>cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. ScCSL4 protein is a subunit of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In S. cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".

Probab=96.60 E-value=0.011 Score=40.38 Aligned_cols=73 Identities=21% Similarity=0.275 Sum_probs=62.6 Q ss_pred CCCCCCEEEEEEEEEEECCEEEECCC--------CCCEEEEEEECCCCCCCCH--HHHCCCCCEEEEEEEEECCCCCEEE Q ss_conf 75468678999999941536998287--------9710488663144454785--5603259889999997868998666 Q gi|254780784|r 616 VPEVNKIYKGQVVKVMDFGAFVHFCG--------ARDGLVHISQLSTERVAKT--SDVVKEGDTVWVKLLDFDDRGKIKL 685 (699) Q Consensus 616 ~~e~g~~y~~~v~~i~~fGafve~~~--------g~~gl~HiS~l~~~~v~~~--~d~~~~Gd~i~vk~~~~d~~g~i~l 685 (699) T Consensus 3 lP~vGdiV~~rVtrv~~~~a~v~Il~v~~~~l~~~f~g~Ir~~dVr~te~d~v~m~~~FrpGDIVrA~Vislgd~~~y~L 82 (92) T cd05791 3 LPKVGSIVIARVTRINPRFAKVDILCVGGRPLKESFRGVIRKEDIRATEKDKVEMYKCFRPGDIVRAKVISLGDASSYYL 82 (92) T ss_pred CCCCCCEEEEEEEEECCCEEEEEEEEECCEECCCEEEEEEEHHHCCCCCCCCEEHHHCCCCCCEEEEEEEECCCCCEEEE T ss_conf 68899999999999711378999999999983762578879244343555304341354999899999997478724999 Q ss_pred EEE Q ss_conf 873 Q gi|254780784|r 686 SMK 688 (699) Q Consensus 686 Srk 688 (699) T Consensus 83 STa 85 (92) T cd05791 83 STA 85 (92) T ss_pred EEC T ss_conf 853

HHsearch alignment for GI: 254780784 and conserved domain: cd05791