BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780786|ref|YP_003065199.1| ribosome-binding factor A
[Candidatus Liberibacter asiaticus str. psy62]
         (128 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|298293851|ref|YP_003695790.1| ribosome-binding factor A [Starkeya novella DSM 506]
 gi|296930362|gb|ADH91171.1| ribosome-binding factor A [Starkeya novella DSM 506]
          Length = 141

 Score =  152 bits (385), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 51/131 (38%), Positives = 76/131 (58%), Gaps = 4/131 (3%)

Query: 1   MKNK---NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVAT 57
           MKN+       S+R LRVGE VR AL  ++   +  D  +S+ +I++ EV MS DL++AT
Sbjct: 1   MKNRASSGSGPSQRQLRVGELVRHALAEILARGDLPDPALSKVMITVPEVRMSPDLKIAT 60

Query: 58  VYISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
            Y+           I AL  N K +RG I R +  L++VPELRFR DTS +   +++AL+
Sbjct: 61  CYVMPLGGKDHKAAIDALATNAKPLRGEIARRV-ELKFVPELRFRIDTSFEEGDRIDALL 119

Query: 118 CLPKIPVALEK 128
             P++   L+K
Sbjct: 120 RSPQVQRDLDK 130


>gi|170750124|ref|YP_001756384.1| ribosome-binding factor A [Methylobacterium radiotolerans JCM 2831]
 gi|259552029|sp|B1LWZ6|RBFA_METRJ RecName: Full=Ribosome-binding factor A
 gi|170656646|gb|ACB25701.1| ribosome-binding factor A [Methylobacterium radiotolerans JCM 2831]
          Length = 142

 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 41/126 (32%), Positives = 69/126 (54%), Gaps = 1/126 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K  +   S+R  RV E VR AL  V+   + QD ++   V+++ EV MS DL++AT Y+ 
Sbjct: 4   KPTSTGPSQRQQRVAELVRHALAEVLQRGDIQDPVLGTHVVTVPEVRMSPDLKLATAYVM 63

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               +    VI+AL  + K +R  + R + NL++ PELRFR D +     +++ L+   +
Sbjct: 64  PLGGLDEAPVIAALERHRKVLRQAVARRV-NLKFAPELRFRRDETFDEAARIDRLLRDER 122

Query: 122 IPVALE 127
           +   L+
Sbjct: 123 VQRDLD 128


>gi|188582063|ref|YP_001925508.1| ribosome-binding factor A [Methylobacterium populi BJ001]
 gi|259552026|sp|B1ZDQ7|RBFA_METPB RecName: Full=Ribosome-binding factor A
 gi|179345561|gb|ACB80973.1| ribosome-binding factor A [Methylobacterium populi BJ001]
          Length = 145

 Score =  147 bits (373), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 44/126 (34%), Positives = 67/126 (53%), Gaps = 1/126 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K      S+R  RV E VR AL  V+   + QD ++   V+++ EV MS DL++AT Y+ 
Sbjct: 4   KQTPSGPSQRQQRVAELVRHALAEVLQRGDIQDPVLGSHVVTVPEVRMSPDLKLATAYVM 63

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI+AL  + K +R  + R + NL+Y PELRFR D +     +++ L+   K
Sbjct: 64  PLGGQDEAPVIAALERHKKILRQEVARRV-NLKYAPELRFRRDETFDEAARIDQLLRSEK 122

Query: 122 IPVALE 127
           +   LE
Sbjct: 123 VQRDLE 128


>gi|299133372|ref|ZP_07026567.1| ribosome-binding factor A [Afipia sp. 1NLS2]
 gi|298593509|gb|EFI53709.1| ribosome-binding factor A [Afipia sp. 1NLS2]
          Length = 140

 Score =  147 bits (372), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 43/120 (35%), Positives = 66/120 (55%), Gaps = 1/120 (0%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R LRVGE +R A+  ++      D  +S  +I++ EV MS DL++ATVY+      
Sbjct: 15  GGSQRQLRVGELIRHAISDILSQGGVHDDTLSGHIITVPEVRMSPDLKLATVYVMPLGGH 74

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             D VI+AL  N KF+RG +   + NL++ P+LRFR D       ++  L+  P +   L
Sbjct: 75  DTDAVIAALAHNKKFLRGEVAHRV-NLKFAPDLRFRADERFDEAERIEKLLRTPAVQKDL 133


>gi|218530873|ref|YP_002421689.1| ribosome-binding factor A [Methylobacterium chloromethanicum CM4]
 gi|259552017|sp|B7KQJ7|RBFA_METC4 RecName: Full=Ribosome-binding factor A
 gi|218523176|gb|ACK83761.1| ribosome-binding factor A [Methylobacterium chloromethanicum CM4]
          Length = 145

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 67/126 (53%), Gaps = 1/126 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K      ++R  RV E +R AL  V+   + QD ++   V+++ EV MS DL++AT Y+ 
Sbjct: 4   KQTPSGPTQRQQRVAELIRHALAEVLQRGDIQDPVLGSHVVTVPEVRMSPDLKLATAYVM 63

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI+AL  + K +R  + R + NL++ P+LRFR D +     +++ L+   K
Sbjct: 64  PLGGQDEAPVIAALERHKKILRQEVARRV-NLKFAPDLRFRRDETFDEAARIDQLLRSEK 122

Query: 122 IPVALE 127
           +   LE
Sbjct: 123 VQRDLE 128


>gi|288959701|ref|YP_003450042.1| ribosome-binding factor A [Azospirillum sp. B510]
 gi|288912009|dbj|BAI73498.1| ribosome-binding factor A [Azospirillum sp. B510]
          Length = 190

 Score =  147 bits (371), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 38/122 (31%), Positives = 64/122 (52%), Gaps = 1/122 (0%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
               S+R LRVGEE+R AL  +    +F D  ++   ++++EV +S DL  ATV+ S   
Sbjct: 12  GKPPSQRQLRVGEELRHALADLFRRGDFHDPELASLNVTVTEVRISPDLSNATVFYSTLG 71

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               +    AL     F+RG++   + NLR+ P L F  DTS     ++++++  P++  
Sbjct: 72  GERMEEAQVALKRAAAFLRGQVA-RMVNLRHAPTLSFEGDTSFDYAHRIDSILHSPEVAR 130

Query: 125 AL 126
            L
Sbjct: 131 DL 132


>gi|163852115|ref|YP_001640158.1| ribosome-binding factor A [Methylobacterium extorquens PA1]
 gi|240139444|ref|YP_002963919.1| ribosome-binding factor A [Methylobacterium extorquens AM1]
 gi|254561859|ref|YP_003068954.1| ribosome-binding factor A [Methylobacterium extorquens DM4]
 gi|259552020|sp|A9W681|RBFA_METEP RecName: Full=Ribosome-binding factor A
 gi|163663720|gb|ABY31087.1| ribosome-binding factor A [Methylobacterium extorquens PA1]
 gi|240009416|gb|ACS40642.1| ribosome-binding factor A [Methylobacterium extorquens AM1]
 gi|254269137|emb|CAX25101.1| ribosome-binding factor A [Methylobacterium extorquens DM4]
          Length = 145

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 40/126 (31%), Positives = 67/126 (53%), Gaps = 1/126 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K      ++R  RV E +R AL  V+   + QD ++   V+++ EV MS DL++AT Y+ 
Sbjct: 4   KQTPSGPTQRQQRVAELIRHALAEVLQRGDIQDPVLGSHVVTVPEVRMSPDLKLATAYVM 63

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI+AL  + K +R  + R + NL++ P+LRFR D +     +++ L+   K
Sbjct: 64  PLGGQDEAPVIAALERHKKILRQEVARRV-NLKFAPDLRFRRDETFDEAARIDQLLRSEK 122

Query: 122 IPVALE 127
           +   LE
Sbjct: 123 VQRDLE 128


>gi|163757751|ref|ZP_02164840.1| ribosome-binding factor A [Hoeflea phototrophica DFL-43]
 gi|162285253|gb|EDQ35535.1| ribosome-binding factor A [Hoeflea phototrophica DFL-43]
          Length = 148

 Score =  146 bits (370), Expect = 8e-34,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 82/126 (65%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K      S+R LRVGE+VR+A+  V+   + +D ++S  +IS++EV MS DL+VAT Y++
Sbjct: 3   KPTTSAPSQRMLRVGEQVRAAITQVLQRGDIRDPILSNTLISVTEVRMSPDLQVATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                     I+ALN N +FIRGRI   LR +R +PELRFR DTS ++Y K++AL+  P+
Sbjct: 63  PLGVEDHAATIAALNKNARFIRGRISPDLRQMRNIPELRFRDDTSFENYSKIDALLRSPE 122

Query: 122 IPVALE 127
           +   L+
Sbjct: 123 VARDLD 128


>gi|90422005|ref|YP_530375.1| ribosome-binding factor A [Rhodopseudomonas palustris BisB18]
 gi|122477505|sp|Q21C30|RBFA_RHOPB RecName: Full=Ribosome-binding factor A
 gi|90104019|gb|ABD86056.1| ribosome-binding factor A [Rhodopseudomonas palustris BisB18]
          Length = 137

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 44/127 (34%), Positives = 70/127 (55%), Gaps = 1/127 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K ++P  S+R LRVGE VR A+  ++      D ++   +I++ EV MS DL++ATVY+ 
Sbjct: 7   KAQSPGGSQRQLRVGEIVRHAVAELLSQGGVHDPVLEGHLITVPEVRMSPDLKLATVYVM 66

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                  D V+ AL  N  FIR  + R + NL++ P+LRFR D       ++  L+  P 
Sbjct: 67  PLGGRDTDVVLKALAANKPFIRTAVARRV-NLKFAPDLRFRIDERFDEAERIEKLLRTPG 125

Query: 122 IPVALEK 128
           +   L++
Sbjct: 126 VQKDLQQ 132


>gi|115522224|ref|YP_779135.1| ribosome-binding factor A [Rhodopseudomonas palustris BisA53]
 gi|122298068|sp|Q07V79|RBFA_RHOP5 RecName: Full=Ribosome-binding factor A
 gi|115516171|gb|ABJ04155.1| ribosome-binding factor A [Rhodopseudomonas palustris BisA53]
          Length = 138

 Score =  146 bits (369), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 43/126 (34%), Positives = 71/126 (56%), Gaps = 1/126 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           KN   + S+R LRVGE VR A+  ++      D ++   ++++ EV MS DL++AT+Y+ 
Sbjct: 7   KNSGREASQRQLRVGESVRHAIAEILAQGGVHDPVLEGHLVTVPEVRMSPDLKLATIYVM 66

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                  + V+ AL+ N KF+RG + R + NL++ PELRFR D       ++  L+  P 
Sbjct: 67  PLGGRDTELVLKALDHNKKFLRGEVSRRV-NLKFAPELRFRADDRFDEAERIEKLLRTPA 125

Query: 122 IPVALE 127
           +   L+
Sbjct: 126 VQRDLQ 131


>gi|148560113|ref|YP_001259960.1| ribosome-binding factor A [Brucella ovis ATCC 25840]
 gi|225626531|ref|ZP_03784570.1| ribosome-binding factor A [Brucella ceti str. Cudo]
 gi|237816506|ref|ZP_04595499.1| ribosome-binding factor A [Brucella abortus str. 2308 A]
 gi|148371370|gb|ABQ61349.1| ribosome-binding factor A [Brucella ovis ATCC 25840]
 gi|225618188|gb|EEH15231.1| ribosome-binding factor A [Brucella ceti str. Cudo]
 gi|237788573|gb|EEP62788.1| ribosome-binding factor A [Brucella abortus str. 2308 A]
          Length = 197

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  V+   E +D LI R VIS+SEV MS DL++AT +I+      P
Sbjct: 61  SQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADP 120

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             VI AL  + KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 121 QAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDL 178


>gi|118590501|ref|ZP_01547903.1| ribosome-binding factor A [Stappia aggregata IAM 12614]
 gi|118436964|gb|EAV43603.1| ribosome-binding factor A [Stappia aggregata IAM 12614]
          Length = 170

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 41/125 (32%), Positives = 70/125 (56%), Gaps = 1/125 (0%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
            +   S+R LRVGE VR  L  ++    F D  +   +++I EV M+ DLR+AT  +   
Sbjct: 37  DSRGPSQRQLRVGETVRKELSDILTRGRFSDPDLDGVIVTIPEVRMTPDLRLATCLVMPL 96

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
             V+ + V  ALN + K++RG++ R L  ++Y+P+LRF  DT      ++  L+  P++ 
Sbjct: 97  GGVNAENVEKALNRSAKYLRGQVSRRL-TMKYMPDLRFVLDTRFDDDDRIGTLLHSPEVS 155

Query: 124 VALEK 128
             L++
Sbjct: 156 RDLDE 160


>gi|83313169|ref|YP_423433.1| ribosome-binding factor A [Magnetospirillum magneticum AMB-1]
 gi|123540595|sp|Q2VZV1|RBFA_MAGMM RecName: Full=Ribosome-binding factor A
 gi|82948010|dbj|BAE52874.1| Ribosome-binding factor A [Magnetospirillum magneticum AMB-1]
          Length = 142

 Score =  146 bits (368), Expect = 1e-33,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 69/127 (54%), Gaps = 1/127 (0%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M       S+R LRVGEE+R A+  VI   EF+D  +    I+++EV +S DLR ATV++
Sbjct: 1   MSRGAKPPSQRQLRVGEELRHAIAMVIERGEFRDPDLLGRAITVTEVRVSPDLRNATVFV 60

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                     +++ L     F+R  I   +  LR VP+L F+ DT+  +  ++++++  P
Sbjct: 61  VPLGGGDVAPILAGLKRAKAFLRHEIS-RMVELRAVPDLWFQEDTTFDTASRIDSILNSP 119

Query: 121 KIPVALE 127
           ++   ++
Sbjct: 120 EVRRDID 126


>gi|23016106|ref|ZP_00055866.1| COG0858: Ribosome-binding factor A [Magnetospirillum
           magnetotacticum MS-1]
          Length = 142

 Score =  145 bits (366), Expect = 2e-33,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 69/127 (54%), Gaps = 1/127 (0%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M       S+R LRVGEE+R A+  VI   EF+D  +    I+++EV +S DLR ATV++
Sbjct: 1   MSRGAKPPSQRQLRVGEELRHAIAMVIERGEFRDPDLLGRAITVTEVRVSPDLRNATVFV 60

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                     +++ L     F+R  I   +  LR VP+L F+ DT+  +  ++++++  P
Sbjct: 61  VPLGGGDVAPILAGLKRAKAFLRHEIS-RMVELRAVPDLWFQEDTTFDTASRIDSILNSP 119

Query: 121 KIPVALE 127
           ++   ++
Sbjct: 120 EVRRDID 126


>gi|325291530|ref|YP_004277394.1| Ribosome-binding factor A [Agrobacterium sp. H13-3]
 gi|325059383|gb|ADY63074.1| Ribosome-binding factor A [Agrobacterium sp. H13-3]
          Length = 138

 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 58/125 (46%), Positives = 83/125 (66%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K  +   S+R LRVGE+VR+AL  ++   E +D LI   VISISEV MS DL++AT Y++
Sbjct: 3   KATSSAPSQRMLRVGEQVRAALTQILQRGEVRDDLIEGTVISISEVRMSPDLKIATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    +I+ALN + KF+RGR+G  LR ++Y+PELRFR DTS  +Y K++AL+  P+
Sbjct: 63  PLGVADHTDIITALNRHAKFMRGRLGPQLRQMKYMPELRFRDDTSFDNYQKIDALLRSPE 122

Query: 122 IPVAL 126
           +   L
Sbjct: 123 VQRDL 127


>gi|15887440|ref|NP_353121.1| ribosome-binding factor A [Agrobacterium tumefaciens str. C58]
 gi|22096033|sp|Q8UJ52|RBFA_AGRT5 RecName: Full=Ribosome-binding factor A
 gi|15154953|gb|AAK85906.1| ribosome-binding factor A [Agrobacterium tumefaciens str. C58]
          Length = 138

 Score =  144 bits (364), Expect = 4e-33,   Method: Composition-based stats.
 Identities = 59/125 (47%), Positives = 83/125 (66%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K  +   S+R LRVGE+VR+AL  ++   E +D LI   VISISEV MS DL++AT Y++
Sbjct: 3   KATSSAPSQRMLRVGEQVRAALTQILQRGEVRDDLIEGTVISISEVRMSPDLKIATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    +ISALN + KF+RGR+G  LR ++Y+PELRFR DTS  +Y K++AL+  P+
Sbjct: 63  PLGVADHTDIISALNRHAKFMRGRLGPQLRQMKYMPELRFRDDTSFDNYQKIDALLRSPE 122

Query: 122 IPVAL 126
           +   L
Sbjct: 123 VQRDL 127


>gi|144899453|emb|CAM76317.1| Ribosome-binding factor A [Magnetospirillum gryphiswaldense MSR-1]
          Length = 144

 Score =  144 bits (363), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 39/126 (30%), Positives = 66/126 (52%), Gaps = 1/126 (0%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M       ++R LRVGEE+R  +  +I   E +D  ++   I+++EV +S DL+ ATV++
Sbjct: 1   MPRGQKPPTQRQLRVGEELRHIIANIIERGEIRDPDLAGRAITVTEVRISPDLKNATVFV 60

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                   + V+  L     FIR  + R + +LR  P+L F+ DTS      ++AL+  P
Sbjct: 61  VPLGGGEVETVVKGLKRARSFIRHEVARQV-DLRIAPDLFFQADTSFDEASHIDALLRSP 119

Query: 121 KIPVAL 126
           ++   L
Sbjct: 120 QVRRDL 125


>gi|170740828|ref|YP_001769483.1| ribosome-binding factor A [Methylobacterium sp. 4-46]
 gi|259552032|sp|B0UL49|RBFA_METS4 RecName: Full=Ribosome-binding factor A
 gi|168195102|gb|ACA17049.1| ribosome-binding factor A [Methylobacterium sp. 4-46]
          Length = 139

 Score =  143 bits (362), Expect = 7e-33,   Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 69/128 (53%), Gaps = 3/128 (2%)

Query: 1   MKN--KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATV 58
           M+   +    S+R  RV E VR A+  V+   + QD ++SR VI++ EV MS DL++AT 
Sbjct: 1   MRKPTETAGPSQRQQRVAELVRHAIAEVLSRGDLQDPVLSRHVITVPEVRMSPDLKLATA 60

Query: 59  YISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           Y+          V+ AL  N K +R  + R + NL++ PELRFR D +     +++ L+ 
Sbjct: 61  YVMPLGGQDEAPVLEALERNRKALRQEVARRV-NLKFAPELRFRRDETFDEAARIDRLLR 119

Query: 119 LPKIPVAL 126
             K+   L
Sbjct: 120 SEKVQRDL 127


>gi|326539882|gb|ADZ88097.1| ribosome-binding factor A [Brucella melitensis M5-90]
          Length = 197

 Score =  143 bits (361), Expect = 8e-33,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  V+   E +D LI R VIS+SEV MS DL++AT +I+      P
Sbjct: 61  SQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADP 120

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             VI AL  + KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 121 QAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRFPEVARDL 178


>gi|15963993|ref|NP_384346.1| ribosome-binding factor A [Sinorhizobium meliloti 1021]
 gi|307306405|ref|ZP_07586149.1| ribosome-binding factor A [Sinorhizobium meliloti BL225C]
 gi|307319292|ref|ZP_07598721.1| ribosome-binding factor A [Sinorhizobium meliloti AK83]
 gi|20978620|sp|Q92SW3|RBFA_RHIME RecName: Full=Ribosome-binding factor A
 gi|15073169|emb|CAC41677.1| Probable ribosome-binding factor A, rRNA processing protein
           [Sinorhizobium meliloti 1021]
 gi|306895128|gb|EFN25885.1| ribosome-binding factor A [Sinorhizobium meliloti AK83]
 gi|306902247|gb|EFN32844.1| ribosome-binding factor A [Sinorhizobium meliloti BL225C]
          Length = 135

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 57/127 (44%), Positives = 84/127 (66%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K+ +   S+R LRVGE+VR+A+  V+   E  D LI   VISISEV MS DL++AT Y++
Sbjct: 3   KSTSSAPSQRMLRVGEQVRAAITQVLQRGEVLDPLIENTVISISEVRMSPDLKIATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI ALN + KFIRGR+G  LR ++Y+P++RFR DTS  +Y K+++L+  P+
Sbjct: 63  PLGVADHAAVIEALNKHAKFIRGRLGPQLRQMKYMPDVRFRDDTSFDNYQKIDSLLRSPE 122

Query: 122 IPVALEK 128
           +   L++
Sbjct: 123 VSRDLDR 129


>gi|297247390|ref|ZP_06931108.1| ribosome-binding factor A [Brucella abortus bv. 5 str. B3196]
 gi|297174559|gb|EFH33906.1| ribosome-binding factor A [Brucella abortus bv. 5 str. B3196]
          Length = 171

 Score =  143 bits (361), Expect = 9e-33,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  V+   E +D LI R VIS+SEV MS DL++AT +I+      P
Sbjct: 35  SQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADP 94

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             VI AL  + KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 95  QAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDL 152


>gi|209966180|ref|YP_002299095.1| ribosome-binding factor A [Rhodospirillum centenum SW]
 gi|209959646|gb|ACJ00283.1| ribosome-binding factor A [Rhodospirillum centenum SW]
          Length = 178

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 70/127 (55%), Gaps = 2/127 (1%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K  N   S+R LRVGEE+R AL  ++   +F+D  +    ++++EV +S DL+ AT ++ 
Sbjct: 9   KPGNTGPSQRQLRVGEEIRHALADILRRGDFRDPGLQDVNVTVTEVRVSPDLKNATAFVM 68

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                 P+ + +ALN    F R +I  ++R L++ P + F+ DTS     +++ L+  P 
Sbjct: 69  PLGGGHPEVI-AALNHAAPFFRAQIAHAVR-LQHAPRIGFQEDTSFAYADRIDRLLHDPA 126

Query: 122 IPVALEK 128
           +   + +
Sbjct: 127 VARDITR 133


>gi|319779768|ref|YP_004139244.1| ribosome-binding factor A [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317165656|gb|ADV09194.1| ribosome-binding factor A [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 146

 Score =  142 bits (360), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 50/125 (40%), Positives = 76/125 (60%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +      S+R LRV E+VR AL   +   E  D LI   V+S+SEV MS DL+VAT ++S
Sbjct: 3   RPTASSPSQRMLRVAEQVRHALSETLQRGEIIDPLIENTVVSVSEVRMSPDLKVATAFVS 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                  D V+ ALN + KF+RGR+  +LR ++++PE RF+ DTS  ++ ++N L+  P+
Sbjct: 63  PLGAKDTDAVVEALNKHAKFVRGRVSGALRQMKFMPEFRFKLDTSFDNFARINDLLKSPE 122

