>cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 3 (ec3) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=99.45 E-value=2.6e-13 Score=127.00 Aligned_cols=66 Identities=47% Similarity=0.734 Sum_probs=63.1 Q ss_pred CCCEEEEEEEEEEECCEEEECCCCCCEEEEEEECCCCCCCCHHHHCCCCCEEEEEEEEECC-CCCEEE Q ss_conf 6867899999994153699828797104886631444547855603259889999997868-998666 Q gi|254780784|r 619 VNKIYKGQVVKVMDFGAFVHFCGARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLDFDD-RGKIKL 685 (699) Q Consensus 619 ~g~~y~~~v~~i~~fGafve~~~g~~gl~HiS~l~~~~v~~~~d~~~~Gd~i~vk~~~~d~-~g~i~l 685 (699) T Consensus 1 eG~iv~g~V~~i~~fG~FV~l-~gi~Glihisels~~~~~~~~~~~k~Gd~v~~kVi~iD~~k~rIsL 67 (68) T cd05688 1 EGDVVEGTVKSITDFGAFVDL-GGVDGLLHISDMSWGRVKHPSEVVNVGDEVEVKVLKIDKERKRISL 67 (68) T ss_pred CCCEEEEEEEEEECCEEEEEE-CCEEEEEECHHHCCCCCCCHHHHCCCCCEEEEEEEEEECCCCEECC T ss_conf 999999999999563889997-9989999843646666689889147999999999999999798649

HHsearch alignment for GI: 254780784 and conserved domain: cd05688