BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780785|ref|YP_003065198.1| 30S ribosomal protein S15 [Candidatus Liberibacter asiaticus str. psy62] (89 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780785|ref|YP_003065198.1| 30S ribosomal protein S15 [Candidatus Liberibacter asiaticus str. psy62] Length = 89 Score = 178 bits (451), Expect = 2e-47, Method: Compositional matrix adjust. Identities = 89/89 (100%), Positives = 89/89 (100%) Query: 1 MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLI 60 MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLI Sbjct: 1 MSITLERKRELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAKKDVNSKIGLGRLI 60 Query: 61 SLRSSLLKYLERKDVERYKRLVQSLKLRR 89 SLRSSLLKYLERKDVERYKRLVQSLKLRR Sbjct: 61 SLRSSLLKYLERKDVERYKRLVQSLKLRR 89 >gi|254780355|ref|YP_003064768.1| type II citrate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Score = 25.4 bits (54), Expect = 0.21, Method: Composition-based stats. Identities = 16/39 (41%), Positives = 18/39 (46%) Query: 9 RELMKEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSAK 47 RE M E G P QVA+ ERIA E+F K Sbjct: 319 RETMYEVLEVTGRFNDPIAQVAIELERIALEDEYFIERK 357 >gi|254780225|ref|YP_003064638.1| peptidyl-tRNA hydrolase [Candidatus Liberibacter asiaticus str. psy62] Length = 189 Score = 24.6 bits (52), Expect = 0.30, Method: Compositional matrix adjust. Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Query: 31 VCTERIANLTEHFKSAKKDVNSKIGLGRLISLRSSLLK 68 +C +RI + F + KK +++I G+L LR+ L+K Sbjct: 24 MCIDRIHSF-HFFPAWKKKFHAEISEGQLDGLRTILIK 60 >gi|254780218|ref|YP_003064631.1| thymidylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 225 Score = 23.9 bits (50), Expect = 0.51, Method: Compositional matrix adjust. Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 4/31 (12%) Query: 49 DVNSKIGLGRL---ISLR-SSLLKYLERKDV 75 D+ IGL R+ SLR S+ L Y ERKDV Sbjct: 137 DLPVDIGLKRVQNRYSLRESACLDYFERKDV 167 >gi|254780945|ref|YP_003065358.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter asiaticus str. psy62] Length = 700 Score = 21.2 bits (43), Expect = 3.8, Method: Compositional matrix adjust. Identities = 11/34 (32%), Positives = 14/34 (41%) Query: 13 KEYAVSPGDTGSPEVQVAVCTERIANLTEHFKSA 46 K Y + P E ER +L EHF S+ Sbjct: 484 KAYWICPQIEEKKESNFRSVVERFNSLHEHFTSS 517 >gi|254780661|ref|YP_003065074.1| exonuclease I [Candidatus Liberibacter asiaticus str. psy62] Length = 471 Score = 20.8 bits (42), Expect = 4.8, Method: Composition-based stats. Identities = 9/18 (50%), Positives = 11/18 (61%) Query: 68 KYLERKDVERYKRLVQSL 85 K L R +E YK +QSL Sbjct: 426 KMLTRSRIEEYKNKLQSL 443 >gi|254780670|ref|YP_003065083.1| phosphopyruvate hydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Score = 20.4 bits (41), Expect = 5.8, Method: Composition-based stats. Identities = 7/12 (58%), Positives = 9/12 (75%) Query: 23 GSPEVQVAVCTE 34 GSP ++V VC E Sbjct: 16 GSPTIEVDVCLE 27 >537021.9.peg.410_1 Length = 952 Score = 20.4 bits (41), Expect = 6.5, Method: Composition-based stats. Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 64 SSLLKYLERKDVERYKRLV 82 S L+K+L++ E Y RL+ Sbjct: 633 SDLIKHLKKSTQEEYNRLL 651 >gi|254780259|ref|YP_003064672.1| 50S ribosomal protein L23 [Candidatus Liberibacter asiaticus str. psy62] Length = 110 Score = 19.6 bits (39), Expect = 9.1, Method: Compositional matrix adjust. Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 62 LRSSLLKYLERKDVER 77 +RSS Y+ RKDV+R Sbjct: 78 VRSSRDMYVSRKDVKR 93 >gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 19.6 bits (39), Expect = 9.3, Method: Compositional matrix adjust. Identities = 6/14 (42%), Positives = 13/14 (92%) Query: 61 SLRSSLLKYLERKD 74 S+R+ +++Y+ER+D Sbjct: 112 SVRARIVEYIERED 125 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.132 0.348 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,139 Number of Sequences: 1233 Number of extensions: 1639 Number of successful extensions: 12 Number of sequences better than 100.0: 12 Number of HSP's better than 100.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of query: 89 length of database: 328,796 effective HSP length: 57 effective length of query: 32 effective length of database: 258,515 effective search space: 8272480 effective search space used: 8272480 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 31 (16.5 bits)