective search space: 97227792 Effective search space used: 97227792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.2 bits)