PSIBLAST alignment of GI: 254780786 and protein with PDB id: 1kkg

>gi|227968183|pdb|1KKG|A Chain A, Nmr Structure Of Ribosome-Binding Factor A (Rbfa) Length = 108
 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 56/109 (51%), Gaps = 6/109 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A VY++   D 
Sbjct: 3   KEFGRPQRVAQEMQKEIALILQR-EIKDPRL-GMMTTVSGVEMSRDLAYAKVYVTFLNDK 60

Query: 67  SPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWK 112
             D V   I AL     FIR  +G+++R LR VPEL F YD SL    +
Sbjct: 61  DEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMR 108