>cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 4 (hs4). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=98.10 E-value=1e-05 Score=65.19 Aligned_cols=68 Identities=28% Similarity=0.443 Sum_probs=60.9 Q ss_pred CCEEE-EEEEEEEE-CCEEEECCCCCCEEEEEEECCCCCCCCHHHHCCCCCEEEEEEEEECCC-CCEEEEE Q ss_conf 86789-99999941-536998287971048866314445478556032598899999978689-9866687 Q gi|254780784|r 620 NKIYK-GQVVKVMD-FGAFVHFCGARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLDFDDR-GKIKLSM 687 (699) Q Consensus 620 g~~y~-~~v~~i~~-fGafve~~~g~~gl~HiS~l~~~~v~~~~d~~~~Gd~i~vk~~~~d~~-g~i~lSr 687 (699) T Consensus 1 G~i~~~~~V~~v~~~~G~~~~l~~g~~gfvhiS~lsD~kv~~~~~~fk~Gs~H~~RVig~s~~D~l~~lSL 71 (71) T cd05696 1 GAVVDSVKVTKVEPDLGAVFELKDGLLGFVHISHLSDDKVPSDTGPFKAGTTHKARIIGYSPMDGLLQLSL 71 (71) T ss_pred CCCCCEEEEEEECCCCCEEEEECCCCEEEEEEHHCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCEEEECC T ss_conf 96233405999858853799969996899996012666423665786479988899983474341488419

HHsearch alignment for GI: 254780784 and conserved domain: cd05696