Query: 122 IPVAL 126
           +   L
Sbjct: 123 VARDL 127


>gi|260461979|ref|ZP_05810224.1| ribosome-binding factor A [Mesorhizobium opportunistum WSM2075]
 gi|259032226|gb|EEW33492.1| ribosome-binding factor A [Mesorhizobium opportunistum WSM2075]
          Length = 156

 Score =  142 bits (359), Expect = 1e-32,   Method: Composition-based stats.
 Identities = 51/126 (40%), Positives = 79/126 (62%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           ++     S+R LRVGE+VR AL   +   +  D LI   V+S+SEV MS DL++AT ++S
Sbjct: 3   RSTTSGPSQRMLRVGEQVRHALSETLQRGDIIDPLIENSVVSVSEVRMSPDLKIATAFVS 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                  + VI ALN + KF+RGR+  +LR ++Y+PE RFR DTS  ++ ++N L+  P+
Sbjct: 63  PLGAKDAEAVIEALNKHAKFVRGRVSGALRQMKYMPEFRFRLDTSFDNFARINDLLKSPE 122

Query: 122 IPVALE 127
           +   L+
Sbjct: 123 VARDLD 128


>gi|39933512|ref|NP_945788.1| ribosome-binding factor A [Rhodopseudomonas palustris CGA009]
 gi|192288870|ref|YP_001989475.1| ribosome-binding factor A [Rhodopseudomonas palustris TIE-1]
 gi|61215050|sp|Q6NCN6|RBFA_RHOPA RecName: Full=Ribosome-binding factor A
 gi|229568643|sp|B3QAB3|RBFA_RHOPT RecName: Full=Ribosome-binding factor A
 gi|39647358|emb|CAE25879.1| putative ribosome-binding factor A [Rhodopseudomonas palustris
           CGA009]
 gi|192282619|gb|ACE98999.1| ribosome-binding factor A [Rhodopseudomonas palustris TIE-1]
          Length = 137

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 42/126 (33%), Positives = 69/126 (54%), Gaps = 1/126 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K+  P  S R+LRVGE +R A+  ++      D ++   ++++ EV MS DL++AT+Y+ 
Sbjct: 7   KSSPPGGSTRSLRVGELIRHAVAEILAQGGVHDPVLESHLVTVPEVRMSPDLKLATIYVM 66

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI AL  + +F+RG I   + NL++ PELRFR D       +++ L+  P 
Sbjct: 67  PLGGRDEKLVIDALEHHKRFLRGEIAHRV-NLKFAPELRFRIDERFAEAERIDKLLRSPA 125

Query: 122 IPVALE 127
           +   LE
Sbjct: 126 VQKDLE 131


>gi|326410164|gb|ADZ67229.1| ribosome-binding factor A [Brucella melitensis M28]
          Length = 192

 Score =  142 bits (359), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  V+   E +D LI R VIS+SEV MS DL++AT +I+      P
Sbjct: 56  SQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADP 115

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             VI AL  + KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 116 QAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRFPEVARDL 173


>gi|227824072|ref|YP_002828045.1| ribosome-binding factor A [Sinorhizobium fredii NGR234]
 gi|254789759|sp|C3MC67|RBFA_RHISN RecName: Full=Ribosome-binding factor A
 gi|227343074|gb|ACP27292.1| ribosome-binding factor A [Sinorhizobium fredii NGR234]
          Length = 135

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 85/126 (67%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           ++ +   S+R LRVGE+VR+A+  V+   E +D LI + VISISEV MS DL++AT Y++
Sbjct: 3   RSTSSAPSQRMLRVGEQVRAAITQVLQRGEVRDPLIEKTVISISEVRMSPDLKIATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI ALN + KFIRGR+G  LR ++Y+P++RFR DTS  +Y K++AL+  P+
Sbjct: 63  PLGVADHAAVIEALNKHAKFIRGRLGPQLRQMKYMPDVRFRDDTSFDNYQKIDALLRSPE 122

Query: 122 IPVALE 127
           +   L+
Sbjct: 123 VSRDLD 128


>gi|114571585|ref|YP_758265.1| ribosome-binding factor A [Maricaulis maris MCS10]
 gi|122314885|sp|Q0AK66|RBFA_MARMM RecName: Full=Ribosome-binding factor A
 gi|114342047|gb|ABI67327.1| ribosome-binding factor A [Maricaulis maris MCS10]
          Length = 141

 Score =  142 bits (358), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 43/125 (34%), Positives = 70/125 (56%), Gaps = 1/125 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           + +   S+R LR GE VR AL+ +I   EF+D  +   +IS++EV  S DLRVA VY++ 
Sbjct: 7   HTSKGPSQRQLRAGELVRHALVGIIAREEFRDPDLEGQMISVTEVRPSPDLRVAKVYVAP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                  ++ + LN    F+RGR+GR +  +++ PEL F  D S  +   ++ L+  P +
Sbjct: 67  LGRGDSAKLAAGLNRCAAFLRGRLGREI-EMKFTPELHFHADNSFDTASHVDDLLNRPTV 125

Query: 123 PVALE 127
              L+
Sbjct: 126 RKDLD 130


>gi|150398628|ref|YP_001329095.1| ribosome-binding factor A [Sinorhizobium medicae WSM419]
 gi|166219408|sp|A6UF30|RBFA_SINMW RecName: Full=Ribosome-binding factor A
 gi|150030143|gb|ABR62260.1| ribosome-binding factor A [Sinorhizobium medicae WSM419]
          Length = 134

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 56/127 (44%), Positives = 86/127 (67%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K+ +   S+R LRVGE+VR+A+  V+   + +D LI   VISISEV MS DL++AT Y++
Sbjct: 3   KSTSSAPSQRMLRVGEQVRAAITQVLQRGDVRDPLIESTVISISEVRMSPDLKLATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI ALN + KFIRGR+G  LR ++Y+P++RFR DTS ++Y K+++L+  P+
Sbjct: 63  PLGVADHAAVIEALNKHAKFIRGRLGPHLRQMKYMPDVRFRDDTSFENYQKIDSLLRSPE 122

Query: 122 IPVALEK 128
           +   L++
Sbjct: 123 VSRDLDR 129


>gi|197106896|ref|YP_002132273.1| ribosome-binding factor A [Phenylobacterium zucineum HLK1]
 gi|238690151|sp|B4RC51|RBFA_PHEZH RecName: Full=Ribosome-binding factor A
 gi|196480316|gb|ACG79844.1| ribosome-binding factor A [Phenylobacterium zucineum HLK1]
          Length = 145

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 43/121 (35%), Positives = 69/121 (57%), Gaps = 1/121 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LR GE VR AL+ +    E  D +++   ++++EV +S DLR ATV++     
Sbjct: 13  QGPSQRQLRAGELVRHALVEIFREEEINDPVLAGVSVTVTEVRVSPDLRHATVFVEPLGG 72

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              D V+ ALN + +F+RG +GR++  LR+ PEL+F +D S     ++  L   PK+   
Sbjct: 73  EHADEVVQALNRHARFLRGHLGRAI-ELRFTPELKFLHDESFNEAARMAKLFDDPKVRQD 131

Query: 126 L 126
           L
Sbjct: 132 L 132


>gi|254713434|ref|ZP_05175245.1| ribosome-binding factor A [Brucella ceti M644/93/1]
 gi|254716209|ref|ZP_05178020.1| ribosome-binding factor A [Brucella ceti M13/05/1]
 gi|261217983|ref|ZP_05932264.1| ribosome-binding factor A [Brucella ceti M13/05/1]
 gi|261321167|ref|ZP_05960364.1| ribosome-binding factor A [Brucella ceti M644/93/1]
 gi|260923072|gb|EEX89640.1| ribosome-binding factor A [Brucella ceti M13/05/1]
 gi|261293857|gb|EEX97353.1| ribosome-binding factor A [Brucella ceti M644/93/1]
          Length = 150

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  V+   E +D LI R VIS+SEV MS DL++AT +I+      P
Sbjct: 14  SQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADP 73

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             VI AL  + KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 74  QAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDL 131


>gi|23503014|ref|NP_699141.1| ribosome-binding factor A [Brucella suis 1330]
 gi|62291003|ref|YP_222796.1| ribosome-binding factor A [Brucella abortus bv. 1 str. 9-941]
 gi|82700912|ref|YP_415486.1| ribosome-binding factor A [Brucella melitensis biovar Abortus 2308]
 gi|161620074|ref|YP_001593961.1| ribosome-binding factor A [Brucella canis ATCC 23365]
 gi|189025215|ref|YP_001935983.1| ribosome-binding factor A [Brucella abortus S19]
 gi|254690297|ref|ZP_05153551.1| ribosome-binding factor A [Brucella abortus bv. 6 str. 870]
 gi|254694785|ref|ZP_05156613.1| ribosome-binding factor A [Brucella abortus bv. 3 str. Tulya]
 gi|254696413|ref|ZP_05158241.1| ribosome-binding factor A [Brucella abortus bv. 2 str. 86/8/59]
 gi|254700797|ref|ZP_05162625.1| ribosome-binding factor A [Brucella suis bv. 5 str. 513]
 gi|254705165|ref|ZP_05166993.1| ribosome-binding factor A [Brucella suis bv. 3 str. 686]
 gi|254707319|ref|ZP_05169147.1| ribosome-binding factor A [Brucella pinnipedialis M163/99/10]
 gi|254709141|ref|ZP_05170952.1| ribosome-binding factor A [Brucella pinnipedialis B2/94]
 gi|254718204|ref|ZP_05180015.1| ribosome-binding factor A [Brucella sp. 83/13]
 gi|254731326|ref|ZP_05189904.1| ribosome-binding factor A [Brucella abortus bv. 4 str. 292]
 gi|256030666|ref|ZP_05444280.1| ribosome-binding factor A [Brucella pinnipedialis M292/94/1]
 gi|256158667|ref|ZP_05456550.1| ribosome-binding factor A [Brucella ceti M490/95/1]
 gi|256254071|ref|ZP_05459607.1| ribosome-binding factor A [Brucella ceti B1/94]
 gi|256258550|ref|ZP_05464086.1| ribosome-binding factor A [Brucella abortus bv. 9 str. C68]
 gi|256370561|ref|YP_003108072.1| ribosome-binding factor A [Brucella microti CCM 4915]
 gi|260169570|ref|ZP_05756381.1| ribosome-binding factor A [Brucella sp. F5/99]
 gi|260546266|ref|ZP_05822006.1| ribosome-binding factor A [Brucella abortus NCTC 8038]
 gi|260567367|ref|ZP_05837837.1| ribosome-binding factor A [Brucella suis bv. 4 str. 40]
 gi|260755837|ref|ZP_05868185.1| ribosome-binding factor A [Brucella abortus bv. 6 str. 870]
 gi|260759060|ref|ZP_05871408.1| ribosome-binding factor A [Brucella abortus bv. 4 str. 292]
 gi|260760785|ref|ZP_05873128.1| ribosome-binding factor A [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884862|ref|ZP_05896476.1| ribosome-binding factor A [Brucella abortus bv. 9 str. C68]
 gi|261215112|ref|ZP_05929393.1| ribosome-binding factor A [Brucella abortus bv. 3 str. Tulya]
 gi|261221212|ref|ZP_05935493.1| ribosome-binding factor A [Brucella ceti B1/94]
 gi|261314801|ref|ZP_05953998.1| ribosome-binding factor A [Brucella pinnipedialis M163/99/10]
 gi|261316640|ref|ZP_05955837.1| ribosome-binding factor A [Brucella pinnipedialis B2/94]
 gi|261751305|ref|ZP_05995014.1| ribosome-binding factor A [Brucella suis bv. 5 str. 513]
 gi|261755870|ref|ZP_05999579.1| ribosome-binding factor A [Brucella suis bv. 3 str. 686]
 gi|261759097|ref|ZP_06002806.1| ribosome-binding factor A [Brucella sp. F5/99]
 gi|265983161|ref|ZP_06095896.1| ribosome-binding factor A [Brucella sp. 83/13]
 gi|265987712|ref|ZP_06100269.1| ribosome-binding factor A [Brucella pinnipedialis M292/94/1]
 gi|265997173|ref|ZP_06109730.1| ribosome-binding factor A [Brucella ceti M490/95/1]
 gi|294851391|ref|ZP_06792064.1| ribosome-binding factor A [Brucella sp. NVSL 07-0026]
 gi|306839944|ref|ZP_07472738.1| ribosome-binding factor A [Brucella sp. NF 2653]
 gi|306843583|ref|ZP_07476184.1| ribosome-binding factor A [Brucella sp. BO1]
 gi|29427805|sp|Q8FXT1|RBFA_BRUSU RecName: Full=Ribosome-binding factor A
 gi|75496017|sp|Q57A99|RBFA_BRUAB RecName: Full=Ribosome-binding factor A
 gi|123547259|sp|Q2YQR6|RBFA_BRUA2 RecName: Full=Ribosome-binding factor A
 gi|172048298|sp|A5VTB3|RBFA_BRUO2 RecName: Full=Ribosome-binding factor A
 gi|189039529|sp|A9M9Z5|RBFA_BRUC2 RecName: Full=Ribosome-binding factor A
 gi|238689419|sp|B2S9F7|RBFA_BRUA1 RecName: Full=Ribosome-binding factor A
 gi|23349055|gb|AAN31056.1| ribosome-binding factor A [Brucella suis 1330]
 gi|62197135|gb|AAX75435.1| RbfA, ribosome-binding factor A [Brucella abortus bv. 1 str. 9-941]
 gi|82617013|emb|CAJ12122.1| Ribosome-binding factor A [Brucella melitensis biovar Abortus 2308]
 gi|161336885|gb|ABX63190.1| ribosome-binding factor A [Brucella canis ATCC 23365]
 gi|189020787|gb|ACD73509.1| Ribosome-binding factor A [Brucella abortus S19]
 gi|256000724|gb|ACU49123.1| ribosome-binding factor A [Brucella microti CCM 4915]
 gi|260096373|gb|EEW80249.1| ribosome-binding factor A [Brucella abortus NCTC 8038]
 gi|260156885|gb|EEW91965.1| ribosome-binding factor A [Brucella suis bv. 4 str. 40]
 gi|260669378|gb|EEX56318.1| ribosome-binding factor A [Brucella abortus bv. 4 str. 292]
 gi|260671217|gb|EEX58038.1| ribosome-binding factor A [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675945|gb|EEX62766.1| ribosome-binding factor A [Brucella abortus bv. 6 str. 870]
 gi|260874390|gb|EEX81459.1| ribosome-binding factor A [Brucella abortus bv. 9 str. C68]
 gi|260916719|gb|EEX83580.1| ribosome-binding factor A [Brucella abortus bv. 3 str. Tulya]
 gi|260919796|gb|EEX86449.1| ribosome-binding factor A [Brucella ceti B1/94]
 gi|261295863|gb|EEX99359.1| ribosome-binding factor A [Brucella pinnipedialis B2/94]
 gi|261303827|gb|EEY07324.1| ribosome-binding factor A [Brucella pinnipedialis M163/99/10]
 gi|261739081|gb|EEY27077.1| ribosome-binding factor A [Brucella sp. F5/99]
 gi|261741058|gb|EEY28984.1| ribosome-binding factor A [Brucella suis bv. 5 str. 513]
 gi|261745623|gb|EEY33549.1| ribosome-binding factor A [Brucella suis bv. 3 str. 686]
 gi|262551641|gb|EEZ07631.1| ribosome-binding factor A [Brucella ceti M490/95/1]
 gi|264659909|gb|EEZ30170.1| ribosome-binding factor A [Brucella pinnipedialis M292/94/1]
 gi|264661753|gb|EEZ32014.1| ribosome-binding factor A [Brucella sp. 83/13]
 gi|294819980|gb|EFG36979.1| ribosome-binding factor A [Brucella sp. NVSL 07-0026]
 gi|306276274|gb|EFM57974.1| ribosome-binding factor A [Brucella sp. BO1]
 gi|306404908|gb|EFM61193.1| ribosome-binding factor A [Brucella sp. NF 2653]
          Length = 150

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  V+   E +D LI R VIS+SEV MS DL++AT +I+      P
Sbjct: 14  SQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADP 73

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             VI AL  + KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 74  QAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDL 131


>gi|209883659|ref|YP_002287516.1| ribosome-binding factor A [Oligotropha carboxidovorans OM5]
 gi|226723605|sp|B6JCS1|RBFA_OLICO RecName: Full=Ribosome-binding factor A
 gi|209871855|gb|ACI91651.1| ribosome-binding factor A [Oligotropha carboxidovorans OM5]
          Length = 141

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 65/117 (55%), Gaps = 1/117 (0%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           +R LRVGE +R A+  ++      D  ++  +I++ EV MS DL++ATVY+        +
Sbjct: 18  QRQLRVGELIRHAMADILAQGGVHDDTLAGHIITVPEVRMSPDLKLATVYVMPLGGHDTE 77

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
            V++AL  N KF+RG +   + NL++ PELRFR D       ++  L+  P +   L
Sbjct: 78  AVLAALAHNKKFLRGEVAHRV-NLKFAPELRFRVDERFDEAERIEKLLRTPAVQRDL 133


>gi|218682086|ref|ZP_03529687.1| ribosome-binding factor A [Rhizobium etli CIAT 894]
          Length = 134

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 83/126 (65%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +  +   S+R LRVGE+VR+A+  V+   E +D +I   VISISEV MS DL++AT Y++
Sbjct: 3   RATSSAPSQRMLRVGEQVRAAITQVLQRGEVRDDVIEATVISISEVRMSPDLKIATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI ALN + KFIRGR+G+ LR ++Y+PE+RFR DTS  +Y K++ L+  P+
Sbjct: 63  PLGVSDHSIVIGALNRHAKFIRGRLGQQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPE 122

Query: 122 IPVALE 127
           +   L+
Sbjct: 123 VRRDLD 128


>gi|239833214|ref|ZP_04681543.1| ribosome-binding factor A [Ochrobactrum intermedium LMG 3301]
 gi|239825481|gb|EEQ97049.1| ribosome-binding factor A [Ochrobactrum intermedium LMG 3301]
          Length = 171

 Score =  141 bits (355), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 58/118 (49%), Positives = 79/118 (66%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  V+   E +D LI+R VIS+SEV MS DL++AT +I+   D   
Sbjct: 35  SQRQLRVGEQVRHALAQVLQRGEIRDDLIARTVISVSEVRMSPDLKIATCFITPLGDADT 94

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             VI AL  N KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 95  QAVIKALAANAKFIRGRMAPSLSQMKYMPEFRFRADTSFDNFSKIDALLRSPEVARDL 152


>gi|163844179|ref|YP_001628584.1| ribosome-binding factor A [Brucella suis ATCC 23445]
 gi|189039530|sp|B0CK12|RBFA_BRUSI RecName: Full=Ribosome-binding factor A
 gi|163674902|gb|ABY39013.1| ribosome-binding factor A [Brucella suis ATCC 23445]
          Length = 150

 Score =  141 bits (355), Expect = 5e-32,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 77/118 (65%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR  L  V+   E +D LI R VIS+SEV MS DL++AT +I+      P
Sbjct: 14  SQRQLRVGEQVRHTLAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADP 73

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             VI AL  + KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 74  QAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDL 131


>gi|17988247|ref|NP_540881.1| ribosome-binding factor A [Brucella melitensis bv. 1 str. 16M]
 gi|17984014|gb|AAL53145.1| ribosome-binding factor a [Brucella melitensis bv. 1 str. 16M]
          Length = 171

 Score =  140 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  V+   E +D LI R VIS+SEV MS DL++AT +I+      P
Sbjct: 35  SQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADP 94

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             VI AL  + KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 95  QAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRFPEVARDL 152


>gi|307942747|ref|ZP_07658092.1| ribosome-binding factor A [Roseibium sp. TrichSKD4]
 gi|307773543|gb|EFO32759.1| ribosome-binding factor A [Roseibium sp. TrichSKD4]
          Length = 136

 Score =  140 bits (354), Expect = 6e-32,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 69/122 (56%), Gaps = 1/122 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LRVGE VR  L  ++   EFQD  +   +I++ EV M+ DLR+AT  +     
Sbjct: 10  KGPSQRQLRVGETVRKELSDILTRGEFQDPALEGAIITVPEVRMTPDLRLATCLVMPLGG 69

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              ++V +ALN + K++RG++ R L  ++Y+P+LRF  DT      ++ +L+    +   
Sbjct: 70  GDGEKVAAALNKSAKYLRGQVSRRL-TMKYMPDLRFVLDTRFDDDDRIGSLLQSGTVARD 128

Query: 126 LE 127
           L+
Sbjct: 129 LD 130


>gi|153008082|ref|YP_001369297.1| ribosome-binding factor A [Ochrobactrum anthropi ATCC 49188]
 gi|166219382|sp|A6WWW4|RBFA_OCHA4 RecName: Full=Ribosome-binding factor A
 gi|151559970|gb|ABS13468.1| ribosome-binding factor A [Ochrobactrum anthropi ATCC 49188]
          Length = 150

 Score =  140 bits (353), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 56/118 (47%), Positives = 78/118 (66%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  V+   E +D LI+  VIS+SEV MS DL++AT +I+   +   
Sbjct: 14  SQRQLRVGEQVRHALAQVLQRGEIRDDLIAHTVISVSEVRMSPDLKIATCFITPLGNADT 73

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             VI AL  N KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 74  QAVIKALAANAKFIRGRMAPSLSQMKYMPEFRFRADTSFDNFSKIDALLRSPEVARDL 131


>gi|217978440|ref|YP_002362587.1| ribosome-binding factor A [Methylocella silvestris BL2]
 gi|254789756|sp|B8EIA6|RBFA_METSB RecName: Full=Ribosome-binding factor A
 gi|217503816|gb|ACK51225.1| ribosome-binding factor A [Methylocella silvestris BL2]
          Length = 155

 Score =  140 bits (353), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 42/121 (34%), Positives = 73/121 (60%), Gaps = 1/121 (0%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           + S+R LRV E VR A+  ++  ++  D  +   VI++ +V MS DL++ATVY+      
Sbjct: 11  QPSQRMLRVAELVRHAMSELLTRSDINDPALEGKVITVPDVRMSPDLKLATVYVMPLGGE 70

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
           +   V++AL+ + K +RG I R + +LR+ P++RF+ D   +   K++AL+  PK+   L
Sbjct: 71  NVTEVLAALDRHKKLLRGEIARRV-SLRFAPDVRFKADPGFEYSGKIDALLSSPKVKQDL 129

Query: 127 E 127
           E
Sbjct: 130 E 130


>gi|182678032|ref|YP_001832178.1| ribosome-binding factor A [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|238691234|sp|B2IIJ6|RBFA_BEII9 RecName: Full=Ribosome-binding factor A
 gi|182633915|gb|ACB94689.1| ribosome-binding factor A [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 141

