>cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 13 (hs13). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=98.47 E-value=1.4e-06 Score=72.18 Aligned_cols=71 Identities=30% Similarity=0.338 Sum_probs=66.0 Q ss_pred CCCCCEEEEEEEEEEE-CCEEEECCCCCCEEEEEEECCCCCCCCHHHHCCCCCEEEEEEEEECCCCCEEEEEE Q ss_conf 5468678999999941-53699828797104886631444547855603259889999997868998666873 Q gi|254780784|r 617 PEVNKIYKGQVVKVMD-FGAFVHFCGARDGLVHISQLSTERVAKTSDVVKEGDTVWVKLLDFDDRGKIKLSMK 688 (699) Q Consensus 617 ~e~g~~y~~~v~~i~~-fGafve~~~g~~gl~HiS~l~~~~v~~~~d~~~~Gd~i~vk~~~~d~~g~i~lSrk 688 (699) T Consensus 1 L~~G~i~~G~V~kV~p~~Gl~Vqlp~g~~G~V~itdl~D~y~~~Pl~~f~~~qiVrc~VLs~-~~g~~~LSlR 72 (72) T cd05704 1 LEEGAVTLGMVTKVIPHSGLTVQLPFGKTGLVSIFHLSDSYTENPLEGFKPGKIVRCCILSK-KDGKYQLSLR 72 (72) T ss_pred CCCCCEEEEEEEEECCCCCEEEECCCCCEEEEEEEEECCCCCCCCHHHCCCCCEEEEEEEEC-CCCEEEEEEC T ss_conf 98874740399997289856998489966689999714745449677657897899999953-6998998749

HHsearch alignment for GI: 254780784 and conserved domain: cd05704