>TIGR00757 RNaseEG ribonuclease, Rne/Rng family; InterPro: IPR004659 The eubacterial degradosome is a large, multiprotein, multienzyme complex involved in RNA processing and degradation in Escherichia coli and other proteobacteria . The components of the RNA degradosome in E. coli (EBI-1169250 from INTACT) are: Ribonuclease E (Rne), P21513 from SWISSPROT, IPR004659 from INTERPRO ATP-dependent RNA helicase (RhlB), P0A8J8 from SWISSPROT, IPR000629 from INTERPRO Polynucleotide phosphorylase (Pnp), , IPR012162 from INTERPRO Enolase (Eno), P0A6P9 from SWISSPROT, IPR000941 from INTERPRO Associated components: The chaperone protein DnaK (,IPR012725 from INTERPRO) associates to abnormal complexes in which the canonical components RhlB and PNPase are not present or present in limiting amount and could be involved in repairing such incorrectly assembled degradosomes. Polyphosphate kinase (Ppk), P0A7B1 from SWISSPROT, IPR003414 from INTERPRO appears to maintain an appropriate microenvironment, removing inhibitory polyphosphate and NDPs and regenerating ATP. Subunit composition of the E. coli degradosome(see: http://biocyc.org/ECOLI/NEW-IMAGE?type=POLYPEPTIDE&object=CPLX0-2381): [(Ppk)4][(Rne)4][(RhlB)2][(Pnp)3][(Eno)2] In vitro a "minimal" degradosome composed of only RNase E, PNPase and RhlB degrades malEF REP RNA in an ATP-dependent manner in vitro, with activity equivalent to purified whole degradosomes. RNase E enzymatic function is dispensible, whereas PNPase must be catalytically active and incorporated into the degradosome for degradation to occur . RNase E provides the organizational structure for the degradosome . It is tethered to the cytoplasmic membrane via its amino-terminus and its carboxy-terminal half, which is largly unstructured and poorly conserved, cooridnates the binding of PNPase, RhlB and enolase. The loss of this portion of the protein prevents degradation of a number of degradosome substrates, including the ptsG and mukB mRNAs and RNA I , , . Ribonuclease E 3.1.4 from EC is responsible for maturing 5S rRNA from its precursors from all the rRNA genes. It also cleaves RNA I, a molecule that controls the replication of ColE1 plasmid DNA. It is the major endoribonuclease participating in mRNA turnover in Escherichia coli, and initiates decay of RNAs by cutting them internally near their 5'-end. It is able to remove poly A tails by an endonucleolytic process. Ribonuclease G is smaller than RNase E lacking the C-terminal region. It is involved in processing of the 5' end of 16S rRNA, and may be involved in chromosome segregation and cell division too. RNase E is a major subunit the eubacterial degradosome. It is a large, multiprotein, multienzyme complex involved in RNA processing and degradation in Escherichia coli and other proteobacteria . It consists of the RNA degradation enzymes RNase E (Rne) and PNPase (Pnp), as well as the ATP-dependent RNA helicase (RhlB) and the metabolic enzyme enolase (Eno) , , .; GO: 0004540 ribonuclease activity, 0006396 RNA processing, 0005737 cytoplasm.

Probab=95.43  E-value=0.0064  Score=42.44  Aligned_cols=64  Identities=31%  Similarity=0.586  Sum_probs=53.0

Q ss_pred             CCCCCEEEEEEEEEEE--CCEEEECCCCCCEEEEEEECCCC---------------------------CC----------
Q ss_conf             5468678999999941--53699828797104886631444---------------------------54----------
Q gi|254780784|r  617 PEVNKIYKGQVVKVMD--FGAFVHFCGARDGLVHISQLSTE---------------------------RV----------  657 (699)
Q Consensus       617 ~e~g~~y~~~v~~i~~--fGafve~~~g~~gl~HiS~l~~~---------------------------~v----------  657 (699)
T Consensus        25 ~~~GnIY~G~V~~vlPsl~AAFvdiG~~~~GFLh~sdi~~~~~~~~~~~~~d~~NA~~~a~~~~~~~~~~~~kp~~~~QS  104 (464)
T TIGR00757        25 QLVGNIYKGRVTRVLPSLQAAFVDIGLEKNGFLHASDIGENSEKLEQLVDTDDDNAEAEAAPAEAKREAGQEKPEEIIQS  104 (464)
T ss_pred             CCHHHHHHCEEEEECCCCCEEEEECCCCCCCCCCHHHCCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCHHHHCC
T ss_conf             11002320202022037644774206883556303320332456888862021257677882332201001362132025


Q ss_pred             ------------CCHHHHCCCCCEEEEEEEEECCCC
Q ss_conf             ------------785560325988999999786899
Q gi|254780784|r  658 ------------AKTSDVVKEGDTVWVKLLDFDDRG  681 (699)
Q Consensus       658 ------------~~~~d~~~~Gd~i~vk~~~~d~~g  681 (699)
T Consensus       105 ~~~~~~~~~~~~~~I~e~L~~gq~vlVQV~K-ep~G  139 (464)
T TIGR00757       105 SGDELERRQSKTASISELLRPGQSVLVQVVK-EPRG  139 (464)
T ss_pred             CHHHHHHHHCCCCCHHHHHCCCCEEEEEEEE-CCCC
T ss_conf             3024554313543526661288858999885-2678