 Score =  139 bits (352), Expect = 8e-32,   Method: Composition-based stats.
 Identities = 38/121 (31%), Positives = 69/121 (57%), Gaps = 1/121 (0%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R LRV E +R  L  ++  +   D ++   VI++ +V MS DL++AT ++      
Sbjct: 11  APSQRMLRVAELIRHTLSDLLSRSIVNDPVLEGHVITVPDVRMSPDLKLATAFVMPLGGK 70

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             + VI AL+ + KF+R  I + + +LR+ P++RF+ D S     K++AL+  P++   L
Sbjct: 71  DINSVIEALDRHKKFLRSEIAQRI-HLRFAPDIRFKADESFDYGDKIDALLASPQVRRDL 129

Query: 127 E 127
           +
Sbjct: 130 D 130


>gi|91974712|ref|YP_567371.1| ribosome-binding factor A [Rhodopseudomonas palustris BisB5]
 gi|123061509|sp|Q13EL9|RBFA_RHOPS RecName: Full=Ribosome-binding factor A
 gi|91681168|gb|ABE37470.1| ribosome-binding factor A [Rhodopseudomonas palustris BisB5]
          Length = 136

 Score =  139 bits (352), Expect = 9e-32,   Method: Composition-based stats.
 Identities = 44/126 (34%), Positives = 67/126 (53%), Gaps = 1/126 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K      S R LRVGE VR A+  ++      D ++   +I++ EV MS DL++ATVY+ 
Sbjct: 6   KPTGQSESPRKLRVGELVRHAVAEILAQGGVHDPVLETHLITVPEVRMSPDLKLATVYVM 65

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI+AL  + +F+RG + R + NL+Y PE+RFR D       ++  L+  P 
Sbjct: 66  PLGGRDEKLVIAALEQHKRFLRGEVARRV-NLKYAPEIRFRIDERFAEAERIEKLLRTPA 124

Query: 122 IPVALE 127
           +   LE
Sbjct: 125 VQKDLE 130


>gi|256060126|ref|ZP_05450308.1| ribosome-binding factor A [Brucella neotomae 5K33]
 gi|261324103|ref|ZP_05963300.1| ribosome-binding factor A [Brucella neotomae 5K33]
 gi|261300083|gb|EEY03580.1| ribosome-binding factor A [Brucella neotomae 5K33]
          Length = 150

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  V+   E +D LI R VIS+SEV MS DL++AT +I+      P
Sbjct: 14  SQRQLRVGEQVRHALAQVLQRGEIRDDLIERIVISVSEVRMSPDLKIATCFIAPLGSADP 73

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             VI AL  + KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 74  QAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDL 131


>gi|86747727|ref|YP_484223.1| ribosome-binding factor A [Rhodopseudomonas palustris HaA2]
 gi|123004688|sp|Q2J2J8|RBFA_RHOP2 RecName: Full=Ribosome-binding factor A
 gi|86570755|gb|ABD05312.1| ribosome-binding factor A [Rhodopseudomonas palustris HaA2]
          Length = 135

 Score =  139 bits (352), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 66/125 (52%), Gaps = 1/125 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K      S R LRVGE VR A+  ++      D ++   +I++ EV MS DL++ATVY+ 
Sbjct: 6   KKTGQSASPRKLRVGELVRHAVAEILSQGGVHDPVLETHLITVPEVRMSPDLKLATVYVM 65

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    V++AL  + +F+RG + R + NL+Y P+LRFR D       ++  L+  P 
Sbjct: 66  PLGGKDEKPVLAALEQHKRFLRGEVARRV-NLKYAPDLRFRIDERFAEAERIEKLLRTPA 124

Query: 122 IPVAL 126
           +   L
Sbjct: 125 VQKDL 129


>gi|218662345|ref|ZP_03518275.1| ribosome-binding factor A [Rhizobium etli IE4771]
 gi|218673741|ref|ZP_03523410.1| ribosome-binding factor A [Rhizobium etli GR56]
          Length = 134

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 82/126 (65%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +  +   S+R LRVGE+VR+A+  V+   E +D +I   VISISEV MS DL++AT Y++
Sbjct: 3   RPTSSAPSQRMLRVGEQVRAAITQVLQRGEVRDDVIEATVISISEVRMSPDLKIATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI ALN + KFIRGR+G  LR ++Y+PE+RFR DTS  +Y K++ L+  P+
Sbjct: 63  PLGVSDHSIVIEALNRHAKFIRGRLGPQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPE 122

Query: 122 IPVALE 127
           +   L+
Sbjct: 123 VSRDLD 128


>gi|13474630|ref|NP_106199.1| ribosome-binding factor A [Mesorhizobium loti MAFF303099]
 gi|20978641|sp|Q98BI7|RBFA_RHILO RecName: Full=Ribosome-binding factor A
 gi|14025384|dbj|BAB51985.1| ribosome-binding factor A [Mesorhizobium loti MAFF303099]
          Length = 146

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 50/123 (40%), Positives = 75/123 (60%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +      S+R LRV E+VR AL   +   E  D LI   V+S+SEV MS DLRVAT ++S
Sbjct: 3   RPTTSSPSQRMLRVAEQVRHALSETLQRGEIIDPLIENTVVSVSEVRMSPDLRVATAFVS 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                  D V+ ALN + KF+RGR+  +LR ++++PE RF+ DTS  ++ ++N L+  P+
Sbjct: 63  PLGAKDTDAVVEALNKHAKFVRGRVSGALRQMKFMPEFRFKLDTSFDNFARINDLLKSPE 122

Query: 122 IPV 124
           +  
Sbjct: 123 VAR 125


>gi|209551637|ref|YP_002283554.1| ribosome-binding factor A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226723606|sp|B5ZW28|RBFA_RHILW RecName: Full=Ribosome-binding factor A
 gi|209537393|gb|ACI57328.1| ribosome-binding factor A [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 134

 Score =  139 bits (351), Expect = 1e-31,   Method: Composition-based stats.
 Identities = 54/126 (42%), Positives = 83/126 (65%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +  +   S+R LRVGE+VR+A+  V+   E +D +I   VISISEV MS DL++AT Y++
Sbjct: 3   RATSSAPSQRMLRVGEQVRAAITQVLQRGEVRDDVIEATVISISEVRMSPDLKIATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI ALN + ++IRGR+G+ LR ++Y+PE+RFR DTS  +Y K++ L+  P+
Sbjct: 63  PLGVSDHSVVIEALNRHARYIRGRLGQQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPE 122

Query: 122 IPVALE 127
           +   L+
Sbjct: 123 VSRDLD 128


>gi|92115665|ref|YP_575394.1| ribosome-binding factor A [Nitrobacter hamburgensis X14]
 gi|122418983|sp|Q1QS63|RBFA_NITHX RecName: Full=Ribosome-binding factor A
 gi|91798559|gb|ABE60934.1| ribosome-binding factor A [Nitrobacter hamburgensis X14]
          Length = 137

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 42/125 (33%), Positives = 67/125 (53%), Gaps = 1/125 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K+     S+R LRV E VR A+  ++      D ++   +I++ EV MS DL++AT+Y+ 
Sbjct: 7   KDSTSGASQRQLRVAETVRHAIADILAQGHVHDPVLEGHLITVPEVRMSADLKLATIYVM 66

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI AL+ N KF+RG I R + NL++ P++RFR D       ++  L+  P 
Sbjct: 67  PLGGRDTTDVIDALDHNRKFLRGEIARRV-NLKFAPDIRFRADERFDEAERIEKLLRTPA 125

Query: 122 IPVAL 126
           +   L
Sbjct: 126 VQRDL 130


>gi|222147150|ref|YP_002548107.1| ribosome-binding factor A [Agrobacterium vitis S4]
 gi|254789726|sp|B9JYK7|RBFA_AGRVS RecName: Full=Ribosome-binding factor A
 gi|221734140|gb|ACM35103.1| ribosome-binding factor A [Agrobacterium vitis S4]
          Length = 137

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 85/125 (68%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K  N   S+R LRVGE+VR+A+  V+   E +D LI + VISISEV MS DL+VAT Y+S
Sbjct: 3   KPTNSAPSQRMLRVGEQVRAAITQVLQRGEVRDDLIEKTVISISEVRMSTDLKVATAYVS 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                  D VI+ALN + K+IRGRIG  LR ++Y+PE+RFR DTS  +Y K++AL+  P+
Sbjct: 63  PLGVSDHDTVIAALNRHAKYIRGRIGGQLRQMKYMPEVRFRDDTSFDNYQKIDALLRSPE 122

Query: 122 IPVAL 126
           +   L
Sbjct: 123 VARDL 127


>gi|148251682|ref|YP_001236267.1| ribosome-binding factor A [Bradyrhizobium sp. BTAi1]
 gi|166218423|sp|A5E867|RBFA_BRASB RecName: Full=Ribosome-binding factor A
 gi|146403855|gb|ABQ32361.1| ribosome-binding factor A [Bradyrhizobium sp. BTAi1]
          Length = 138

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 40/121 (33%), Positives = 64/121 (52%), Gaps = 1/121 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LRV E VR A+  ++      D  +   +I++ EV MS DL++AT+YI     
Sbjct: 12  SGGSQRQLRVAETVRHAVADILSQGSAHDPDLEGHIITVPEVRMSPDLKLATIYIMPLGG 71

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              + V++AL  N KF+RG I   + NL++ P++RFR D       ++  L+  P +   
Sbjct: 72  RDTEIVLAALERNKKFLRGEIAHRV-NLKFAPDIRFRADERFDEAERIEKLLRTPAVQRD 130

Query: 126 L 126
           L
Sbjct: 131 L 131


>gi|218461916|ref|ZP_03502007.1| ribosome-binding factor A [Rhizobium etli Kim 5]
          Length = 134

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 82/126 (65%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +  +   S+R LRVGE+VR+A+  V+   E +D +I   VISISEV MS DL++AT Y++
Sbjct: 3   RPTSSAPSQRMLRVGEQVRAAITQVLQRGEVRDDIIEATVISISEVRMSPDLKIATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI ALN + KFIRGR+G  LR ++Y+PE+RFR DTS  +Y K++ L+  P+
Sbjct: 63  PLGVSDHSIVIEALNRHAKFIRGRLGPQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPE 122

Query: 122 IPVALE 127
           +   L+
Sbjct: 123 VSRDLD 128


>gi|114706047|ref|ZP_01438950.1| ribosome-binding factor A [Fulvimarina pelagi HTCC2506]
 gi|114538893|gb|EAU42014.1| ribosome-binding factor A [Fulvimarina pelagi HTCC2506]
          Length = 140

 Score =  139 bits (350), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 53/124 (42%), Positives = 80/124 (64%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
             N   S+R L VGE+VR AL  V+   E +D L+ R V+S+SEV MS DL++AT Y+++
Sbjct: 5   KPNAGPSQRQLSVGEKVRHALTEVMQRGEIRDPLLERAVVSVSEVRMSPDLKIATAYVTV 64

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                    I ALN + KFIRGR+  SL+ ++Y+PE+RFR DTS  ++ +++AL+  P++
Sbjct: 65  LGQEDMQPFIKALNDHAKFIRGRVTPSLKQMKYMPEIRFREDTSFDNFARIDALLKSPEV 124

Query: 123 PVAL 126
              L
Sbjct: 125 QQDL 128


>gi|190889784|ref|YP_001976326.1| ribosome binding factor A, rRNA processing protein [Rhizobium etli
           CIAT 652]
 gi|238692530|sp|B3PXE2|RBFA_RHIE6 RecName: Full=Ribosome-binding factor A
 gi|190695063|gb|ACE89148.1| ribosome binding factor A, rRNA processing protein [Rhizobium etli
           CIAT 652]
          Length = 134

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 82/126 (65%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +  +   S+R LRVGE+VR+A+  V+   E +D +I   VISISEV MS DL++AT Y++
Sbjct: 3   RPTSSAPSQRMLRVGEQVRAAITQVLQRGEVRDDIIEATVISISEVRMSPDLKIATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI ALN + KFIRGR+G  LR ++Y+PE+RFR DTS  +Y K++ L+  P+
Sbjct: 63  PLGVSDHSIVIEALNRHAKFIRGRLGPQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPE 122

Query: 122 IPVALE 127
           +   L+
Sbjct: 123 VSRDLD 128


>gi|172046706|sp|Q3SWP8|RBFA_NITWN RecName: Full=Ribosome-binding factor A
          Length = 137

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 68/123 (55%), Gaps = 1/123 (0%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           K+P  S R LRV E VR A+  ++   +  D ++   ++++ EV MS DL++AT+Y+   
Sbjct: 9   KHPGGSHRQLRVAETVRHAIADILAQGQVHDPVLEGHLVTVPEVRMSADLKLATIYVMPL 68

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                  VI AL+ N KF+RG I R + NL++ P++RFR D       ++  L+  P + 
Sbjct: 69  GGRDTADVIDALDRNRKFLRGEIARRV-NLKFAPDIRFRVDERFDEAERIEKLLRTPAVQ 127

Query: 124 VAL 126
             L
Sbjct: 128 RDL 130


>gi|146337228|ref|YP_001202276.1| ribosome-binding factor A [Bradyrhizobium sp. ORS278]
 gi|166218424|sp|A4YJF0|RBFA_BRASO RecName: Full=Ribosome-binding factor A
 gi|146190034|emb|CAL74026.1| Ribosome-binding factor A [Bradyrhizobium sp. ORS278]
          Length = 138

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/121 (33%), Positives = 65/121 (53%), Gaps = 1/121 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LRV E VR A+  ++      D  +   +I++ EV MS DL++AT+YI     
Sbjct: 12  SGGSQRQLRVAETVRHAVADILSQGSAHDPDLEGHIITVPEVRMSPDLKLATIYIMPLGG 71

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              D V++AL  N KF+RG + R + NL++ P++RFR D       ++  L+  P +   
Sbjct: 72  RDTDVVLAALERNKKFLRGEVARRV-NLKFAPDIRFRVDERFDEAERIEKLLRTPAVQRD 130

Query: 126 L 126
           L
Sbjct: 131 L 131


>gi|220924487|ref|YP_002499789.1| ribosome-binding factor A [Methylobacterium nodulans ORS 2060]
 gi|259552023|sp|B8IEB4|RBFA_METNO RecName: Full=Ribosome-binding factor A
 gi|219949094|gb|ACL59486.1| ribosome-binding factor A [Methylobacterium nodulans ORS 2060]
          Length = 135

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 43/128 (33%), Positives = 70/128 (54%), Gaps = 3/128 (2%)

Query: 1   MKN--KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATV 58
           M+   ++   ++R  RV E VR A+  V+   + QD ++SR VI++ EV MS DL++AT 
Sbjct: 1   MRKPTESAGPTQRQQRVAELVRHAIAEVLSRGDLQDPVLSRHVITVPEVRMSPDLKLATA 60

Query: 59  YISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           Y+          VI AL  N K +R  + R + NL++ P+LRFR D +     +++ L+ 
Sbjct: 61  YVMPLGGEDEQPVIEALERNRKVLRQEVARRV-NLKFAPDLRFRRDETFDEAARIDRLLR 119

Query: 119 LPKIPVAL 126
             K+   L
Sbjct: 120 SDKVQRDL 127


>gi|225853591|ref|YP_002733824.1| ribosome-binding factor A [Brucella melitensis ATCC 23457]
 gi|256045769|ref|ZP_05448647.1| ribosome-binding factor A [Brucella melitensis bv. 1 str. Rev.1]
 gi|256112489|ref|ZP_05453410.1| ribosome-binding factor A [Brucella melitensis bv. 3 str. Ether]
 gi|256264966|ref|ZP_05467498.1| ribosome-binding factor A [Brucella melitensis bv. 2 str. 63/9]
 gi|260563065|ref|ZP_05833551.1| ribosome-binding factor A [Brucella melitensis bv. 1 str. 16M]
 gi|265992186|ref|ZP_06104743.1| ribosome-binding factor A [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993925|ref|ZP_06106482.1| ribosome-binding factor A [Brucella melitensis bv. 3 str. Ether]
 gi|20978585|sp|Q8YEB4|RBFA_BRUME RecName: Full=Ribosome-binding factor A
 gi|254789736|sp|C0RG48|RBFA_BRUMB RecName: Full=Ribosome-binding factor A
 gi|225641956|gb|ACO01870.1| ribosome-binding factor A [Brucella melitensis ATCC 23457]
 gi|260153081|gb|EEW88173.1| ribosome-binding factor A [Brucella melitensis bv. 1 str. 16M]
 gi|262764906|gb|EEZ10827.1| ribosome-binding factor A [Brucella melitensis bv. 3 str. Ether]
 gi|263003252|gb|EEZ15545.1| ribosome-binding factor A [Brucella melitensis bv. 1 str. Rev.1]
 gi|263095449|gb|EEZ19050.1| ribosome-binding factor A [Brucella melitensis bv. 2 str. 63/9]
          Length = 150

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 57/118 (48%), Positives = 78/118 (66%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  V+   E +D LI R VIS+SEV MS DL++AT +I+      P
Sbjct: 14  SQRQLRVGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADP 73

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             VI AL  + KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 74  QAVIKALASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRFPEVARDL 131


>gi|27375893|ref|NP_767422.1| ribosome-binding factor A [Bradyrhizobium japonicum USDA 110]
 gi|32171617|sp|Q89WB0|RBFA_BRAJA RecName: Full=Ribosome-binding factor A
 gi|27349031|dbj|BAC46047.1| ribosome-binding factor A [Bradyrhizobium japonicum USDA 110]
          Length = 144

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 69/122 (56%), Gaps = 1/122 (0%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R LRVGE+VR A+  ++      D  +   ++++ EV MS DL++AT+Y+      
Sbjct: 14  GGSQRQLRVGEQVRHAMAEILAQGNVHDADLEGHIVTVPEVRMSPDLKLATIYVMPLGGR 73

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             + VI+AL  N KF+RG + R + NL++ P++RFR D       ++  L+  P +   L
Sbjct: 74  DTEIVIAALERNKKFLRGEVARRV-NLKFAPDVRFRVDERFDEAERIEKLLRTPAVQKDL 132

Query: 127 EK 128
           E+
Sbjct: 133 EQ 134


>gi|296114404|ref|ZP_06833058.1| ribosome-binding factor A [Gluconacetobacter hansenii ATCC 23769]
 gi|295979165|gb|EFG85889.1| ribosome-binding factor A [Gluconacetobacter hansenii ATCC 23769]
          Length = 146

 Score =  138 bits (349), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 40/122 (32%), Positives = 66/122 (54%), Gaps = 1/122 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LRV EE+R  L  +    EF+D  +    I+++EV +S DL+ ATV+++    
Sbjct: 25  SGPSQRQLRVAEEIRRVLADIFARVEFRDPELVDARITVTEVRISPDLKHATVFVARLGR 84

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              + ++ AL     F+R R+   +R LR VP+L F+ DT+L     ++ L+  P +   
Sbjct: 85  SDIEALLPALKRVSSFLRSRLSHMVR-LRGVPDLHFQPDTALDYAMHVDDLLRDPAVARD 143

Query: 126 LE 127
           LE
Sbjct: 144 LE 145


>gi|75674224|ref|YP_316645.1| ribosome-binding factor A [Nitrobacter winogradskyi Nb-255]
 gi|74419094|gb|ABA03293.1| ribosome-binding factor A [Nitrobacter winogradskyi Nb-255]
          Length = 146

 Score =  138 bits (348), Expect = 3e-31,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 68/123 (55%), Gaps = 1/123 (0%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           K+P  S R LRV E VR A+  ++   +  D ++   ++++ EV MS DL++AT+Y+   
Sbjct: 18  KHPGGSHRQLRVAETVRHAIADILAQGQVHDPVLEGHLVTVPEVRMSADLKLATIYVMPL 77

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                  VI AL+ N KF+RG I R + NL++ P++RFR D       ++  L+  P + 
Sbjct: 78  GGRDTADVIDALDRNRKFLRGEIARRV-NLKFAPDIRFRVDERFDEAERIEKLLRTPAVQ 136

Query: 124 VAL 126
             L
Sbjct: 137 RDL 139


>gi|330991193|ref|ZP_08315146.1| Ribosome-binding factor A [Gluconacetobacter sp. SXCC-1]
 gi|329761779|gb|EGG78270.1| Ribosome-binding factor A [Gluconacetobacter sp. SXCC-1]
          Length = 138

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 70/123 (56%), Gaps = 1/123 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LRV EEVR  L  +    EF+D  ++   I+++EV +S DL+ ATV+++    
Sbjct: 16  SGPSQRQLRVAEEVRRVLAEIFARTEFRDPDLADVRITVTEVRISPDLKHATVFVARLGR 75

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                ++ AL     F+R R+  +LR LR VP+L F+ DT+L    +++ ++  P++   
Sbjct: 76  SDVAELLPALKRVTPFLRTRLSHALR-LRGVPDLHFQPDTALDYAMEVDTMLRQPEVQRD 134

Query: 126 LEK 128
           L++
Sbjct: 135 LKE 137


>gi|85714174|ref|ZP_01045163.1| ribosome-binding factor A [Nitrobacter sp. Nb-311A]
 gi|85699300|gb|EAQ37168.1| ribosome-binding factor A [Nitrobacter sp. Nb-311A]
          Length = 137

 Score =  137 bits (347), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 42/124 (33%), Positives = 69/124 (55%), Gaps = 1/124 (0%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           K+P  S R LRV E VR A+  ++   +  D ++   ++++ EV MS DL++AT+Y+   
Sbjct: 9   KHPGGSHRQLRVAESVRHAIADILAQGQVHDPVLEGRLVTVPEVRMSADLKLATIYVMPL 68

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                  VI AL+ N KF+RG I R + NL++ P++RFR D       ++  L+  P + 
Sbjct: 69  GGRDTAEVIDALDHNRKFLRGEIARRV-NLKFAPDIRFRVDERFDEAERIEKLLRTPAVQ 127

Query: 124 VALE 127
             L+
Sbjct: 128 RDLK 131


>gi|116249890|ref|YP_765728.1| ribosome-binding factor A [Rhizobium leguminosarum bv. viciae 3841]
 gi|166219398|sp|Q1MN40|RBFA_RHIL3 RecName: Full=Ribosome-binding factor A
 gi|115254538|emb|CAK05612.1| putative ribosome-binding factor protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 134

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 53/126 (42%), Positives = 82/126 (65%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +  +   S+R LR+GE+VR+A+  V+   E +D +I   VIS+SEV MS DL++AT Y++
Sbjct: 3   RPTSSAPSQRMLRIGEQVRAAITQVLQRGEVRDDVIEATVISVSEVRMSPDLKIATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI ALN + +FIRGR+G  LR ++Y+PE+RFR DTS  +Y K++ L+  P+
Sbjct: 63  PLGVSDHSIVIEALNRHARFIRGRLGPQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPE 122

Query: 122 IPVALE 127
           +   L+
Sbjct: 123 VSRDLD 128


>gi|329113265|ref|ZP_08242048.1| Ribosome-binding factor A [Acetobacter pomorum DM001]
 gi|326697406|gb|EGE49064.1| Ribosome-binding factor A [Acetobacter pomorum DM001]
          Length = 154

