RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780785|ref|YP_003065198.1| 30S ribosomal protein S15 [Candidatus Liberibacter asiaticus str. psy62] (89 letters) >d1vs5o1 a.16.1.2 (O:1-88) Ribosomal protein S15 {Escherichia coli [TaxId: 562]} Length = 88 Score = 102 bits (255), Expect = 1e-23 Identities = 42/88 (47%), Positives = 58/88 (65%) Query: 2 SITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLIS 61 S++ E +++ E+ DTGS EVQVA+ T +I +L HF KKD +S+ GL R++S Sbjct: 1 SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHHSRRGLLRMVS 60 Query: 62 LRSSLLKYLERKDVERYKRLVQSLKLRR 89 R LL YL+RKDV RY RL++ L LRR Sbjct: 61 QRRKLLDYLKRKDVARYTRLIERLGLRR 88 >d1a32a_ a.16.1.2 (A:) Ribosomal protein S15 {Bacillus stearothermophilus [TaxId: 1422]} Length = 85 Score = 98.2 bits (245), Expect = 2e-22 Identities = 42/85 (49%), Positives = 60/85 (70%) Query: 3 ITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLISL 62 +T ERKRE+++++ V DTGSPEVQ+A+ TE+I NL EH + KKD +S+ GL +++ Sbjct: 1 LTQERKREIIEQFKVHENDTGSPEVQIAILTEQINNLNEHLRVHKKDHHSRRGLLKMVGK 60 Query: 63 RSSLLKYLERKDVERYKRLVQSLKL 87 R LL YL KDV RY+ +V+ L L Sbjct: 61 RRRLLAYLRNKDVARYREIVEKLGL 85 >d1kuqa_ a.16.1.2 (A:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} Length = 84 Score = 97.1 bits (242), Expect = 4e-22 Identities = 40/82 (48%), Positives = 58/82 (70%) Query: 6 ERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSS 65 E K+++++E+A PGDTGS EVQVA+ T RI L+EH K KKD +S GL ++ R Sbjct: 3 EEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRR 62 Query: 66 LLKYLERKDVERYKRLVQSLKL 87 LL+YL+R+D ERY+ L++ L + Sbjct: 63 LLRYLQREDPERYRALIEKLGI 84 >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Score = 24.8 bits (53), Expect = 1.9 Identities = 8/44 (18%), Positives = 19/44 (43%) Query: 16 AVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRL 59 A+ PG +P V+ + N + +A++ ++ K + Sbjct: 182 AICPGWVRTPLVEKQISALAEKNGVDQETAARELLSEKQPSLQF 225 >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 215 Score = 24.0 bits (51), Expect = 4.0 Identities = 6/16 (37%), Positives = 11/16 (68%) Query: 71 ERKDVERYKRLVQSLK 86 E++ E++ R V+ LK Sbjct: 1 EKELYEKWMRTVEMLK 16 >d1fcqa_ c.1.8.9 (A:) Bee venom hyaluronidase {Honeybee (Apis mellifera) [TaxId: 7460]} Length = 321 Score = 23.3 bits (50), Expect = 6.7 Identities = 5/19 (26%), Positives = 12/19 (63%) Query: 36 IANLTEHFKSAKKDVNSKI 54 + NLT+H + + + ++I Sbjct: 72 LGNLTKHLQVFRDHLINQI 90 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.132 0.348 Gapped Lambda K H 0.267 0.0489 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 302,684 Number of extensions: 11517 Number of successful extensions: 27 Number of sequences better than 10.0: 1 Number of HSP's gapped: 27 Number of HSP's successfully gapped: 7 Length of query: 89 Length of database: 2,407,596 Length adjustment: 53 Effective length of query: 36 Effective length of database: 1,679,906 Effective search space: 60476616 Effective search space used: 60476616 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.5 bits)