RPSBLAST alignment for GI: 254780784 and conserved domain: cd05690

>gnl|CDD|88445 cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 5 (ec5) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.. Length = 69
 Score = 46.4 bits (110), Expect = 2e-05
 Identities = 27/64 (42%), Positives = 39/64 (60%), Gaps = 2/64 (3%)

Query: 624 KGQVVKVMDFGAFVHFCGARDGLVHISQLS-TERVAKTSDVVKEGDTVWVKLLDFD-DRG 681
            G++  + DFG FV   G  DGLVHIS +S T+RV   S++ K+G  V   +L+ D +R 
Sbjct: 5   SGKIKSITDFGIFVGLDGGIDGLVHISDISWTQRVRHPSEIYKKGQEVEAVVLNIDVERE 64

Query: 682 KIKL 685
           +I L
Sbjct: 65  RISL 68