 Score =  137 bits (345), Expect = 5e-31,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 64/121 (52%), Gaps = 1/121 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LRVGEEVR  L  V     F+D  +    ++++EV +S D R ATV+I+    
Sbjct: 24  SGPSQRQLRVGEEVRRVLAEVFARTTFRDPDLVDVALTVTEVRLSPDFRHATVFITRLGR 83

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                ++ AL     ++R ++   +R  R VPEL F+ DT+L +   ++ L+  P++   
Sbjct: 84  SDVAELLPALKRVAPWLRTQLAHKIRA-RTVPELHFQPDTALDTAMHMDTLLRSPEVQRD 142

Query: 126 L 126
           L
Sbjct: 143 L 143


>gi|103486106|ref|YP_615667.1| ribosome-binding factor A [Sphingopyxis alaskensis RB2256]
 gi|123078561|sp|Q1GVI8|RBFA_SPHAL RecName: Full=Ribosome-binding factor A
 gi|98976183|gb|ABF52334.1| ribosome-binding factor A [Sphingopyxis alaskensis RB2256]
          Length = 136

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 68/126 (53%), Gaps = 1/126 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K ++   S R LRVGE+VR  L  ++   +  D +++   +S++EV MS DLR ATV++ 
Sbjct: 4   KEQSEGPSVRVLRVGEQVRHVLSEILARGDVHDDVLATHPVSVTEVRMSPDLRHATVFVK 63

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             L    + V+ A+  N  +++  +   +R ++Y  +L+F  D S      ++ L+  PK
Sbjct: 64  PLLGKDEEAVLKAMRTNTAYLQREVAHRIR-MKYAAKLKFLADDSFDEASHIDRLLRDPK 122

Query: 122 IPVALE 127
           +   LE
Sbjct: 123 VARDLE 128


>gi|114329055|ref|YP_746212.1| ribosome-binding factor A [Granulibacter bethesdensis CGDNIH1]
 gi|122325999|sp|Q0BPG3|RBFA_GRABC RecName: Full=Ribosome-binding factor A
 gi|114317229|gb|ABI63289.1| ribosome-binding factor A [Granulibacter bethesdensis CGDNIH1]
          Length = 138

 Score =  137 bits (345), Expect = 6e-31,   Method: Composition-based stats.
 Identities = 40/122 (32%), Positives = 70/122 (57%), Gaps = 1/122 (0%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R LRV EE+R  L  V    EF+D  ++    +I+EV +S DL+ ATV+IS     
Sbjct: 18  APSQRQLRVAEEIRHVLAGVFARQEFRDPELATTTFTINEVRISPDLKHATVFISRLGSS 77

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             + ++  L     ++RG + + +R LRY PEL F+ D++L+    +++L+  P++   L
Sbjct: 78  EIEPLLPNLKRVATYLRGEVAKVMR-LRYAPELHFQPDSALEYAMHVDSLLRRPEVKRDL 136

Query: 127 EK 128
           ++
Sbjct: 137 DE 138


>gi|94497013|ref|ZP_01303587.1| ribosome-binding factor A [Sphingomonas sp. SKA58]
 gi|94423689|gb|EAT08716.1| ribosome-binding factor A [Sphingomonas sp. SKA58]
          Length = 133

 Score =  136 bits (344), Expect = 8e-31,   Method: Composition-based stats.
 Identities = 44/127 (34%), Positives = 69/127 (54%), Gaps = 1/127 (0%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M N+    S R LRVGE+VR  L  ++   +  D ++S  V+S++EV MS DLR ATV+I
Sbjct: 1   MSNQPEGPSVRLLRVGEQVRHVLSEILQRGDVHDDVLSSHVVSVTEVRMSPDLRHATVFI 60

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              L    D V+ AL  N  +++  +   +R L+Y  +L+F  D S      ++ L+  P
Sbjct: 61  KSLLGQDEDAVLKALRTNTAYLQREVAHRIR-LKYAAKLKFLSDESFDEGSHIDKLLRDP 119

Query: 121 KIPVALE 127
           K+   L+
Sbjct: 120 KVARDLD 126


>gi|154244249|ref|YP_001415207.1| ribosome-binding factor A [Xanthobacter autotrophicus Py2]
 gi|238686704|sp|A7IC07|RBFA_XANP2 RecName: Full=Ribosome-binding factor A
 gi|154158334|gb|ABS65550.1| ribosome-binding factor A [Xanthobacter autotrophicus Py2]
          Length = 151

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 48/127 (37%), Positives = 70/127 (55%), Gaps = 4/127 (3%)

Query: 1   MKNKNP---KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVAT 57
           MK         S+R LRVGE VR AL  V+      D +++  +I++ EV MS DL++AT
Sbjct: 1   MKPDTRTGGGPSQRMLRVGELVRHALADVLQRGSVTDPVLAAHIITVPEVRMSPDLKIAT 60

Query: 58  VYISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
            Y+          VI AL  N +++R  +GR +  L+ VPELRFR DTS     +++AL+
Sbjct: 61  CYVMPLGGKDITPVIKALAANARYLRLEVGRRM-ELKSVPELRFREDTSFDEGARMDALL 119

Query: 118 CLPKIPV 124
             PK+  
Sbjct: 120 RSPKVVR 126


>gi|119385523|ref|YP_916579.1| ribosome-binding factor A [Paracoccus denitrificans PD1222]
 gi|166219383|sp|A1B5T9|RBFA_PARDP RecName: Full=Ribosome-binding factor A
 gi|119375290|gb|ABL70883.1| ribosome-binding factor A [Paracoccus denitrificans PD1222]
          Length = 138

 Score =  136 bits (343), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +     S+R LRVGE +R  L  V+L  +  D  ++R  I++ EV  S DL+VAT Y+  
Sbjct: 7   HSGTGPSQRQLRVGELIRRTLSDVLLRGDVHDPELNRHSITVGEVRTSPDLKVATAYVLP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 +  ++AL  N   +R  + +++  L+Y P+LRF  D +         L+   ++
Sbjct: 67  LGGHDAEEALAALRRNAGELRHLVAKAM-TLKYAPQLRFVLDETFDRMDDTRRLLSEDRV 125

Query: 123 PVALE 127
              +E
Sbjct: 126 RRDVE 130


>gi|300024999|ref|YP_003757610.1| ribosome-binding factor A [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526820|gb|ADJ25289.1| ribosome-binding factor A [Hyphomicrobium denitrificans ATCC 51888]
          Length = 132

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 44/124 (35%), Positives = 69/124 (55%), Gaps = 1/124 (0%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
           +   S+R LRVGE +R  +  ++   E  D +++  VI+I EV +S DL++ATVY+    
Sbjct: 10  SKAPSQRMLRVGELIRHKIAEMLSRGEIHDDVLASHVITIPEVRLSPDLKLATVYVMPLG 69

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                 VI AL  N K+IR  +  +L NLRY P+LRFR D + +   +++ L+   K+  
Sbjct: 70  GNDVKPVIEALTRNKKYIRAEVAHTL-NLRYAPDLRFREDETFEEATRIDRLLDSEKVRR 128

Query: 125 ALEK 128
              K
Sbjct: 129 DTGK 132


>gi|83595111|ref|YP_428863.1| ribosome-binding factor A [Rhodospirillum rubrum ATCC 11170]
 gi|123525360|sp|Q2RMR9|RBFA_RHORT RecName: Full=Ribosome-binding factor A
 gi|83578025|gb|ABC24576.1| ribosome-binding factor A [Rhodospirillum rubrum ATCC 11170]
          Length = 164

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 65/125 (52%), Gaps = 1/125 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +  +   ++R LRVGEE+R AL  V      +D  ++   ++++EV +S DLR ATV++ 
Sbjct: 3   RTSDKAPTQRQLRVGEEIRHALAEVFERGTVRDPAVAGVALTVTEVRISPDLRNATVFLV 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                  D V++ L     F+R  +   + + ++VP+LRF  D S      +N L+  P+
Sbjct: 63  RLGGGPLDEVLTGLRKARAFLRREVAIRI-HTKFVPDLRFESDPSFDYAEYINGLLHRPE 121

Query: 122 IPVAL 126
           +   L
Sbjct: 122 VARDL 126


>gi|258543553|ref|YP_003188986.1| ribosome-binding factor A [Acetobacter pasteurianus IFO 3283-01]
 gi|256634631|dbj|BAI00607.1| ribosome-binding factor A [Acetobacter pasteurianus IFO 3283-01]
 gi|256637687|dbj|BAI03656.1| ribosome-binding factor A [Acetobacter pasteurianus IFO 3283-03]
 gi|256640741|dbj|BAI06703.1| ribosome-binding factor A [Acetobacter pasteurianus IFO 3283-07]
 gi|256643796|dbj|BAI09751.1| ribosome-binding factor A [Acetobacter pasteurianus IFO 3283-22]
 gi|256646851|dbj|BAI12799.1| ribosome-binding factor A [Acetobacter pasteurianus IFO 3283-26]
 gi|256649904|dbj|BAI15845.1| ribosome-binding factor A [Acetobacter pasteurianus IFO 3283-32]
 gi|256652894|dbj|BAI18828.1| ribosome-binding factor A [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655948|dbj|BAI21875.1| ribosome-binding factor A [Acetobacter pasteurianus IFO 3283-12]
          Length = 154

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 39/121 (32%), Positives = 64/121 (52%), Gaps = 1/121 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LRVGEEVR  L  V     F+D  +    ++++EV +S D R ATV+I+    
Sbjct: 24  SGPSQRQLRVGEEVRRVLAEVFARTTFRDPDLVDVDLTVTEVRLSPDFRHATVFITRLGR 83

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                ++ AL     ++R ++   +R  R VPEL F+ DT+L +   ++ L+  P++   
Sbjct: 84  SDVAELLPALKRVAPWLRTQLAHKIRA-RTVPELHFQPDTALDTAMHMDTLLRSPEVQRD 142

Query: 126 L 126
           L
Sbjct: 143 L 143


>gi|316931580|ref|YP_004106562.1| ribosome-binding factor A [Rhodopseudomonas palustris DX-1]
 gi|315599294|gb|ADU41829.1| ribosome-binding factor A [Rhodopseudomonas palustris DX-1]
          Length = 137

 Score =  135 bits (341), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 67/126 (53%), Gaps = 1/126 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K+     S R+LRVGE VR A+  ++      D ++   ++++ EV MS DL++AT+Y+ 
Sbjct: 7   KSSPSGGSTRSLRVGELVRHAVAEILSQGGVHDPVLESHLVTVPEVRMSPDLKLATIYVM 66

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    V+ AL  + +F+RG I   +  L++ P++RFR D       +++ L+  P 
Sbjct: 67  PLGGRDEKLVLDALEHHKRFLRGEIAHRV-ALKFAPDIRFRIDERFAEAERIDRLLRSPA 125

Query: 122 IPVALE 127
           +   LE
Sbjct: 126 VQKDLE 131


>gi|296285007|ref|ZP_06863005.1| ribosome-binding factor A [Citromicrobium bathyomarinum JL354]
          Length = 137

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/122 (32%), Positives = 66/122 (54%), Gaps = 1/122 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
            + S R L+VGE VR  L  ++   E  D  +S   +S++EV M+ DL+ A+VY+   L 
Sbjct: 9   EQQSVRVLKVGERVRHILSELLTRGEVHDETLSAHSVSVTEVKMTPDLKHASVYVKPLLG 68

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              D V+ AL  N  F +  + + L  L++ P+L+FR D S +   ++  L+  PK+   
Sbjct: 69  EDEDVVVKALRTNTAFFQREVAKRL-GLKFAPKLQFRPDESFEEADRIERLLNDPKVARD 127

Query: 126 LE 127
           L+
Sbjct: 128 LD 129


>gi|84500520|ref|ZP_00998769.1| ribosome-binding factor A [Oceanicola batsensis HTCC2597]
 gi|84391473|gb|EAQ03805.1| ribosome-binding factor A [Oceanicola batsensis HTCC2597]
          Length = 134

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 40/128 (31%), Positives = 65/128 (50%), Gaps = 1/128 (0%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           + N  P  S+R LRVGE +R AL  +++  +  D  ++R  I++ EV  S DL+VAT ++
Sbjct: 8   IHNDGPGPSQRQLRVGETIRRALSEILMRGDIHDPDLNRLSITVGEVRTSPDLKVATAFV 67

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                   D V+  L  N   +R  IG+ L  L++ P+LRFR D +     +   L    
Sbjct: 68  LPLGGTGQDVVVDLLARNKGELRRMIGKKL-GLKFTPDLRFRVDDTFDRMDETRRLFQQD 126

Query: 121 KIPVALEK 128
            +   +E+
Sbjct: 127 DVRRDVEE 134


>gi|83945012|ref|ZP_00957378.1| ribosome-binding factor A [Oceanicaulis alexandrii HTCC2633]
 gi|83851794|gb|EAP89649.1| ribosome-binding factor A [Oceanicaulis alexandrii HTCC2633]
          Length = 140

 Score =  135 bits (340), Expect = 2e-30,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 65/123 (52%), Gaps = 1/123 (0%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
               S+R LR GE VR A+  +I      D  ++   ++I+E  +S DLR ATVY+ L  
Sbjct: 14  MKAQSQRQLRAGELVRRAVSDIIREGRVHDPHVNTAAVTITEARVSPDLRHATVYVDLLG 73

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               + V +ALN    FI+  +GR +  L++ P+LRF  D  +    +++AL+  P +  
Sbjct: 74  GGDREAVATALNHAAGFIQRELGRQI-ELKFTPKLRFAVDDRIDDVREVDALLDRPSVKR 132

Query: 125 ALE 127
            LE
Sbjct: 133 DLE 135


>gi|312112865|ref|YP_004010461.1| ribosome-binding factor A [Rhodomicrobium vannielii ATCC 17100]
 gi|311217994|gb|ADP69362.1| ribosome-binding factor A [Rhodomicrobium vannielii ATCC 17100]
          Length = 128

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 73/129 (56%), Gaps = 3/129 (2%)

Query: 1   MK--NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATV 58
           MK  + +   S+R LR GE +R AL  +    + +D  +   +I+++EV +S DL+ ATV
Sbjct: 1   MKPTHDSKGPSQRQLRAGELLRHALAEIFRLEDIEDDELKGQLITVAEVRVSPDLKHATV 60

Query: 59  YISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           + S       D +  ALN + +F+RG + R +  L+YVPEL FR D +L +  +++ L+ 
Sbjct: 61  FASALGGKPGDVIAKALNRHARFLRGELARRI-ELKYVPELVFRADHALDAAERIDELLR 119

Query: 119 LPKIPVALE 127
            P +   L+
Sbjct: 120 SPDVARDLK 128


>gi|294011607|ref|YP_003545067.1| ribosome-binding factor A [Sphingobium japonicum UT26S]
 gi|292674937|dbj|BAI96455.1| ribosome-binding factor A [Sphingobium japonicum UT26S]
          Length = 133

 Score =  135 bits (340), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 68/128 (53%), Gaps = 1/128 (0%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M   N   S R LRVGE+VR  L  ++   +  D +++  V+S++EV MS DLR ATV+I
Sbjct: 1   MPAPNEGPSVRLLRVGEQVRHVLSDILQRGDVHDDVLASHVVSVTEVRMSPDLRHATVFI 60

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              L      V+ AL  N  F++  +   +R L+Y  +L+F  D S      ++ L+  P
Sbjct: 61  KSLLGQDEAAVLKALRTNTAFLQREVATRIR-LKYAAKLKFLADESFDEGSHIDKLLRDP 119

Query: 121 KIPVALEK 128
           K+   LE+
Sbjct: 120 KVARDLEQ 127


>gi|254500779|ref|ZP_05112930.1| ribosome-binding factor A [Labrenzia alexandrii DFL-11]
 gi|222436850|gb|EEE43529.1| ribosome-binding factor A [Labrenzia alexandrii DFL-11]
          Length = 137

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 40/124 (32%), Positives = 67/124 (54%), Gaps = 1/124 (0%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
            +   S+R L+VGE VR  L  +     F D  +   +I+I EV M+ DLR+AT  +   
Sbjct: 8   DSQGPSQRQLKVGETVRKELSDIFTRGRFSDPDLDGVIITIPEVRMTPDLRLATCLVMPL 67

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
              + ++V  ALN + K++RG++ R L  ++Y+P+LRF  DT      ++  L+  P + 
Sbjct: 68  GGANAEKVEKALNRSAKYLRGQVSRRL-TMKYMPDLRFVLDTRFDDDDRIGTLLHSPDVA 126

Query: 124 VALE 127
             L+
Sbjct: 127 RDLD 130


>gi|49475026|ref|YP_033067.1| ribosome-binding factor A [Bartonella henselae str. Houston-1]
 gi|61215011|sp|Q6G4W8|RBFA_BARHE RecName: Full=Ribosome-binding factor A
 gi|49237831|emb|CAF27026.1| Ribosomal-binding factor A [Bartonella henselae str. Houston-1]
          Length = 135

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 53/129 (41%), Positives = 79/129 (61%), Gaps = 5/129 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MKN   + S+R LRVGE+VR A+  ++      D L+   VIS+ EV MS DL++A  ++
Sbjct: 1   MKNA--EPSQRQLRVGEQVRHAVAHILQQGILLDNLLKNMVISVVEVRMSPDLKIAICFV 58

Query: 61  SLPLDVS---PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
           S    V       V++ALN + +FIRG I  SLR ++Y+PELRFR D S  ++ K++AL+
Sbjct: 59  SPLSTVHNASRADVVNALNKHSRFIRGEISHSLRQMKYMPELRFRLDNSFDNFSKIDALL 118

Query: 118 CLPKIPVAL 126
             P++   L
Sbjct: 119 RSPEVARDL 127


>gi|114766563|ref|ZP_01445519.1| ribosome-binding factor A [Pelagibaca bermudensis HTCC2601]
 gi|114541179|gb|EAU44231.1| ribosome-binding factor A [Roseovarius sp. HTCC2601]
          Length = 131

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 61/125 (48%), Gaps = 1/125 (0%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
             P  S+R LRVGE +R  L  V+   +  D  ++R  I++ EV +S DL+VAT Y+   
Sbjct: 8   DGPGPSQRQLRVGELIRRTLSEVLTRGDIHDPELNRLSITVGEVTVSPDLKVATAYVVPL 67

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
               PD +   L  N   +R  + + L  L++ PE+RF+ D +     +   L     + 
Sbjct: 68  GGGKPDEMFDLLKRNKSELRRAVSKGL-TLKFAPEIRFKLDETFDRLDETRRLFSQDAVR 126

Query: 124 VALEK 128
             +E+
Sbjct: 127 RDVEE 131


>gi|110636255|ref|YP_676463.1| ribosome-binding factor A [Mesorhizobium sp. BNC1]
 gi|123057284|sp|Q11BC7|RBFA_MESSB RecName: Full=Ribosome-binding factor A
 gi|110287239|gb|ABG65298.1| ribosome-binding factor A [Chelativorans sp. BNC1]
          Length = 133

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 46/120 (38%), Positives = 78/120 (65%), Gaps = 1/120 (0%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
           +   S+R LRVGE+ R AL  V+   + +D  +   VIS+SEV MS DL++ATV++S   
Sbjct: 3   SSAPSQRQLRVGEQARHALSDVLQREDMRDPALEGAVISVSEVRMSPDLKIATVFVSPL- 61

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               + +I+ALN + ++IRGR+  +LR ++Y+PE RF  DTS +++ K++ ++  P++  
Sbjct: 62  SGDKEAIIAALNRHARYIRGRVSPALRQMKYMPEFRFHLDTSYENFEKIDRILRSPEVAR 121


>gi|146278956|ref|YP_001169115.1| ribosome-binding factor A [Rhodobacter sphaeroides ATCC 17025]
 gi|145557197|gb|ABP71810.1| ribosome-binding factor A [Rhodobacter sphaeroides ATCC 17025]
          Length = 165

 Score =  134 bits (338), Expect = 4e-30,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 1/124 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +     S+R LRVGE +R  L  V+   E  D  ++R  I++ EV  S DL+VATV++  
Sbjct: 34  HTGTGPSQRQLRVGELIRRTLADVLNRGEIHDPDLNRMSITVGEVRCSPDLKVATVHVMP 93

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 +  I+ L+ +   +R  I R +  L+Y P+LRFR D +     +   L     +
Sbjct: 94  LGGKDVEEAIALLSKHRGELRHHITRQM-TLKYAPDLRFRPDETFDRLDETRRLFSDETV 152

Query: 123 PVAL 126
              +
Sbjct: 153 QRDI 156


>gi|158421645|ref|YP_001522937.1| ribosome-binding factor A [Azorhizobium caulinodans ORS 571]
 gi|172048016|sp|A8IG22|RBFA_AZOC5 RecName: Full=Ribosome-binding factor A
 gi|158328534|dbj|BAF86019.1| ribosome-binding factor A [Azorhizobium caulinodans ORS 571]
          Length = 145

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 43/130 (33%), Positives = 66/130 (50%), Gaps = 4/130 (3%)

Query: 1   MK---NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVAT 57
           MK         S+R LRVGE VR AL   +   +  D  ++  +I++ EV MS DL++AT
Sbjct: 1   MKTQDRSGSGPSQRMLRVGELVRHALADALQRGDHLDPALAGTIITVPEVRMSPDLKIAT 60

Query: 58  VYISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
            ++        + VI  L  N K +R  + R +  L+ VP LRF  DTS     +++AL+
Sbjct: 61  CFVMPLGGKDVNTVIKLLAANQKLLRTEVARRV-ELKSVPSLRFLRDTSFDEGARIDALL 119

Query: 118 CLPKIPVALE 127
             P +   L+
Sbjct: 120 RRPDVARDLD 129


>gi|163867510|ref|YP_001608709.1| ribosome-binding factor A [Bartonella tribocorum CIP 105476]
 gi|189039527|sp|A9IMT2|RBFA_BART1 RecName: Full=Ribosome-binding factor A
 gi|161017156|emb|CAK00714.1| Ribosome-binding factor A [Bartonella tribocorum CIP 105476]
          Length = 135

 Score =  134 bits (337), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 49/129 (37%), Positives = 79/129 (61%), Gaps = 5/129 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MKN     S+R LRV E+VR A+  ++      D ++   VIS+SEV +S DL++AT ++
Sbjct: 1   MKNA--GPSQRQLRVAEQVRHAVAHILQRGILLDDVLKDIVISVSEVRISPDLKIATCFV 58

Query: 61  SLPL---DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
           S      + S   V++ LN + +F+RG I  +LR ++Y+PELRFR D S  ++ K++AL+
Sbjct: 59  SPLSTLKNTSHTDVVNTLNKHSRFLRGEISHALRQMKYMPELRFRLDNSFDNFSKIDALL 118

