>cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain. PNPase is a polyribonucleotide nucleotidyl transferase that degrades mRNA. It is a trimeric multidomain protein. The C-terminus contains the S1 domain which binds ssRNA. This family is classified based on the S1 domain. PNPase nonspecifically removes the 3' nucleotides from mRNA, but is stalled by double-stranded RNA structures such as a stem-loop. Evidence shows that a minimum of 7-10 unpaired nucleotides at the 3' end, is required for PNPase degradation. It is suggested that PNPase also dephosphorylates the RNA 5' end. This additional activity may regulate the 5'-dependent activity of RNaseE in vivo.

Probab=99.68 E-value=1.1e-16 Score=154.42 Aligned_cols=68 Identities=60% Similarity=0.937 Sum_probs=67.0 Q ss_pred CCEEEEEEEEEEECCEEEECCCCCCEEEEEEECCCCCCCCHHHHCCCCCEEEEEEEEECCCCCEEEEE Q ss_conf 86789999999415369982879710488663144454785560325988999999786899866687 Q gi|254780784|r 620 NKIYKGQVVKVMDFGAFVHFCGARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLDFDDRGKIKLSM 687 (699) Q Consensus 620 g~~y~~~v~~i~~fGafve~~~g~~gl~HiS~l~~~~v~~~~d~~~~Gd~i~vk~~~~d~~g~i~lSr 687 (699) T Consensus 1 G~iv~G~V~~i~~fG~FV~l~~g~~GLiHiSeis~~~v~~~~~~~~~Gd~v~vkVi~iD~~~ri~LSr 68 (68) T cd04472 1 GKIYEGKVVKIKDFGAFVEILPGKDGLVHISELSDERVEKVEDVLKVGDEVKVKVIEVDDRGRISLSR 68 (68) T ss_pred CCEEEEEEEEEECCEEEEEECCCCEEEEEHHHHCCCCCCCHHHHCCCCCEEEEEEEEECCCCCCCCCC T ss_conf 99999999999732999995799624888689345654698890789999999999999999720529

HHsearch alignment for GI: 254780784 and conserved domain: cd04472