Query: 118 CLPKIPVAL 126
             P++   L
Sbjct: 119 RSPEVARDL 127


>gi|307293336|ref|ZP_07573182.1| ribosome-binding factor A [Sphingobium chlorophenolicum L-1]
 gi|306881402|gb|EFN12618.1| ribosome-binding factor A [Sphingobium chlorophenolicum L-1]
          Length = 133

 Score =  133 bits (336), Expect = 7e-30,   Method: Composition-based stats.
 Identities = 42/128 (32%), Positives = 68/128 (53%), Gaps = 1/128 (0%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M   N   S R LRVGE+VR  L  ++   +  D ++   V+S++EV MS DLR ATV+I
Sbjct: 1   MPAPNEGPSVRLLRVGEQVRHILSDILQRGDVHDDVLVSHVVSVTEVRMSPDLRHATVFI 60

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              L    + V+ AL  N  +++  +   +R L+Y  +L+F  D S      ++ L+  P
Sbjct: 61  KSLLGQDEEAVLKALRTNTAYLQREVATRIR-LKYAAKLKFLADESFDEGTHIDKLLRDP 119

Query: 121 KIPVALEK 128
           K+   L++
Sbjct: 120 KVARDLDQ 127


>gi|319408010|emb|CBI81664.1| Ribosome-binding factor A [Bartonella schoenbuchensis R1]
          Length = 135

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 51/129 (39%), Positives = 78/129 (60%), Gaps = 5/129 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MKN     S+R LRVGE+VR  L  ++  +   D ++   VISISEV MS DL++AT ++
Sbjct: 1   MKNT--GPSQRQLRVGEQVRHVLAHILQRDILLDDVLKGVVISISEVRMSADLKIATCFV 58

Query: 61  SLPLDVS---PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
           S    +       +I  LN + +FIR  I   LR ++Y+PELRFR+D+S  ++ K++AL+
Sbjct: 59  SPLSTIHDISHTAIIEVLNKHSRFIRKEISHQLRQMKYMPELRFRFDSSFDNFSKIDALL 118

Query: 118 CLPKIPVAL 126
             P++   L
Sbjct: 119 HSPEVARDL 127


>gi|254295407|ref|YP_003061430.1| ribosome-binding factor A [Hirschia baltica ATCC 49814]
 gi|254043938|gb|ACT60733.1| ribosome-binding factor A [Hirschia baltica ATCC 49814]
          Length = 143

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 44/123 (35%), Positives = 69/123 (56%), Gaps = 3/123 (2%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LR GE VR AL+ ++L  +F D  ++   I++SEV MS DL+ AT Y++    
Sbjct: 10  KGPSQRQLRAGELVRHALVDILLREQFNDPALADVSITVSEVRMSPDLQHATCYVAPLGG 69

Query: 66  VS--PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                + ++  LN    F+RGR+GR + ++RY P+LRF  D S     K+  L+  P++ 
Sbjct: 70  DESAQESIVHGLNRAKGFLRGRLGREI-DMRYTPQLRFLSDDSYTEAGKIGDLLASPEVA 128

Query: 124 VAL 126
             L
Sbjct: 129 RDL 131


>gi|241207068|ref|YP_002978164.1| ribosome-binding factor A [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860958|gb|ACS58625.1| ribosome-binding factor A [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 134

 Score =  133 bits (335), Expect = 9e-30,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 82/126 (65%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +  +   S+R LR+GE+VR+AL  V+   E +D +I   VISISEV MS DL++AT Y++
Sbjct: 3   RPTSSAPSQRMLRIGEQVRAALTQVLQRGEVRDEIIEATVISISEVRMSTDLKIATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI ALN + +FIRGR+G  LR ++Y+PE+RFR DTS  +Y K++ L+  P+
Sbjct: 63  PLGVSDHSIVIKALNRHARFIRGRLGPQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPE 122

Query: 122 IPVALE 127
           +   L+
Sbjct: 123 VSRDLD 128


>gi|163734260|ref|ZP_02141700.1| ribosome-binding factor A [Roseobacter litoralis Och 149]
 gi|161392268|gb|EDQ16597.1| ribosome-binding factor A [Roseobacter litoralis Och 149]
          Length = 140

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 63/123 (51%), Gaps = 1/123 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +  P  S+R LRVGE +R AL  V+   +  D  ++R  +++ EV +S DL++AT Y+  
Sbjct: 7   HTGPGPSQRQLRVGETIRRALSDVLARGDVHDTDLNRLSVTVGEVRVSPDLKIATAYVLP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 D VI+ L  N   +R  + + L  L++ P+LRF+ D +     +   ++   ++
Sbjct: 67  LGGQGRDEVIALLARNKGELRRLVAKKL-TLKFAPDLRFQLDETFDRMDETREMLNRAEV 125

Query: 123 PVA 125
              
Sbjct: 126 KRD 128


>gi|315122008|ref|YP_004062497.1| ribosome-binding factor A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495410|gb|ADR52009.1| ribosome-binding factor A [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 132

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 98/127 (77%), Positives = 110/127 (86%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MKNK+   SRRALRVGEEVRSALMWVILNNEFQD LI RD+ISISEVCMSVDLRVATVY+
Sbjct: 1   MKNKSSVPSRRALRVGEEVRSALMWVILNNEFQDNLIHRDIISISEVCMSVDLRVATVYV 60

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           SLP DVSPD VI AL CN KF+RGRI +SLRNL+Y+PELRFRYDTSLQ+YWK++ LMC  
Sbjct: 61  SLPPDVSPDVVIDALKCNNKFLRGRISQSLRNLKYIPELRFRYDTSLQNYWKIDTLMCSS 120

Query: 121 KIPVALE 127
           K+   L+
Sbjct: 121 KVVRDLK 127


>gi|162147161|ref|YP_001601622.1| ribosome-binding factor A [Gluconacetobacter diazotrophicus PAl 5]
 gi|182676540|sp|A9HF21|RBFA_GLUDA RecName: Full=Ribosome-binding factor A
 gi|161785738|emb|CAP55309.1| putative ribosome-binding factor A [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 136

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 68/122 (55%), Gaps = 1/122 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              ++R LRVGEEVR  L  +    EF+D  +    I+++EV +S DL+ AT +++    
Sbjct: 16  SGPTQRQLRVGEEVRRMLADLFARTEFRDPELVDVRITVTEVRISPDLKHATAFVARLGR 75

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              + ++ AL     F+R R+   LR LR VPE+ F+ DT+L    +++AL+  P +   
Sbjct: 76  SDVETLLPALKRVAPFLRSRLSTGLR-LRGVPEIHFQPDTALDYAMEVDALLRQPDVARD 134

Query: 126 LE 127
           L+
Sbjct: 135 LD 136


>gi|222084325|ref|YP_002542854.1| ribosome-binding factor A [Agrobacterium radiobacter K84]
 gi|221721773|gb|ACM24929.1| ribosome-binding factor A [Agrobacterium radiobacter K84]
          Length = 139

 Score =  132 bits (333), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 82/123 (66%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +      S+R LRVGE+VR+A+  V+   E +D LI R VISISEV MS DL++AT +++
Sbjct: 4   RPTTSAPSQRMLRVGEQVRAAITQVLQRGEVRDDLIERTVISISEVRMSPDLKIATAFVT 63

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                  D +I  LN + K+IRGR+G+ LR ++Y+PE+RFR DTS  +Y K++AL+  P+
Sbjct: 64  PLGVADHDLIIDTLNRHTKYIRGRLGQHLRQMKYMPEIRFRDDTSFDNYKKIDALLRSPE 123

Query: 122 IPV 124
           +  
Sbjct: 124 VQR 126


>gi|114799473|ref|YP_758849.1| ribosome-binding factor A [Hyphomonas neptunium ATCC 15444]
 gi|123323719|sp|Q0C5Z4|RBFA_HYPNA RecName: Full=Ribosome-binding factor A
 gi|114739647|gb|ABI77772.1| ribosome-binding factor A [Hyphomonas neptunium ATCC 15444]
          Length = 135

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/123 (32%), Positives = 68/123 (55%), Gaps = 4/123 (3%)

Query: 8   NSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS 67
            S+R LR GE VR AL  +I   +F+D  +S  ++++ EV  S DL+ A ++++   D S
Sbjct: 11  PSQRQLRAGEIVRHALAEIISREDFRDPDLSNVIVTVGEVRCSPDLKHANIFVTPLGDDS 70

Query: 68  PD---RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
            +   R+  AL     F+R R+GR +  L++ PEL F  D+S      ++ L+  P++  
Sbjct: 71  EEGRKRLADALTRAKGFLRTRLGREI-ELKFTPELHFIADSSYDEATAIDRLLNDPRVRR 129

Query: 125 ALE 127
            +E
Sbjct: 130 DVE 132


>gi|304392770|ref|ZP_07374710.1| ribosome-binding factor A [Ahrensia sp. R2A130]
 gi|303295400|gb|EFL89760.1| ribosome-binding factor A [Ahrensia sp. R2A130]
          Length = 150

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 48/124 (38%), Positives = 73/124 (58%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
            KN   S+R LRVGE VR ALM V+   +  D +++  +I+ISEV M+ DL++A  Y+SL
Sbjct: 2   KKNKGPSQRQLRVGELVRHALMDVLAREQLDDPVLASAMITISEVRMTADLKIANCYVSL 61

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 + V+ AL     F+RGR G  L  +R +P  RFR DTS +++ +++AL+    +
Sbjct: 62  LGGGDMEAVLKALGRAEGFLRGRSGPHLSQMRSMPTFRFREDTSFENFARIDALLKSDAV 121

Query: 123 PVAL 126
              L
Sbjct: 122 KRDL 125


>gi|254420363|ref|ZP_05034087.1| ribosome-binding factor A [Brevundimonas sp. BAL3]
 gi|196186540|gb|EDX81516.1| ribosome-binding factor A [Brevundimonas sp. BAL3]
          Length = 151

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 40/130 (30%), Positives = 72/130 (55%), Gaps = 9/130 (6%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-- 64
             S+R LR GE +R AL+ ++   +  D  ++   ++++EV +S DL+ AT ++      
Sbjct: 15  GPSQRQLRAGELIRHALVDILREEDIHDEALADVSVTVTEVRLSPDLKHATCFVEPLGAG 74

Query: 65  ------DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
                       +I ALN + KF+RG++GR L ++++ P+LRFR+D S  +   L+ L  
Sbjct: 75  VEAAATTGHESEIIKALNVHAKFLRGQLGRRL-DMKFTPDLRFRHDESFDAASHLDRLFE 133

Query: 119 LPKIPVALEK 128
            P++   LE+
Sbjct: 134 DPRVRADLER 143


>gi|99079927|ref|YP_612081.1| ribosome-binding factor A [Ruegeria sp. TM1040]
 gi|259417241|ref|ZP_05741160.1| ribosome-binding factor A [Silicibacter sp. TrichCH4B]
 gi|122398485|sp|Q1GKJ7|RBFA_SILST RecName: Full=Ribosome-binding factor A
 gi|99036207|gb|ABF62819.1| ribosome-binding factor A [Ruegeria sp. TM1040]
 gi|259346147|gb|EEW57961.1| ribosome-binding factor A [Silicibacter sp. TrichCH4B]
          Length = 131

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 59/125 (47%), Gaps = 1/125 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +  P  S+R LRVGE +R  L  V+   +  D  ++R  I++ EV  S DL++AT Y+  
Sbjct: 7   HDGPGPSQRQLRVGEVIRRTLSEVLARGDIHDPELNRLSITVGEVRTSPDLKIATAYVLP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 + V+  L  N   +R  IG+    L++ P+LRF+ D +         L     +
Sbjct: 67  LGGKGQEDVLQLLARNKSELRRAIGKK-TGLKFTPDLRFQIDETFDRMDDTRRLFNQDAV 125

Query: 123 PVALE 127
              LE
Sbjct: 126 RRDLE 130


>gi|148259246|ref|YP_001233373.1| ribosome-binding factor A [Acidiphilium cryptum JF-5]
 gi|326402399|ref|YP_004282480.1| ribosome-binding factor A [Acidiphilium multivorum AIU301]
 gi|172047759|sp|A5FV22|RBFA_ACICJ RecName: Full=Ribosome-binding factor A
 gi|146400927|gb|ABQ29454.1| ribosome-binding factor A [Acidiphilium cryptum JF-5]
 gi|325049260|dbj|BAJ79598.1| ribosome-binding factor A [Acidiphilium multivorum AIU301]
          Length = 140

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 43/123 (34%), Positives = 69/123 (56%), Gaps = 1/123 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R  RV E++R  L  +    EF+D  ++   I+++EV MS DL+ ATV++S    
Sbjct: 15  EGPSQRQRRVAEDLRHRLAELFARTEFRDPELAGVHITVAEVRMSPDLKHATVFVSRLGA 74

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              DR + AL     F+RG IG  LR +++VP+L F+ D +L    ++N L+  P++   
Sbjct: 75  TDIDRYLPALKRIAPFLRGEIGHGLR-MKFVPDLHFQPDHALDEATRINELLHRPEVMRD 133

Query: 126 LEK 128
           L K
Sbjct: 134 LLK 136


>gi|260427176|ref|ZP_05781155.1| ribosome-binding factor A [Citreicella sp. SE45]
 gi|260421668|gb|EEX14919.1| ribosome-binding factor A [Citreicella sp. SE45]
          Length = 132

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 60/125 (48%), Gaps = 1/125 (0%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
                S+R LRVGE +R  L  V+   +  D  ++R  I++ EV +S DL+VAT Y+   
Sbjct: 8   DGHGPSQRQLRVGELIRRTLSDVLTRGDIHDPELNRLSITVGEVVVSPDLKVATAYVVPL 67

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
              + D +   L  N   +R  + + L  L++ PELRF+ D +     +   L     + 
Sbjct: 68  GGGASDEMFDLLKRNRSELRRAVSKGL-TLKFAPELRFKLDETFDRLDETRRLFAQDAVR 126

Query: 124 VALEK 128
             LE+
Sbjct: 127 RDLEE 131


>gi|260432190|ref|ZP_05786161.1| ribosome-binding factor A [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416018|gb|EEX09277.1| ribosome-binding factor A [Silicibacter lacuscaerulensis ITI-1157]
          Length = 131

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 1/126 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +  P  S+R LRVGE +R  L  V+   +  D  ++R  I++ EV  S DL++AT Y+  
Sbjct: 7   HDGPGPSQRQLRVGELIRRTLSEVLARGDVHDPDLNRLSITVGEVRTSPDLKIATAYVLP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 + VI  L  N   +R  +G+ +  L++ P+LRFR D +         ++    +
Sbjct: 67  LGGKGQETVIELLARNKGELRRMVGKKV-GLKFAPDLRFRLDETFDRMDDTRRMLEQDAV 125

Query: 123 PVALEK 128
              L++
Sbjct: 126 RRDLDE 131


>gi|209544217|ref|YP_002276446.1| ribosome-binding factor A [Gluconacetobacter diazotrophicus PAl 5]
 gi|209531894|gb|ACI51831.1| ribosome-binding factor A [Gluconacetobacter diazotrophicus PAl 5]
          Length = 145

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 68/122 (55%), Gaps = 1/122 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              ++R LRVGEEVR  L  +    EF+D  +    I+++EV +S DL+ AT +++    
Sbjct: 25  SGPTQRQLRVGEEVRRMLADLFARTEFRDPELVDVRITVTEVRISPDLKHATAFVARLGR 84

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              + ++ AL     F+R R+   LR LR VPE+ F+ DT+L    +++AL+  P +   
Sbjct: 85  SDVETLLPALKRVAPFLRSRLSTGLR-LRGVPEIHFQPDTALDYAMEVDALLRQPDVARD 143

Query: 126 LE 127
           L+
Sbjct: 144 LD 145


>gi|319406544|emb|CBI80186.1| Ribosome-binding factor A [Bartonella sp. 1-1C]
          Length = 137

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 54/126 (42%), Positives = 78/126 (61%), Gaps = 3/126 (2%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           KNP  S+R LRVGE+VR A+  ++      D +    VIS+SEV MS DL++AT ++S  
Sbjct: 2   KNPHPSQRQLRVGEQVRHAIAHILQRGILLDDIFKNIVISVSEVRMSSDLKIATCFVSFL 61

Query: 64  LDVS---PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             V     D +ISALN N +FIRG I   LR ++Y+P LRFR+D S  ++ K++ L+  P
Sbjct: 62  NTVDQTSHDAIISALNKNSRFIRGAISHQLRQMKYMPALRFRFDNSFDNFAKIDTLLRSP 121

Query: 121 KIPVAL 126
           ++   L
Sbjct: 122 EVARDL 127


>gi|332188278|ref|ZP_08390005.1| ribosome-binding factor A [Sphingomonas sp. S17]
 gi|332011674|gb|EGI53752.1| ribosome-binding factor A [Sphingomonas sp. S17]
          Length = 135

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 69/126 (54%), Gaps = 1/126 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
               + S R LRVGE+VR  L  ++   +  D  +++ ++S++EV MS DLR ATV++  
Sbjct: 5   KNPAEPSVRLLRVGEQVRHILSEILARGDVHDETLAKHMVSVTEVRMSPDLRHATVFVKP 64

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
            L    + VI AL  N  +++  +   ++ ++Y  +L+F  D S      +++L+  PK+
Sbjct: 65  LLGKDEEVVIKALRTNTAYLQREVAHRVK-MKYAAKLKFLADESFDEGSHIDSLLRSPKV 123

Query: 123 PVALEK 128
              LE+
Sbjct: 124 SQDLEE 129


>gi|241761096|ref|ZP_04759185.1| ribosome-binding factor A [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260752938|ref|YP_003225831.1| ribosome-binding factor A [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|241374715|gb|EER64176.1| ribosome-binding factor A [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258552301|gb|ACV75247.1| ribosome-binding factor A [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 141

 Score =  131 bits (331), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 72/130 (55%), Gaps = 3/130 (2%)

Query: 1   MKNKNPKN--SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATV 58
           M+        S R LRVGE++R  L  +++  E     +    +SISEV M+ DLR+ATV
Sbjct: 1   MRRNQTPEGHSIRPLRVGEQIRHVLAEMLMRGEIHGDTLDNLFVSISEVRMTPDLRIATV 60

Query: 59  YISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           ++      S D VI  L+ N  F++  I + +R L+YVP+LRF  D S +   ++++L+ 
Sbjct: 61  FVKSLGGASDDTVIGVLSKNASFLQAAIAKKIR-LKYVPKLRFLADESFEQGSRIDSLLR 119

Query: 119 LPKIPVALEK 128
            P +   L++
Sbjct: 120 SPHVQRDLQE 129


>gi|86355775|ref|YP_467667.1| ribosome-binding factor A [Rhizobium etli CFN 42]
 gi|123513437|sp|Q2KDZ6|RBFA_RHIEC RecName: Full=Ribosome-binding factor A
 gi|86279877|gb|ABC88940.1| ribosome binding factor A, rRNA processing protein [Rhizobium etli
           CFN 42]
          Length = 136

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 55/121 (45%), Positives = 80/121 (66%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +  +   S+R LRVGE+VR+A+  V+   E +D +I   VISISEV MS DL++AT Y++
Sbjct: 3   RPTSSAPSQRMLRVGEQVRAAITQVLQRGEVRDDIIEATVISISEVRMSPDLKIATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    VI ALN + KFIRGR+G  LR ++Y+PE+RFR DTS  +Y K++ L+  P+
Sbjct: 63  PLGVSDHSIVIEALNRHAKFIRGRLGPQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPE 122

Query: 122 I 122
           +
Sbjct: 123 V 123


>gi|84684345|ref|ZP_01012246.1| ribosome-binding factor A [Maritimibacter alkaliphilus HTCC2654]
 gi|84667324|gb|EAQ13793.1| ribosome-binding factor A [Rhodobacterales bacterium HTCC2654]
          Length = 136

 Score =  131 bits (331), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 40/124 (32%), Positives = 62/124 (50%), Gaps = 1/124 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           N+    S+R LRVGE +R  L  V++  E  D  ++R  I++ EV  S DL++AT Y+  
Sbjct: 7   NEGTGPSQRQLRVGELIRRTLSDVLMRGEIHDPDLNRMSITVGEVRTSPDLKIATAYVLP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
               +PD  I AL  N   +R  IG+ + NL++ P+LRF  D +         L     +
Sbjct: 67  LGGKNPDEAIKALARNKHELRRFIGK-VTNLKFTPDLRFMIDETFDQMDATRRLFSDETV 125

Query: 123 PVAL 126
              +
Sbjct: 126 QRDI 129


>gi|56698646|ref|YP_169023.1| ribosome-binding factor A [Ruegeria pomeroyi DSS-3]
 gi|61214678|sp|Q5LLT6|RBFA_SILPO RecName: Full=Ribosome-binding factor A
 gi|56680383|gb|AAV97049.1| ribosome-binding factor A [Ruegeria pomeroyi DSS-3]
          Length = 131

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 62/126 (49%), Gaps = 1/126 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +  P  S+R LRVGE +R  L  V+   +  D  ++R  I++ EV  S DL++AT Y+  
Sbjct: 7   HDGPGPSQRQLRVGEVIRRTLSEVLARGDVHDPDLNRMSITVGEVRTSPDLKIATAYVLP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 + V+  L+ N   +R  IG+ L  L++ P+LRFR D +         +     +
Sbjct: 67  LGGRGQEDVVQLLSRNKGELRRMIGKKL-GLKFTPDLRFRLDETFDRLDDTRRMFDQDAV 125

Query: 123 PVALEK 128
              L++
Sbjct: 126 RRDLDE 131


>gi|240849880|ref|YP_002971268.1| ribosomal-binding factor A [Bartonella grahamii as4aup]
 gi|240267003|gb|ACS50591.1| ribosomal-binding factor A [Bartonella grahamii as4aup]
          Length = 135

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 52/129 (40%), Positives = 81/129 (62%), Gaps = 5/129 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MKN   K S+R LRV E+VR A+  ++  +   D ++   VIS+SEV MS DL++AT ++
Sbjct: 1   MKNA--KPSQRQLRVAEQVRHAIAHILQRDILLDDILKDIVISVSEVRMSPDLKIATCFV 58

Query: 61  SLPL---DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
           S      +VS   V+  LN + +F+RG I  +LR ++Y+PELRFR D S  ++ K++AL+
Sbjct: 59  SPLSTLKNVSHTDVVDTLNKHSRFLRGEISHALRQMKYMPELRFRLDNSFDNFSKIDALL 118

Query: 118 CLPKIPVAL 126
             P++   L
Sbjct: 119 RSPEVARDL 127


>gi|254463718|ref|ZP_05077129.1| ribosome-binding factor A [Rhodobacterales bacterium Y4I]
 gi|206684626|gb|EDZ45108.1| ribosome-binding factor A [Rhodobacterales bacterium Y4I]
          Length = 131

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 1/126 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +  P  S+R LRVGE +R  L  V+   +  D  ++R  I++ EV  S DL++AT Y+  
Sbjct: 7   HDGPGPSQRQLRVGELIRRTLSEVLARGDVHDPDLNRMSITVGEVRTSPDLKIATAYVLP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 + V+  L  N   +R  +G+ L  L++ P+LRFR D +         ++    +
Sbjct: 67  LGGKGQEDVLKLLARNKSELRRMVGKKL-GLKFTPDLRFRLDETFDQMDDTRRMLSQDAV 125

Query: 123 PVALEK 128
              +E+
Sbjct: 126 RRDVEE 131


>gi|56551449|ref|YP_162288.1| ribosome-binding factor A [Zymomonas mobilis subsp. mobilis ZM4]
 gi|61214722|sp|Q5NQ28|RBFA_ZYMMO RecName: Full=Ribosome-binding factor A
 gi|56543023|gb|AAV89177.1| ribosome-binding factor A [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 141

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 72/130 (55%), Gaps = 3/130 (2%)

Query: 1   MKNKNPKN--SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATV 58
           M+        S R LRVGE++R  L  +++  E     +    +SISEV M+ DLR+ATV
Sbjct: 1   MRRNQTPEGHSIRPLRVGEQIRHVLAEMLMRGEIHGDTLDNLFVSISEVRMTPDLRIATV 60

Query: 59  YISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           ++      S D VI  L+ N  F++  I + +R L+YVP+LRF  D S +   ++++L+ 
Sbjct: 61  FVKSLGGASDDTVIGILSKNASFLQAAIAKKIR-LKYVPKLRFLADESFEQGSRIDSLLR 119

Query: 119 LPKIPVALEK 128
            P +   L++
Sbjct: 120 SPHVQRDLQE 129


>gi|110678026|ref|YP_681033.1| ribosome-binding factor A [Roseobacter denitrificans OCh 114]
 gi|123172936|sp|Q16CE6|RBFA_ROSDO RecName: Full=Ribosome-binding factor A
 gi|109454142|gb|ABG30347.1| ribosome-binding factor A [Roseobacter denitrificans OCh 114]
          Length = 143

 Score =  131 bits (329), Expect = 4e-29,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 62/123 (50%), Gaps = 1/123 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +  P  S+R LRVGE +R AL  V+   +  D  ++R  +++ EV  S DL++AT Y+  
Sbjct: 10  HTGPGPSQRQLRVGETIRRALSDVLARGDVHDTDLNRLSVTVGEVRASPDLKIATAYVLP 69

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 D VI+ L  N   +R  + + L  L++ P+LRF+ D +     +   ++   ++
Sbjct: 70  LGGQGKDEVIALLARNKGELRRLVAKKL-TLKFAPDLRFQLDETFDRMDETREMLNRAEV 128

Query: 123 PVA 125
              
Sbjct: 129 KRD 131


>gi|149912793|ref|ZP_01901327.1| ribosome-binding factor A [Roseobacter sp. AzwK-3b]
 gi|149813199|gb|EDM73025.1| ribosome-binding factor A [Roseobacter sp. AzwK-3b]
          Length = 134

 Score =  130 bits (328), Expect = 6e-29,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 66/125 (52%), Gaps = 1/125 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +     S+R LRVGE VR  L  +++  +  D  ++R  +++ EV +S DLR+AT Y+  
Sbjct: 10  HDGQGPSQRQLRVGELVRRTLSDLLMRGDVHDPELNRMSVTVGEVRVSPDLRIATAYVLP 69

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 ++VI  L  N   +R  IG+ L +L+YVP+LRFR D +     +   +    K+
Sbjct: 70  LGGDGQEQVIDLLARNRGELRRLIGKKL-DLKYVPDLRFRIDETFDRMDETRRMFADEKV 128

Query: 123 PVALE 127
              +E
Sbjct: 129 RRDVE 133


>gi|296534730|ref|ZP_06897109.1| ribosome-binding factor A [Roseomonas cervicalis ATCC 49957]
 gi|296264943|gb|EFH11189.1| ribosome-binding factor A [Roseomonas cervicalis ATCC 49957]
          Length = 144

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 68/129 (52%), Gaps = 4/129 (3%)

Query: 1   MKNKNPK---NSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVAT 57
           M  K       S+R LRV EEVR AL  V +  EF D  +S   I+++EV  S DL+  T
Sbjct: 1   MAKKTAAAGAPSQRMLRVAEEVRHALSAVFMRGEFHDPDLSGRHITVTEVRASPDLKHMT 60

Query: 58  VYISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
            ++S          +  L     F+R ++ R++R L++ PE+ F+ DT+L    K++A+M
Sbjct: 61  CFVSALGRPVTKEELQGLRRVQPFLRTQVARAVR-LKFAPEMHFQPDTALDYAMKIDAVM 119

Query: 118 CLPKIPVAL 126
             P++   L
Sbjct: 120 RRPEVQQDL 128


>gi|90420530|ref|ZP_01228437.1| ribosome-binding factor A [Aurantimonas manganoxydans SI85-9A1]
 gi|90335258|gb|EAS49011.1| ribosome-binding factor A [Aurantimonas manganoxydans SI85-9A1]
          Length = 137

 Score =  130 bits (327), Expect = 7e-29,   Method: Composition-based stats.
 Identities = 45/123 (36%), Positives = 78/123 (63%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +  +   S+R L VGE+VR AL  V+   E  D ++ + ++ ++EV MS DL++AT Y++
Sbjct: 3   RTSSSGPSQRQLSVGEKVRHALTEVMQRGEINDPMLEKALVLVTEVRMSSDLKLATAYVT 62

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           +         + ALN N +FIRGR+  +LR ++Y+PE+RFR DTS  ++ +++AL+  P+
Sbjct: 63  ILGQTETKPFVDALNRNARFIRGRLTPALRQMKYMPEVRFRTDTSFDNFARIDALLKSPE 122

Query: 122 IPV 124
           +  
Sbjct: 123 VAR 125


>gi|260574496|ref|ZP_05842500.1| ribosome-binding factor A [Rhodobacter sp. SW2]
 gi|259023392|gb|EEW26684.1| ribosome-binding factor A [Rhodobacter sp. SW2]
          Length = 138

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 1/124 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
             +   S+R LRVGE +R  L  ++   E  D  ++R  I++ EV +S DL++AT Y+  
Sbjct: 5   RSSSGPSQRQLRVGELIRRTLSDLLNRGEIHDPELNRMSITVGEVRLSNDLKIATAYVMP 64

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                    I+AL  N   +R RIG+ +  L++ P+LRF  D +     +   L     +
Sbjct: 65  LGGGDVAAAIAALKRNKYDLRHRIGQQM-TLKHTPDLRFLPDETFDRIEETRRLFANEVV 123

Query: 123 PVAL 126
              +
Sbjct: 124 QRDI 127


>gi|319403628|emb|CBI77213.1| Ribosome-binding factor A [Bartonella rochalimae ATCC BAA-1498]
          Length = 138

 Score =  130 bits (327), Expect = 8e-29,   Method: Composition-based stats.
 Identities = 52/126 (41%), Positives = 76/126 (60%), Gaps = 3/126 (2%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           KN   S+R LRVGE+VR A+  ++      D      VIS+SEV MS DL++AT ++S  
Sbjct: 3   KNIHPSQRQLRVGEQVRHAIAHILQRGVLLDDTFKNIVISVSEVRMSSDLKIATCFVSFL 62

Query: 64  LDVS---PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             V     D ++SALN N +FIRG I   LR ++Y+P LRFR+D S  ++ K++ L+  P
Sbjct: 63  NTVDQTSHDAIVSALNKNSRFIRGAISHQLRQMKYMPALRFRFDNSFDNFAKIDTLLRSP 122

Query: 121 KIPVAL 126
           ++   L
Sbjct: 123 EVARDL 128


>gi|49473869|ref|YP_031911.1| ribosome-binding factor A [Bartonella quintana str. Toulouse]
 gi|61215005|sp|Q6G0P3|RBFA_BARQU RecName: Full=Ribosome-binding factor A
 gi|49239372|emb|CAF25705.1| Ribosomal-binding factor A [Bartonella quintana str. Toulouse]
          Length = 135

 Score =  129 bits (326), Expect = 9e-29,   Method: Composition-based stats.
 Identities = 54/129 (41%), Positives = 82/129 (63%), Gaps = 5/129 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MKN     S+R LRVGE+VR A+ + +      D L+   VIS++EV MS DL++AT ++
Sbjct: 1   MKNA--GPSQRQLRVGEQVRHAVAYKLQQGILLDDLLKNIVISVAEVRMSPDLKIATCFV 58

Query: 61  S---LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
           S      +VSP  V++ LN + +FIR  I  SLR ++Y+PELRFR DTS  ++ K+++L+
Sbjct: 59  SSLSTLHNVSPTDVVNVLNKHSRFIRREISYSLRQMKYMPELRFRLDTSFDNFSKIDSLL 118

Query: 118 CLPKIPVAL 126
             P++   L
Sbjct: 119 RSPEVARDL 127


>gi|154254060|ref|YP_001414884.1| ribosome-binding factor A [Parvibaculum lavamentivorans DS-1]
 gi|171769695|sp|A7HZ94|RBFA_PARL1 RecName: Full=Ribosome-binding factor A
 gi|154158010|gb|ABS65227.1| ribosome-binding factor A [Parvibaculum lavamentivorans DS-1]
          Length = 140

 Score =  129 bits (326), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
                  S+R LR GE +R AL  V+     QD  +     S++EV +S DLR AT +++
Sbjct: 10  HRATRGPSQRQLRAGELIRRALSDVVTRGTIQDPDLIERSFSVTEVRVSPDLRHATCFVA 69

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                    + +AL     ++RG++ + +   +Y+P+L F  DTS     +++ L+  PK
Sbjct: 70  PLGKGDAAALAAALTRVRGYLRGQLSKEV-TFKYMPDLTFEPDTSFDKAEQIDRLLHSPK 128

Query: 122 IPVAL 126
           +   L
Sbjct: 129 VSQDL 133


>gi|89067209|ref|ZP_01154722.1| ribosome-binding factor A [Oceanicola granulosus HTCC2516]
 gi|89046778|gb|EAR52832.1| ribosome-binding factor A [Oceanicola granulosus HTCC2516]
          Length = 143

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 61/124 (49%), Gaps = 1/124 (0%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           +    S+R LRVGE +R  L  V+   +  D  ++   I++SEV  + DL++AT Y+   
Sbjct: 11  EGRGPSQRQLRVGELIRRTLSDVLARGDVHDPDLTGMSITVSEVQTTPDLKIATAYVLPL 70

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                +  + AL  N   +R  + ++L  L++ P+LRFR D +         +   P++ 
Sbjct: 71  GGRDVEVALKALARNKGELRRAVSKNL-TLKFAPDLRFRVDETFDRIDDTRRMFNEPRVR 129

Query: 124 VALE 127
             +E
Sbjct: 130 QDIE 133


>gi|254510483|ref|ZP_05122550.1| ribosome-binding factor A [Rhodobacteraceae bacterium KLH11]
 gi|221534194|gb|EEE37182.1| ribosome-binding factor A [Rhodobacteraceae bacterium KLH11]
          Length = 131

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 61/126 (48%), Gaps = 1/126 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +  P  S+R LRVGE +R  L  V+   +  D  ++R  I++ EV  S DL++AT Y+  
Sbjct: 7   HDGPGPSQRQLRVGELIRRTLSEVLARGDVHDPDLNRMSITVGEVRTSPDLKIATAYVLP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 + VI  L  N   +R  +G+ +  L++ P+LRFR D +         +     +
Sbjct: 67  LGGKGQEDVIELLARNKGELRRMVGKKV-GLKFSPDLRFRLDDTFDRLDDTRRMFQQDAV 125

Query: 123 PVALEK 128
              L++
Sbjct: 126 RRDLDE 131


>gi|332559581|ref|ZP_08413903.1| ribosome-binding factor A [Rhodobacter sphaeroides WS8N]
 gi|332277293|gb|EGJ22608.1| ribosome-binding factor A [Rhodobacter sphaeroides WS8N]
          Length = 140

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 1/124 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +     S+R LRVGE +R  L  V+   E  D  ++R  I++ EV  S DL+VATV++  
Sbjct: 9   HTGTGPSQRQLRVGELIRRTLADVLNRGEIHDPELNRLSITVGEVRCSPDLKVATVHVMP 68

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 +  I+ L+ +   +R  I R +  L+Y P+LRFR D +     +   L     +
Sbjct: 69  LGGKDVEEAIALLSKHRGELRHHITRQM-TLKYAPDLRFRPDETFDRLDETRRLFSDETV 127

Query: 123 PVAL 126
              +
Sbjct: 128 MRDI 131


>gi|172046045|sp|A4WWP6|RBFA_RHOS5 RecName: Full=Ribosome-binding factor A
          Length = 140

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 1/124 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +     S+R LRVGE +R  L  V+   E  D  ++R  I++ EV  S DL+VATV++  
Sbjct: 9   HTGTGPSQRQLRVGELIRRTLADVLNRGEIHDPDLNRMSITVGEVRCSPDLKVATVHVMP 68

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 +  I+ L+ +   +R  I R +  L+Y P+LRFR D +     +   L     +
Sbjct: 69  LGGKDVEEAIALLSKHRGELRHHITRQM-TLKYAPDLRFRPDETFDRLDETRRLFSDETV 127

Query: 123 PVAL 126
              +
Sbjct: 128 QRDI 131


>gi|85703968|ref|ZP_01035071.1| ribosome-binding factor A [Roseovarius sp. 217]
 gi|85671288|gb|EAQ26146.1| ribosome-binding factor A [Roseovarius sp. 217]
          Length = 131

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 1/125 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +  P  S+R LRVGE +R  L  V++  +  D  ++R  +++ EV  S DL++AT Y+  
Sbjct: 7   HDGPGPSQRQLRVGELIRRTLSEVLMRGDIHDPDLNRISVTVGEVRTSSDLKIATAYVMP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 D +I+ L  N   +R  IG+ +  L+Y P+LRFR D +     +   L     +
Sbjct: 67  LGGEGQDDLIALLARNKHELRRMIGKKV-GLKYAPDLRFRLDETFDQIDETRRLFDQDTV 125

Query: 123 PVALE 127
              +E
Sbjct: 126 RRDVE 130


>gi|83950711|ref|ZP_00959444.1| ribosome-binding factor A [Roseovarius nubinhibens ISM]
 gi|83838610|gb|EAP77906.1| ribosome-binding factor A [Roseovarius nubinhibens ISM]
          Length = 131

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 40/125 (32%), Positives = 62/125 (49%), Gaps = 1/125 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +  P  S+R LRVGE +R  L  V++  +  D  ++R  +++ EV  S DL++AT Y+  
Sbjct: 7   HDGPGPSQRQLRVGELIRRTLSEVLMRGDIHDPELNRMSVTVGEVRTSPDLKIATAYVLP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 D ++  L  N   +R  IGR L  L+Y PELRFR D +     +   L     +
Sbjct: 67  LGGKGQDVIVGLLARNQSELRRIIGRKL-GLKYAPELRFRLDQTFDQMDETRRLFDQDDV 125

Query: 123 PVALE 127
              +E
Sbjct: 126 RRDVE 130


>gi|254477757|ref|ZP_05091143.1| ribosome-binding factor A [Ruegeria sp. R11]
 gi|214032000|gb|EEB72835.1| ribosome-binding factor A [Ruegeria sp. R11]
          Length = 131

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 60/123 (48%), Gaps = 1/123 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           N+    S+R LRVGE +R AL  +    +  D  ++R  I++ EV ++ DLR+AT Y+  
Sbjct: 7   NEGAGPSQRQLRVGELIRRALSEIFTRGDIHDPDLNRMSITVGEVRVTSDLRIATAYVLP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 D ++  +  N   +R  IG+ L  L++ PELRF+ D +         ++    +
Sbjct: 67  LGGKGQDEILKLMARNKGELRRMIGKKL-GLKFTPELRFQLDETFDRMDDTRRILSQDAV 125

Query: 123 PVA 125
              
Sbjct: 126 RRD 128


>gi|89056527|ref|YP_511978.1| ribosome-binding factor A [Jannaschia sp. CCS1]
 gi|123285867|sp|Q28K09|RBFA_JANSC RecName: Full=Ribosome-binding factor A
 gi|88866076|gb|ABD56953.1| ribosome-binding factor A [Jannaschia sp. CCS1]
          Length = 143

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 42/128 (32%), Positives = 67/128 (52%), Gaps = 2/128 (1%)

Query: 2   KNKN-PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           KN+N P  S+R LRVGE +R  L  V+   +  D  ++   I+++EV  S DL++ATVY+
Sbjct: 5   KNQNGPSKSQRQLRVGELIRRTLSTVLARADVHDPALNAMSITVAEVRTSSDLKIATVYV 64

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                   D  I AL  N   +R  +G+ L+ L+Y+P+LRF  D +         ++   
Sbjct: 65  MPLGGSGKDEAIEALKRNKGELRRLLGKDLK-LKYLPDLRFVIDQTFDQMDATREMLARA 123

Query: 121 KIPVALEK 128
            +   +EK
Sbjct: 124 DVRRDVEK 131


>gi|254780786|ref|YP_003065199.1| ribosome-binding factor A [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040463|gb|ACT57259.1| ribosome-binding factor A [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 128

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 128/128 (100%), Positives = 128/128 (100%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI
Sbjct: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP
Sbjct: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120

Query: 121 KIPVALEK 128
           KIPVALEK
Sbjct: 121 KIPVALEK 128


>gi|323136841|ref|ZP_08071922.1| ribosome-binding factor A [Methylocystis sp. ATCC 49242]
 gi|322398158|gb|EFY00679.1| ribosome-binding factor A [Methylocystis sp. ATCC 49242]
          Length = 142

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 70/119 (58%), Gaps = 1/119 (0%)

Query: 8   NSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS 67
            S+R LRV E VR A   ++   E  D ++ + V+++S V MS DL++AT+Y+       
Sbjct: 12  PSQRMLRVAELVRHAFAQLLSRGEISDPVLEKHVVTVSRVKMSPDLKLATIYVMPLGGKD 71

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
              VISAL+ + +F+RG I   + NL++ PE+RFR D S  +  +++A++   ++   L
Sbjct: 72  EPEVISALDRHKRFLRGEIAHEV-NLKFAPEIRFRIDDSFDAVSRIDAILNSERVKRDL 129


>gi|159045581|ref|YP_001534375.1| ribosome-binding factor A [Dinoroseobacter shibae DFL 12]
 gi|189039539|sp|A8LL25|RBFA_DINSH RecName: Full=Ribosome-binding factor A
 gi|157913341|gb|ABV94774.1| ribosome-binding factor A [Dinoroseobacter shibae DFL 12]
          Length = 135

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 37/125 (29%), Positives = 59/125 (47%), Gaps = 1/125 (0%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
                S+R LRVGE +R  L  V+   +  D  ++R  I++ EV  S DL+VAT Y+   
Sbjct: 8   TGSGPSQRQLRVGELIRRTLSSVLNQGDIHDPDLNRMSITVGEVRTSPDLKVATAYVLPL 67

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                   + AL  N   +R  + + L  L++ PELRF+ D +     +   L+    + 
Sbjct: 68  GGHGAQDALDALRRNRHELRRAVSKEL-TLKFSPELRFQIDETFDRMDETRRLLSQDHVR 126

Query: 124 VALEK 128
             L+K
Sbjct: 127 QDLDK 131


>gi|149203493|ref|ZP_01880463.1| ribosome-binding factor A [Roseovarius sp. TM1035]
 gi|149143326|gb|EDM31365.1| ribosome-binding factor A [Roseovarius sp. TM1035]
          Length = 134

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 38/125 (30%), Positives = 63/125 (50%), Gaps = 1/125 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +  P  S+R LRVGE +R  L  V++  +  D  ++R  +++ EV  S DL++AT Y+  
Sbjct: 10  HDGPGPSQRQLRVGELIRRTLSEVLMRGDIHDPDLNRISVTVGEVRTSSDLKIATAYVMP 69

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 D +I+ L  N   +R  IG+ +  L+Y P+LRFR D +     +   L     +
Sbjct: 70  LGGEGQDDLIALLARNKNELRRMIGKKV-GLKYAPDLRFRLDETFDQMDETRRLFDQDTV 128

Query: 123 PVALE 127
              +E
Sbjct: 129 RRDVE 133


>gi|163739812|ref|ZP_02147219.1| ribosome-binding factor A [Phaeobacter gallaeciensis BS107]
 gi|163744093|ref|ZP_02151459.1| ribosome-binding factor A [Phaeobacter gallaeciensis 2.10]
 gi|161382640|gb|EDQ07043.1| ribosome-binding factor A [Phaeobacter gallaeciensis 2.10]
 gi|161386846|gb|EDQ11208.1| ribosome-binding factor A [Phaeobacter gallaeciensis BS107]
          Length = 131

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 59/124 (47%), Gaps = 1/124 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           ++    S+R LRVGE +R AL  +    +  D  ++R  I++ EV  S DLR+AT Y+  
Sbjct: 7   HEGSGPSQRQLRVGELIRRALSEIFARGDLHDPDLNRLSITVGEVRTSPDLRIATAYVLP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 +  +  +  N   +R  IG+ L  L++ PELRF+ D +         ++    +
Sbjct: 67  LGGKGQEDTLKLMARNKGELRRMIGKKL-ALKFTPELRFQLDDTFDRMDDTRRMLSQDAV 125

Query: 123 PVAL 126
              +
Sbjct: 126 RRDI 129


>gi|319405098|emb|CBI78702.1| Ribosome-binding factor A [Bartonella sp. AR 15-3]
          Length = 138

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 53/126 (42%), Positives = 78/126 (61%), Gaps = 3/126 (2%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           KN  +S+R LRVGE+VR A+  ++      D      VIS+SEV MS DL+VAT ++S  
Sbjct: 3   KNISSSQRQLRVGEQVRHAIAHILQRGILLDDTFKNIVISVSEVRMSSDLKVATCFVSFL 62

Query: 64  LDVS---PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             V     D +++ALN N +FIRG I   LR ++Y+P LRFR+D S  ++ K++AL+  P
Sbjct: 63  NTVDKASHDTIVNALNKNSRFIRGAISHQLRQMKYMPTLRFRFDNSFDNFAKIDALLRSP 122

Query: 121 KIPVAL 126
           ++   L
Sbjct: 123 EVARDL 128


>gi|77464688|ref|YP_354192.1| ribosome-binding factor A [Rhodobacter sphaeroides 2.4.1]
 gi|123590863|sp|Q3IYU3|RBFA_RHOS4 RecName: Full=Ribosome-binding factor A
 gi|77389106|gb|ABA80291.1| ribosome-binding factor A [Rhodobacter sphaeroides 2.4.1]
          Length = 140

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 60/124 (48%), Gaps = 1/124 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +     S+R LRVGE +R  L  V+   E  D  ++R  I++ EV  S DL+VATV++  
Sbjct: 9   HTGTGPSQRQLRVGELIRRTLADVLNRGEIHDPELNRLSITVGEVRCSPDLKVATVHVMP 68

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 +  IS L+ +   +R  I R +  L+Y P+LRFR D +     +   L     +
Sbjct: 69  LGGKDVEEAISLLSKHRGELRHHITRQM-TLKYAPDLRFRPDETFDRLDETRRLFSDKTV 127

Query: 123 PVAL 126
              +
Sbjct: 128 MRDI 131


>gi|221640602|ref|YP_002526864.1| ribosome-binding factor A [Rhodobacter sphaeroides KD131]
 gi|254789761|sp|B9KP41|RBFA_RHOSK RecName: Full=Ribosome-binding factor A
 gi|221161383|gb|ACM02363.1| Ribosome-binding factor A [Rhodobacter sphaeroides KD131]
          Length = 137

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 1/124 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +     S+R LRVGE +R  L  V+   E  D  ++R  I++ EV  S DL+VATV++  
Sbjct: 6   HTGTGPSQRQLRVGELIRRTLADVLNRGEIHDPELNRLSITVGEVRCSPDLKVATVHVMP 65

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 +  I+ L+ +   +R  I R +  L+Y P+LRFR D +     +   L     +
Sbjct: 66  LGGKDVEEAIALLSKHRGELRHHITRQM-TLKYAPDLRFRPDETFDRLDETRRLFSDETV 124

Query: 123 PVAL 126
              +
Sbjct: 125 MRDI 128


>gi|319898336|ref|YP_004158429.1| Ribosome-binding factor A [Bartonella clarridgeiae 73]
 gi|319402300|emb|CBI75839.1| Ribosome-binding factor A [Bartonella clarridgeiae 73]
          Length = 136

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 49/126 (38%), Positives = 79/126 (62%), Gaps = 3/126 (2%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           KN   S+R LR+GE+VR A+  ++  +   D  +   +IS+SEV MS DL++AT ++S  
Sbjct: 3   KNIGPSQRQLRIGEQVRHAVAHILQRDVLLDDALRNIIISVSEVRMSSDLKIATCFVSPL 62

Query: 64  LDVS---PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             V     + +ISALN + +FIRG +   LR ++Y+P LRFR+D S  ++ K++AL+  P
Sbjct: 63  NTVDKTSHNAIISALNKHSRFIRGAVSHQLRQMKYMPILRFRFDNSFDNFAKIDALLRSP 122

Query: 121 KIPVAL 126
           ++   L
Sbjct: 123 EVARDL 128


>gi|126463528|ref|YP_001044642.1| ribosome-binding factor A [Rhodobacter sphaeroides ATCC 17029]
 gi|171855226|sp|A3PNF4|RBFA_RHOS1 RecName: Full=Ribosome-binding factor A
 gi|126105192|gb|ABN77870.1| ribosome-binding factor A [Rhodobacter sphaeroides ATCC 17029]
          Length = 137

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 1/124 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +     S+R LRVGE +R  L  V+   E  D  ++R  I++ EV  S DL+VATV++  
Sbjct: 6   HTGTGPSQRQLRVGELIRRTLADVLNRGEIHDPELNRLSITVGEVRCSPDLKVATVHVMP 65

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
               + +  I+ L+ +   +R  I R +  L+Y P+LRFR D +     +   L     +
Sbjct: 66  LGGKNVEEAIALLSKHRGELRHHITRQM-TLKYAPDLRFRPDETFDRLDETRRLFSDETV 124

Query: 123 PVAL 126
              +
Sbjct: 125 MRDI 128


>gi|58040016|ref|YP_191980.1| ribosome-binding factor A [Gluconobacter oxydans 621H]
 gi|62510968|sp|Q5FQM2|RBFA_GLUOX RecName: Full=Ribosome-binding factor A
 gi|58002430|gb|AAW61324.1| Ribosome-binding factor A [Gluconobacter oxydans 621H]
          Length = 142

 Score =  127 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 40/120 (33%), Positives = 66/120 (55%), Gaps = 1/120 (0%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S R LRV EEVR  L  +    EF+D  +    I+++EV +S D R AT +++     
Sbjct: 19  GPSTRQLRVAEEVRRVLAELFARTEFRDPELLDVRITVTEVRISPDFRHATAFVTRLGRS 78

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             + ++ AL     F+R  + ++L NLR VPE+ F+ DT+L +  +L+ +M  P++   L
Sbjct: 79  DVEVLLPALKRVAPFLRTGLSKAL-NLRTVPEIHFQPDTALDNAMELDEIMRSPEVQRDL 137


>gi|315497231|ref|YP_004086035.1| ribosome-binding factor a [Asticcacaulis excentricus CB 48]
 gi|315415243|gb|ADU11884.1| ribosome-binding factor A [Asticcacaulis excentricus CB 48]
          Length = 156

 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 67/134 (50%), Gaps = 10/134 (7%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K +    S+R LR GE VR AL+ ++   E  D  +    I+I+EV  S DLR ATV++ 
Sbjct: 12  KAEAQGPSQRQLRAGELVRHALVEILREEELHDEALQGVSITITEVRCSPDLRHATVFVE 71

Query: 62  LPL---------DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWK 112
                              I ALN + KF+RG +G  + ++++ P+LRF +D S     +
Sbjct: 72  PLGAGLGGVTISKDKIAPAIEALNRHAKFLRGILG-RMIDMKFTPDLRFLHDESFNEAAR 130

Query: 113 LNALMCLPKIPVAL 126
           ++AL   P +   L
Sbjct: 131 IDALFMRPDVARDL 144


>gi|294675833|ref|YP_003576448.1| ribosome-binding factor A [Rhodobacter capsulatus SB 1003]
 gi|294474653|gb|ADE84041.1| ribosome-binding factor A [Rhodobacter capsulatus SB 1003]
          Length = 144

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 64/124 (51%), Gaps = 5/124 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL---- 62
             S+R LRVGE +R  L  V+L  +  D  +++  I++ EV  S DL+VATVY++     
Sbjct: 11  GPSQRQLRVGELIRRTLSDVLLRGDVHDPDLNKISITVGEVRTSPDLKVATVYVAPLGGT 70

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
               S + +++AL  +   +R  + +++  L+Y P+LRFR D +     +   L     +
Sbjct: 71  LGGESAEAMLAALRRHSGELRHHVAKAM-TLKYAPDLRFRMDETFDRLDETRRLFSDETV 129

Query: 123 PVAL 126
              +
Sbjct: 130 QRDI 133


>gi|149185841|ref|ZP_01864156.1| ribosome-binding factor A [Erythrobacter sp. SD-21]
 gi|148830402|gb|EDL48838.1| ribosome-binding factor A [Erythrobacter sp. SD-21]
          Length = 133

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 61/120 (50%), Gaps = 1/120 (0%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S R L+VGE VR  L  ++   E  D ++    I+++EV M+ DLR A  Y+   L    
Sbjct: 13  SVRVLKVGERVRHILSELLARGEAHDDVLRAHNIAVTEVRMTPDLRNAKAYVKPLLGKDE 72

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             V+ AL  N  F +  + + L  L++ P+L F+ D S     ++  L+  P++   L++
Sbjct: 73  AEVLKALRTNTAFFQKEVAQRL-GLKFAPKLSFKPDESFDEAGRIERLLDDPRVARDLDE 131


>gi|296448275|ref|ZP_06890169.1| ribosome-binding factor A [Methylosinus trichosporium OB3b]
 gi|296254227|gb|EFH01360.1| ribosome-binding factor A [Methylosinus trichosporium OB3b]
          Length = 129

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 66/116 (56%), Gaps = 1/116 (0%)

Query: 12  ALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRV 71
            LRV E VR +L  ++   E  D ++   V+++S V MS DL++ATVY+        + V
Sbjct: 1   MLRVAELVRHSLAQMLSRGEIVDPVLETHVVTVSRVAMSPDLKLATVYVMPLGGKDGEEV 60

Query: 72  ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           + A   + KF+RG I   + NL++ PE+RFR D S  +  +++AL+   ++   LE
Sbjct: 61  VRAFERHKKFLRGEIAHHV-NLKFAPEVRFRIDDSFDNVARIDALLNSERVRRDLE 115


>gi|306842725|ref|ZP_07475368.1| ribosome-binding factor A [Brucella sp. BO2]
 gi|306287171|gb|EFM58673.1| ribosome-binding factor A [Brucella sp. BO2]
          Length = 131

 Score =  126 bits (316), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 52/112 (46%), Positives = 73/112 (65%)

Query: 15  VGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRVISA 74
           +GE+VR AL  V+   E +D LI R VIS+SEV MS DL++AT +I+      P  VI A
Sbjct: 1   MGEQVRHALAQVLQRGEIRDDLIERTVISVSEVRMSPDLKIATCFITPLGSADPQAVIKA 60

Query: 75  LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
           L  + KFIRGR+  SL  ++Y+PE RFR DTS  ++ K++AL+  P++   L
Sbjct: 61  LASHAKFIRGRVAPSLAQMKYMPEFRFRPDTSFDNFSKIDALLRSPEVARDL 112


>gi|148556716|ref|YP_001264298.1| ribosome-binding factor A [Sphingomonas wittichii RW1]
 gi|166219409|sp|A5VCZ4|RBFA_SPHWW RecName: Full=Ribosome-binding factor A
 gi|148501906|gb|ABQ70160.1| ribosome-binding factor A [Sphingomonas wittichii RW1]
          Length = 132

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 44/130 (33%), Positives = 70/130 (53%), Gaps = 3/130 (2%)

Query: 1   MKNKNPKN--SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATV 58
           M+        S R LRVGE+VR AL  +++  E  D +++  ++S++EV MS DLR ATV
Sbjct: 1   MRRNETPEGRSVRLLRVGEQVRHALSDILMRGEVHDDVLASHMVSVTEVRMSPDLRHATV 60

Query: 59  YISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           ++   L    D VI AL  N  F++  + R + N +Y  +L+F  D S      ++ L+ 
Sbjct: 61  FVKPLLGGDEDIVIKALRTNTAFLQSEVARRV-NTKYAAKLKFLADESFDEGSHIDRLLR 119

Query: 119 LPKIPVALEK 128
            P I   L++
Sbjct: 120 DPSIARDLDQ 129


>gi|254470702|ref|ZP_05084105.1| ribosome-binding factor A [Pseudovibrio sp. JE062]
 gi|211959844|gb|EEA95041.1| ribosome-binding factor A [Pseudovibrio sp. JE062]
          Length = 146

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 38/120 (31%), Positives = 61/120 (50%), Gaps = 1/120 (0%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           + S+R LRVGE VR  L  +++  +  D  +   +I++ EV MS DLR A V +      
Sbjct: 11  QPSQRQLRVGELVRKELSDILIRGQVSDPDLDGVIITVPEVRMSPDLRWADVLVMPMGGR 70

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             + V+ AL  N K++RG++ R +  ++Y  +LRF  DT       +  L+  P I    
Sbjct: 71  DVEVVLEALKRNAKYLRGQVARRV-TMKYTCDLRFVADTRFDDDDLITRLLHEPSIRKDF 129


>gi|85710525|ref|ZP_01041589.1| ribosome-binding factor A [Erythrobacter sp. NAP1]
 gi|85687703|gb|EAQ27708.1| ribosome-binding factor A [Erythrobacter sp. NAP1]
          Length = 142

 Score =  124 bits (313), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 68/127 (53%), Gaps = 5/127 (3%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP-- 63
            + S R L+VGE VR  L  ++   E  D ++S   I+++EV M+ DLR AT Y+     
Sbjct: 10  EQQSVRVLKVGERVRHILSELLARQEVHDEVVSASNIAVTEVRMTPDLRHATAYVKPLLA 69

Query: 64  --LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               +S   V+ AL  N  F++  + + L  L++ P+L+FR D S     ++ AL+  PK
Sbjct: 70  AGPKISDADVVHALRQNTAFLQREVAKRL-GLKFAPKLKFRSDESFAEADRIEALLRDPK 128

Query: 122 IPVALEK 128
           +   L++
Sbjct: 129 VARDLDE 135


>gi|126740777|ref|ZP_01756462.1| ribosome-binding factor A [Roseobacter sp. SK209-2-6]
 gi|126718073|gb|EBA14790.1| ribosome-binding factor A [Roseobacter sp. SK209-2-6]
          Length = 131

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 63/125 (50%), Gaps = 1/125 (0%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           +    S+R LRVGE +R  L  V++  +  D  ++R  I++ EV ++ DLR+AT Y+   
Sbjct: 8   EGRGPSQRQLRVGELIRRTLSEVLMRGDLHDPELNRMSITVGEVRVTPDLRIATAYVLPL 67

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                + ++  L  N   +R   G+ L  +++ P+LRF+ D +        A++    + 
Sbjct: 68  GGKGQEDLLKLLARNKGELRRIAGKKL-GMKFAPDLRFQLDLTYDQMDATRAMLEQDAVR 126

Query: 124 VALEK 128
             +EK
Sbjct: 127 RDIEK 131


>gi|310817250|ref|YP_003965214.1| ribosome-binding factor A [Ketogulonicigenium vulgare Y25]
 gi|308755985|gb|ADO43914.1| ribosome-binding factor A [Ketogulonicigenium vulgare Y25]
          Length = 145

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 40/118 (33%), Positives = 58/118 (49%), Gaps = 1/118 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LRVGE +R  L  V+   E  D  + R  I++ EV  S DL+VAT Y+     
Sbjct: 13  NGPSQRQLRVGELIRRTLSSVLQRGEVHDPELQRTSITVGEVRTSPDLKVATAYVLPLGG 72

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
            + D V++AL  N   IR  IG  +  L++VP+LRF  D +     +   L     + 
Sbjct: 73  GNADLVLAALRRNKSEIRHMIGHGM-TLKFVPDLRFEIDRTFDRMDETRRLFENDHVR 129


>gi|295687490|ref|YP_003591183.1| ribosome-binding factor A [Caulobacter segnis ATCC 21756]
 gi|295429393|gb|ADG08565.1| ribosome-binding factor A [Caulobacter segnis ATCC 21756]
          Length = 148

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/131 (31%), Positives = 68/131 (51%), Gaps = 5/131 (3%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K      S+R LR GE +R AL+ ++   E QD  +    +++SEV MS DL+ A  ++ 
Sbjct: 9   KGAATGPSQRQLRAGELIRHALVEILREEELQDEALHNISVTVSEVRMSPDLKHAVCFVE 68

Query: 62  LPLD----VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                        VI  LN   KF+RGR+GRS+ ++++ P+L+F +D S  +   ++ L 
Sbjct: 69  PLGAGLTGEDTTEVIKGLNRVSKFLRGRLGRSI-DMKFTPDLKFIHDESFGTAAYMDKLF 127

Query: 118 CLPKIPVALEK 128
             PK+     +
Sbjct: 128 LDPKVQQDTRR 138


>gi|171769483|sp|A1UU51|RBFA_BARBK RecName: Full=Ribosome-binding factor A
          Length = 134

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 51/121 (42%), Positives = 74/121 (61%), Gaps = 3/121 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  ++      D  +   V S+SEV MS DL++AT ++S    V  
Sbjct: 7   SQRQLRVGEQVRHALAHMLQRGILLDDALKDVVFSVSEVRMSPDLKIATCFVSFLNTVDD 66

Query: 69  ---DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                +I  LN + +FIRG I  SLR ++Y+PELRFR D S  ++ K++AL+ LP++   
Sbjct: 67  ISRATLIKVLNKHSRFIRGEISSSLRQMKYMPELRFRLDNSFDNFSKIDALLRLPEVARD 126

Query: 126 L 126
           L
Sbjct: 127 L 127


>gi|302381333|ref|YP_003817156.1| ribosome-binding factor A [Brevundimonas subvibrioides ATCC 15264]
 gi|302191961|gb|ADK99532.1| ribosome-binding factor A [Brevundimonas subvibrioides ATCC 15264]
          Length = 147

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 45/138 (32%), Positives = 76/138 (55%), Gaps = 14/138 (10%)

Query: 1   MKNKNPKN-----SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRV 55
           M NK  K+     S+R LR  E +R AL+ V+  NE +D  +    ++++EV +S DL+ 
Sbjct: 1   MANKKSKSTAGLVSQRQLRASEMIRHALVEVMRENEIRDPALIGVSVTVTEVRLSPDLKH 60

Query: 56  ATVYISLPL--------DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSL 107
           AT ++                D ++ ALN + KF+RG +GR + ++R+ P+LRFR+D S 
Sbjct: 61  ATCFVEPLGAGIETSDTAGHIDEIVKALNTHAKFLRGALGRHI-DMRFTPDLRFRHDESF 119

Query: 108 QSYWKLNALMCLPKIPVA 125
            +  +LN L+  P++   
Sbjct: 120 AAAERLNRLLDDPRVRAD 137


>gi|86139376|ref|ZP_01057945.1| ribosome-binding factor A [Roseobacter sp. MED193]
 gi|85823879|gb|EAQ44085.1| ribosome-binding factor A [Roseobacter sp. MED193]
          Length = 131

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 39/129 (30%), Positives = 64/129 (49%), Gaps = 4/129 (3%)

Query: 2   KNKNP---KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATV 58
           KNK+P     S+R LRVGE +R  L  V+   E  D  ++R  I++ EV ++ DLR+AT 
Sbjct: 3   KNKSPEGRAPSQRQLRVGELIRRTLSEVLSRGELHDPELNRMSITVGEVRVTPDLRIATA 62

Query: 59  YISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           Y+        D ++  L  N   +R   G+ L  ++Y P+LRF+ D +         ++ 
Sbjct: 63  YVLPLGGKGQDDLLKLLGRNKWELRTLAGKKL-GMKYTPDLRFQLDLTYDQMDATRRMLE 121

Query: 119 LPKIPVALE 127
              +   +E
Sbjct: 122 QDAVRRDIE 130


>gi|121601742|ref|YP_989504.1| ribosome-binding factor A [Bartonella bacilliformis KC583]
 gi|120613919|gb|ABM44520.1| ribosome-binding factor A [Bartonella bacilliformis KC583]
          Length = 148

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 51/121 (42%), Positives = 74/121 (61%), Gaps = 3/121 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE+VR AL  ++      D  +   V S+SEV MS DL++AT ++S    V  
Sbjct: 21  SQRQLRVGEQVRHALAHMLQRGILLDDALKDVVFSVSEVRMSPDLKIATCFVSFLNTVDD 80

Query: 69  ---DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                +I  LN + +FIRG I  SLR ++Y+PELRFR D S  ++ K++AL+ LP++   
Sbjct: 81  ISRATLIKVLNKHSRFIRGEISSSLRQMKYMPELRFRLDNSFDNFSKIDALLRLPEVARD 140

Query: 126 L 126
           L
Sbjct: 141 L 141


>gi|83855206|ref|ZP_00948736.1| ribosome-binding factor A [Sulfitobacter sp. NAS-14.1]
 gi|83941728|ref|ZP_00954190.1| ribosome-binding factor A [Sulfitobacter sp. EE-36]
 gi|83843049|gb|EAP82216.1| ribosome-binding factor A [Sulfitobacter sp. NAS-14.1]
 gi|83847548|gb|EAP85423.1| ribosome-binding factor A [Sulfitobacter sp. EE-36]
          Length = 142

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 61/125 (48%), Gaps = 1/125 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           ++    S+R LRVGE +R AL  V+   +  D  ++R  I++ EV  S DL++AT Y+  
Sbjct: 10  HEGSGPSQRQLRVGETIRRALSDVLARGDVHDPELNRMSITVGEVRASPDLKIATAYVLP 69

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 + V+  L  N   +R  + + L  L+Y P+LRF+ D +     +   ++    +
Sbjct: 70  LGGDGQEDVLKLLARNKGELRRLMAKKLV-LKYAPDLRFQLDETFDRMDETRRMLAQDVV 128

Query: 123 PVALE 127
               +
Sbjct: 129 RRDAD 133


>gi|117926999|ref|YP_867616.1| ribosome-binding factor A [Magnetococcus sp. MC-1]
 gi|171460788|sp|A0LE17|RBFA_MAGSM RecName: Full=Ribosome-binding factor A
 gi|117610755|gb|ABK46210.1| ribosome-binding factor A [Magnetococcus sp. MC-1]
          Length = 123

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 55/115 (47%), Gaps = 2/115 (1%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           + R  RVG  +R  +  ++   E +D  +    ++I EV +S DL  A VY ++  +   
Sbjct: 2   TIRTERVGNAIRKEVASMLTRGEIKDPRLGG-FVNIQEVRVSPDLSYAKVYYTVFGESDQ 60

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
             V  A      F+R  I + L+ LR+ PELRF  D       +++ L+   +IP
Sbjct: 61  AGVADAWQRASGFLRNVIAKRLK-LRHAPELRFELDHVADYSKRIDELLNGLEIP 114


>gi|254462052|ref|ZP_05075468.1| ribosome-binding factor A [Rhodobacterales bacterium HTCC2083]
 gi|206678641|gb|EDZ43128.1| ribosome-binding factor A [Rhodobacteraceae bacterium HTCC2083]
          Length = 142

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 63/132 (47%), Gaps = 5/132 (3%)

Query: 1   MKNKN----PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVA 56
           M  K+       S+R LRVGE +R  L  ++   +  D  ++R  ++I EV +S DLRVA
Sbjct: 3   MAKKSYSSGSGPSQRQLRVGELIRRGLSEILQRGDVHDADLNRLSVTIGEVRVSPDLRVA 62

Query: 57  TVYISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
           TVY         D VI  L  N   +R  I + L  L++ P++RFR D +     +   L
Sbjct: 63  TVYALPLGGEGKDDVIGLLAKNKGELRQLINKKL-ALKHSPDMRFRLDETFDKMDETRRL 121

Query: 117 MCLPKIPVALEK 128
                +   +E+
Sbjct: 122 FEQEHVRADIER 133


>gi|328545916|ref|YP_004306025.1| ribosome-binding factor A [polymorphum gilvum SL003B-26A1]
 gi|326415656|gb|ADZ72719.1| Ribosome-binding factor A [Polymorphum gilvum SL003B-26A1]
          Length = 117

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 63/114 (55%), Gaps = 1/114 (0%)

Query: 14  RVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRVIS 73
           RVGE VR  L  ++   +  D  +   +I++ EV M+ DLR+A+  +        +R++ 
Sbjct: 2   RVGELVRKELSDILTRGQLADPDLDGVIITVPEVRMTPDLRLASCLVMPLGGAHGERIVK 61

Query: 74  ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           ALN + K+IRG++ R L  L+Y+P+LRF  DT      ++  L+  P +   +E
Sbjct: 62  ALNRSAKYIRGQVSRRL-TLKYMPDLRFVLDTRFDDDDRIGHLLHSPDVQRDIE 114


>gi|84515137|ref|ZP_01002500.1| ribosome-binding factor A [Loktanella vestfoldensis SKA53]
 gi|84511296|gb|EAQ07750.1| ribosome-binding factor A [Loktanella vestfoldensis SKA53]
          Length = 134

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 63/127 (49%), Gaps = 1/127 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +      ++R LRVGE +R  L  ++   E  D  ++R  I++ EV MS DLR+AT +I 
Sbjct: 9   QRDGKAPTQRMLRVGEMIRRTLSEILQRGEVHDPDLARMSITVGEVRMSPDLRIATAFIL 68

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               +  +  + AL  N   +R  + +   ++++ PELRF+ D +        AL+    
Sbjct: 69  PLGGIGKEEALDALRRNRHEVRHLVVKG-GSMKFAPELRFQLDGTFDQMDATRALLAEDH 127

Query: 122 IPVALEK 128
           +   L++
Sbjct: 128 VRQDLDE 134


>gi|16124293|ref|NP_418857.1| ribosome-binding factor A [Caulobacter crescentus CB15]
 gi|221232975|ref|YP_002515411.1| ribosome-binding factor A [Caulobacter crescentus NA1000]
 gi|20978655|sp|Q9AC30|RBFA_CAUCR RecName: Full=Ribosome-binding factor A
 gi|254789739|sp|B8GWZ3|RBFA_CAUCN RecName: Full=Ribosome-binding factor A
 gi|13421129|gb|AAK22025.1| ribosome-binding factor A [Caulobacter crescentus CB15]
 gi|220962147|gb|ACL93503.1| ribosome-binding factor A [Caulobacter crescentus NA1000]
          Length = 149

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/131 (29%), Positives = 68/131 (51%), Gaps = 5/131 (3%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K      S+R LR GE +R AL+ ++   E QD  +    +++SEV MS DL+ A  ++ 
Sbjct: 9   KGALTGPSQRQLRAGELIRHALVEILREEELQDEALQNISVTVSEVRMSPDLKHAICFVE 68

Query: 62  LPLD----VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                        +I  LN   KF+RGR+GRS+ ++++ P+L+F +D S  +   ++ L 
Sbjct: 69  PLGAGLTGQDTTDIIKGLNRVSKFLRGRLGRSI-DMKFTPDLKFIHDESFGTAAYMDKLF 127

Query: 118 CLPKIPVALEK 128
             P++     +
Sbjct: 128 LDPRVQQDTRR 138


>gi|37523601|ref|NP_926978.1| ribosome binding facror A [Gloeobacter violaceus PCC 7421]
 gi|39931738|sp|Q7NE48|RBFA_GLOVI RecName: Full=Ribosome-binding factor A
 gi|35214606|dbj|BAC91973.1| ribosome binding facror A [Gloeobacter violaceus PCC 7421]
          Length = 129

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 61/119 (51%), Gaps = 2/119 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  RVGE ++  +  ++L  + +D  +   ++S+++V ++ DLR A +++S+    
Sbjct: 1   MKTHRPARVGELIKREVSDMLLRGQIKDPRVGAGLVSVTDVEVTGDLRQAKIFVSIFGTP 60

Query: 67  SPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
              +  + AL     F+R  IG  +R LRY PE+ F  D SL+   ++  L+   +   
Sbjct: 61  EAQKLTMMALAEVTGFVRQEIGHRIR-LRYTPEIAFVQDRSLERGARITRLIDEIRAEE 118


>gi|126727800|ref|ZP_01743630.1| ribosome-binding factor A [Rhodobacterales bacterium HTCC2150]
 gi|126702927|gb|EBA02030.1| ribosome-binding factor A [Rhodobacterales bacterium HTCC2150]
          Length = 144

 Score =  120 bits (301), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 1/127 (0%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K+     S+R LRVGE +R  L  V+   E  D  ++R  I++ EV  S DL++AT +I 
Sbjct: 6   KDSGQGPSQRQLRVGEVIRRTLAEVLQRGEIHDPDLNRMSITVGEVRASPDLKIATAFIL 65

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                  +  +  L  N   IR  I + ++ L++ PELRF  D +         ++    
Sbjct: 66  PLGGEGAEEALDLLRKNRHEIRRVISKKMK-LKHSPELRFLIDVTFDRIDDTRRMLAQEA 124

Query: 122 IPVALEK 128
           +    +K
Sbjct: 125 VTRDTQK 131


>gi|163796761|ref|ZP_02190719.1| ribosome-binding factor A [alpha proteobacterium BAL199]
 gi|159178015|gb|EDP62562.1| ribosome-binding factor A [alpha proteobacterium BAL199]
          Length = 130

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 62/114 (54%), Gaps = 1/114 (0%)

Query: 14  RVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRVIS 73
           RVGEE+R  L  ++      D  +    ++ISEV +S DLR ATV+I+         +++
Sbjct: 2   RVGEEIRRTLARILERGTLHDPALYHAPVTISEVTVSPDLRNATVWITRLGGGDATDLLA 61

Query: 74  ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           AL  N   + G + R ++ L+Y P L+F  D++  +  +++AL+  P +   +E
Sbjct: 62  ALKRNAGRLGGLLARDIK-LKYAPRLQFARDSAFDTSSRIDALLRNPVVRNDIE 114


>gi|255261891|ref|ZP_05341233.1| ribosome-binding factor A [Thalassiobium sp. R2A62]
 gi|255104226|gb|EET46900.1| ribosome-binding factor A [Thalassiobium sp. R2A62]
          Length = 136

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 1/125 (0%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           +    S R LRVGE +R  L   +   +  D  ++R  I++ EV ++ DL++AT ++   
Sbjct: 8   EGRAPSTRQLRVGELIRRTLSDALQRGDIHDPDLNRMSITVGEVRVTPDLQIATCFVLPL 67

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                D  I+AL  N   +R  +G+ +  L+  P+LRF  D +        A+    ++ 
Sbjct: 68  GGKGGDEAIAALKRNKYELRRLVGK-VTKLKMTPDLRFLIDKTYDQMDATAAMFADARVQ 126

Query: 124 VALEK 128
             L K
Sbjct: 127 ADLIK 131


>gi|297184032|gb|ADI20152.1| ribosome-binding factor a [uncultured alpha proteobacterium
           EB080_L06A09]
          Length = 135

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 63/121 (52%), Gaps = 1/121 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LRVGE +R A+  V+L  +  D  ++   I++ EV  + DL++A VY+     
Sbjct: 10  KGPSQRQLRVGEMLRRAVSDVLLRGDIHDTDLAHVSITVGEVRSTPDLKLALVYVLPLGG 69

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
            + + VI+ALN N   IR  + + L +L+Y P+L+F  D +     +   L+    +   
Sbjct: 70  QNAEIVINALNKNKYEIRRSVNK-LVSLKYSPDLKFVLDRTFDQLDETRRLLEQDVVKRD 128

Query: 126 L 126
           +
Sbjct: 129 V 129


>gi|289207911|ref|YP_003459977.1| ribosome-binding factor A [Thioalkalivibrio sp. K90mix]
 gi|288943542|gb|ADC71241.1| ribosome-binding factor A [Thioalkalivibrio sp. K90mix]
          Length = 147

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 61/117 (52%), Gaps = 5/117 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             ++  R+ RVG++++  L   ++  E +D  +   +I++++V +S DL  A V+ +   
Sbjct: 3   GNRDFHRSDRVGDQIQRELAE-LIRLEVKDPRVG--MITLADVEVSRDLAHAKVFFTQLG 59

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                      LN    F+R  +G+ +R LR VP+LRF YD + +   ++++L+   
Sbjct: 60  GEEKGREAQQGLNHAAGFLRRALGQRMR-LRSVPQLRFVYDDTPERGARMSSLIDQA 115


>gi|87200501|ref|YP_497758.1| ribosome-binding factor A [Novosphingobium aromaticivorans DSM
           12444]
 gi|123488757|sp|Q2G5E9|RBFA_NOVAD RecName: Full=Ribosome-binding factor A
 gi|87136182|gb|ABD26924.1| ribosome-binding factor A [Novosphingobium aromaticivorans DSM
           12444]
          Length = 135

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/129 (34%), Positives = 65/129 (50%), Gaps = 4/129 (3%)

Query: 1   MKNKNPKN---SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVAT 57
           M  +       S R L+VGE+VR  L  ++   E  D ++S   +S++EV MS DLR AT
Sbjct: 1   MAKQQTSPETRSVRLLKVGEQVRHILSELLARQEVHDDVLSAHTVSVTEVRMSPDLRHAT 60

Query: 58  VYISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
           V+I   L    D V+ AL  N  F +  + + LR L+Y   L+F  D S     K+  L+
Sbjct: 61  VFIKALLGEDEDLVLKALRTNTAFFQREVAQRLR-LKYAARLKFLADESFDVASKIETLL 119

Query: 118 CLPKIPVAL 126
             PK+   L
Sbjct: 120 ADPKVQRDL 128


>gi|95929625|ref|ZP_01312367.1| ribosome-binding factor A [Desulfuromonas acetoxidans DSM 684]
 gi|95134322|gb|EAT15979.1| ribosome-binding factor A [Desulfuromonas acetoxidans DSM 684]
          Length = 119

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 64/123 (52%), Gaps = 5/123 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             ++R  RV E++   +  ++L    +D  +    ++I+ V +S DLR A ++ ++  + 
Sbjct: 1   MATQRTYRVAEQIHKEISDIMLRG-LRDPRVG--FVTITSVDISSDLRHAKIFFTVMGEE 57

Query: 67  -SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              ++    L+  + F+R  +G+ ++ LR+VP+L F+YDTS+     +  L+    I   
Sbjct: 58  ADAEKTQQGLDSAVPFLRRELGKRMK-LRHVPDLVFKYDTSIAYGSHIEELLKEAGITHD 116

Query: 126 LEK 128
            ++
Sbjct: 117 DDE 119


>gi|218515711|ref|ZP_03512551.1| ribosome-binding factor A [Rhizobium etli 8C-3]
          Length = 116

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 72/110 (65%)

Query: 18  EVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRVISALNC 77
           +VR+A+  V+   E +D +I   VISISEV MS DL++AT Y++         VI ALN 
Sbjct: 1   QVRAAITQVLQRGEVRDDIIEATVISISEVRMSPDLKIATAYVTPLGVSDHSIVIEALNR 60

Query: 78  NIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           + KFIRGR+G  LR ++Y+PE+RFR DTS  +Y K++ L+  P++   L+
Sbjct: 61  HAKFIRGRLGPQLRQMKYMPEVRFRDDTSFDNYKKIDELLRSPEVSRDLD 110


>gi|114769583|ref|ZP_01447193.1| ribosome-binding factor A [alpha proteobacterium HTCC2255]
 gi|114549288|gb|EAU52170.1| ribosome-binding factor A [alpha proteobacterium HTCC2255]
 gi|297184255|gb|ADI20373.1| ribosome-binding factor a [uncultured alpha proteobacterium
           EB080_L27A02]
          Length = 135

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 63/122 (51%), Gaps = 1/122 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LRVGE +R A+  V+L  +  D  ++   +++ EV  + DL++A VY+     
Sbjct: 10  KGPSQRQLRVGEMLRRAVSDVLLRGDIHDADLAHVSVTVGEVRSTPDLKLAIVYVLPLGG 69

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
            + + VI ALN N   IR  + + L +L+Y P+L+F  D +     +   L+    +   
Sbjct: 70  ENANIVIDALNRNKYEIRRSVNK-LVSLKYSPDLKFVLDRTFDQLDETRRLLDQEIVKKD 128

Query: 126 LE 127
           +E
Sbjct: 129 VE 130


>gi|197117692|ref|YP_002138119.1| ribosome-binding factor A [Geobacter bemidjiensis Bem]
 gi|226723601|sp|B5EI59|RBFA_GEOBB RecName: Full=Ribosome-binding factor A
 gi|197087052|gb|ACH38323.1| ribosome-binding factor A [Geobacter bemidjiensis Bem]
          Length = 119

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 65/120 (54%), Gaps = 5/120 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSP 68
           +R+ +VGE++   +  +++    +D  I    ++I+ V M+ DLR ATVY ++   D   
Sbjct: 3   KRSDKVGEQIHKIISELLIKG-LKDPRIG--FLTITGVKMTPDLRQATVYFTVHGSDEDK 59

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
               + LN    +IR  IG++L+ +R+VPE+ F+YDTSL     + +++         E+
Sbjct: 60  KNSEAGLNSAKGYIRKEIGQALK-MRFVPEVLFKYDTSLDYGQHIESILKEIGATDDGEQ 118


>gi|71083095|ref|YP_265814.1| ribosome-binding factor A [Candidatus Pelagibacter ubique HTCC1062]
 gi|123647144|sp|Q4FNM8|RBFA_PELUB RecName: Full=Ribosome-binding factor A
 gi|71062208|gb|AAZ21211.1| Ribosome-binding factor A [Candidatus Pelagibacter ubique HTCC1062]
          Length = 122

 Score =  117 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 57/111 (51%), Gaps = 1/111 (0%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE +R +L  +   NE +   +  + I+++EV MS DL++A  Y+        
Sbjct: 10  SQRQLRVGEMIRQSLGMIFARNEAKVPNLETNTITVTEVKMSQDLKIAKAYVLPLGGKDS 69

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           + VI  L      IR  + + +  ++Y+P++ F  D S +   K+  L+  
Sbjct: 70  ELVIKKLKECSFLIRKALSKKII-MKYLPKILFAKDDSFEYAEKIENLIKQ 119


>gi|297183949|gb|ADI20070.1| hypothetical protein [uncultured alpha proteobacterium
           EB080_L11F12]
          Length = 135

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 62/122 (50%), Gaps = 1/122 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LRVGE +R A+  V+L  +  D  +    +++ EV  + DL++A VY+     
Sbjct: 10  KGPSQRQLRVGEMLRRAVSDVLLRGDIHDADLVHVSVTVGEVRSTPDLKLAIVYVLPLGG 69

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
            + + VI ALN N   IR  + + L +L+Y P+L+F  D +     +   L+    +   
Sbjct: 70  ENANIVIDALNRNKYEIRRSVNK-LVSLKYSPDLKFVLDRTFDQLDETRRLLDQEIVKKD 128

Query: 126 LE 127
           +E
Sbjct: 129 VE 130


>gi|326388035|ref|ZP_08209639.1| ribosome-binding factor A [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207536|gb|EGD58349.1| ribosome-binding factor A [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 133

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 39/119 (32%), Positives = 65/119 (54%), Gaps = 1/119 (0%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S R L+VGE+VR  L  ++   +  D ++S   +S++EV MS DLR A V++   L    
Sbjct: 12  SVRLLKVGEQVRHILSELLSRQQVHDDVLSAHTVSVTEVRMSPDLRHAAVFVKSLLGADE 71

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           + V+ AL  N  F +  +   L+ L+Y  ++RF  D S     +++AL+  P++   LE
Sbjct: 72  EIVLKALRTNTAFFQKEVAGRLK-LKYAAKIRFLPDESFDEANRIDALLADPRVLRDLE 129


>gi|253701578|ref|YP_003022767.1| ribosome-binding factor A [Geobacter sp. M21]
 gi|259552004|sp|C6E2P9|RBFA_GEOSM RecName: Full=Ribosome-binding factor A
 gi|251776428|gb|ACT19009.1| ribosome-binding factor A [Geobacter sp. M21]
          Length = 119

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 65/120 (54%), Gaps = 5/120 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSP 68
           +R+ +VGEE+   +  +++    +D  I    ++I+ V M+ DLR ATVY ++   D   
Sbjct: 3   KRSDKVGEEIHKIISELLIKG-LKDPRIG--FLTITGVKMTPDLRQATVYFTVHGSDEDK 59

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
               + LN    +IR  IG++L+ +R+VPE+ F+YDTSL     + +++         E+
Sbjct: 60  KNSEAGLNSAKGYIRKEIGQALK-MRFVPEVLFKYDTSLDYGQHIESILKEIGATDDGEQ 118


>gi|254455287|ref|ZP_05068716.1| ribosome-binding factor A [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082289|gb|EDZ59715.1| ribosome-binding factor A [Candidatus Pelagibacter sp. HTCC7211]
          Length = 122

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 1/111 (0%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE ++ +L  + + NE +   +  + I+++EV MS DL++A  Y+        
Sbjct: 10  SQRQLRVGEMIKQSLSMIFIRNEAKVPNLETNTITVTEVRMSQDLKIAKAYVLPLGGKDA 69

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           D VI  L      IR  + + +  ++++P+L FR D S +   K+  L+  
Sbjct: 70  DEVIKVLKEYSFLIRKILSQKVV-MKFLPKLLFRKDESFEYAEKIENLIKQ 119


>gi|91762478|ref|ZP_01264443.1| Ribosome-binding factor A [Candidatus Pelagibacter ubique HTCC1002]
 gi|91718280|gb|EAS84930.1| Ribosome-binding factor A [Candidatus Pelagibacter ubique HTCC1002]
          Length = 122

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 57/111 (51%), Gaps = 1/111 (0%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R LRVGE +R +L  +   NE +   +  + I+++EV MS DL++A  Y+        
Sbjct: 10  SQRQLRVGEMIRQSLGMIFARNEAKVPNLETNTITVTEVKMSQDLKIAKAYVLPLGGKDS 69

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           + VI  L      IR  + + +  ++Y+P++ F  D S +   K+  L+  
Sbjct: 70  ELVIKKLKEYSFLIRKALSKKII-MKYLPKILFAKDDSFEYAEKIENLIKQ 119


>gi|254454178|ref|ZP_05067615.1| ribosome-binding factor A [Octadecabacter antarcticus 238]
 gi|198268584|gb|EDY92854.1| ribosome-binding factor A [Octadecabacter antarcticus 238]
          Length = 142

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 1/120 (0%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R LRVGE +R  +  ++   E  D  + R  I++ EV M+ DL +AT ++      
Sbjct: 11  GPTTRQLRVGELIRRTMSELLQRGEVHDPDLQRMSITVGEVRMTPDLSIATCFVLPLGGK 70

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             D  I+AL  N   +R  I R ++ L+  P+LRFR D           +    ++   +
Sbjct: 71  DADVAIAALARNKGELRHLISRGMK-LKVTPDLRFRIDDMYDRMDATRVMFAEDRVAKDV 129


>gi|91774424|ref|YP_544180.1| ribosome-binding factor A [Methylobacillus flagellatus KT]
 gi|122399242|sp|Q1GXD5|RBFA_METFK RecName: Full=Ribosome-binding factor A
 gi|91708411|gb|ABE48339.1| ribosome-binding factor A [Methylobacillus flagellatus KT]
          Length = 125

 Score =  116 bits (292), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 5/116 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R+ RV E+++  L   +L  E +D  +S  +++++EV +S D+  A VY + P 
Sbjct: 1   MVKEFSRSDRVAEQIQRELAD-LLQFEVKDPRVSS-MVTVTEVEVSGDMSHAKVYYTAP- 57

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 +   L     F+R ++ R L  LR VP+L F YD S+    ++  L+   
Sbjct: 58  -QGTPELQKGLEKTAGFLRSQLARRLL-LRTVPQLHFVYDASIDRGMRIAKLIDEA 111


>gi|126736599|ref|ZP_01752339.1| ribosome-binding factor A [Roseobacter sp. CCS2]
 gi|126713912|gb|EBA10783.1| ribosome-binding factor A [Roseobacter sp. CCS2]
          Length = 131

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 57/125 (45%), Gaps = 1/125 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
                 ++R LRVGE +R  L  V+   +  D  ++R  I++ EV M+ DLR+AT ++  
Sbjct: 7   RDGKAPTQRMLRVGEVIRRTLSEVLQRGDVHDDELARMSITVGEVRMTSDLRIATAFVLP 66

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                    + AL  N   IR  + +    +++ PELRF  D +        AL+    +
Sbjct: 67  LGGHGKQEALEALRRNRHEIRHLVVKG-GTMKFAPELRFEIDGTFDQIDATRALLAEDHV 125

Query: 123 PVALE 127
              L+
Sbjct: 126 RQDLD 130


>gi|15614974|ref|NP_243277.1| ribosome-binding factor A [Bacillus halodurans C-125]
 gi|20139771|sp|Q9KA79|RBFA_BACHD RecName: Full=Ribosome-binding factor A
 gi|10175031|dbj|BAB06130.1| ribosome-binding factor A [Bacillus halodurans C-125]
          Length = 116

 Score =  116 bits (292), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 37/122 (30%), Positives = 63/122 (51%), Gaps = 7/122 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA RVGE+++  L  + +  E +D  I    ++++ V ++ DL+ A VYI++  D 
Sbjct: 1   MSNVRANRVGEQMKKELSDIFMR-ELKDPRIE--FVTVTGVDVTGDLQQANVYITVLGDD 57

Query: 67  SPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                  A L+    FIR  IG+ +R LR  PEL F +D S++   ++  L+    I   
Sbjct: 58  EQKEATLAGLSKAKGFIRSEIGKRIR-LRKTPELFFHFDESIEYGNRIEKLLQD--INRD 114

Query: 126 LE 127
            E
Sbjct: 115 GE 116


>gi|322418691|ref|YP_004197914.1| ribosome-binding factor A [Geobacter sp. M18]
 gi|320125078|gb|ADW12638.1| ribosome-binding factor A [Geobacter sp. M18]
          Length = 119

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 36/117 (30%), Positives = 63/117 (53%), Gaps = 5/117 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           +R+ +VGEE+   +  +++    +D  I    ++I+ V M+ DLR ATVY ++       
Sbjct: 3   KRSDKVGEEIHKIISELLIKG-LKDPRIG--FLTITGVKMTPDLRQATVYFTVHGSDEDK 59

Query: 70  RVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
           +   A LN    FIR  IG++L+ +R+VPE+ F+YDTSL     + +++        
Sbjct: 60  KASEAGLNSAKGFIRKEIGQALK-MRFVPEVLFKYDTSLDYGQHIESILKEIGATDD 115


>gi|254438397|ref|ZP_05051891.1| ribosome-binding factor A [Octadecabacter antarcticus 307]
 gi|198253843|gb|EDY78157.1| ribosome-binding factor A [Octadecabacter antarcticus 307]
          Length = 145

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 1/120 (0%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R LRVGE +R  +  ++   E  D  + R  I++ EV M+ DL +AT ++      
Sbjct: 14  GPTTRQLRVGELIRRTMSELLQRGEVHDPDLQRMSITVGEVRMTPDLSIATCFVLPLGGK 73

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             D  I+AL  N   +R  I R ++ L+  P+LRFR D           +    ++   +
Sbjct: 74  DADVAIAALARNKGELRHLISRGMK-LKVTPDLRFRIDDMYDRMDATRVMFAQDRVAKDV 132


>gi|296132889|ref|YP_003640136.1| ribosome-binding factor A [Thermincola sp. JR]
 gi|296031467|gb|ADG82235.1| ribosome-binding factor A [Thermincola potens JR]
          Length = 120

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 60/117 (51%), Gaps = 7/117 (5%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            RA RV E ++  +  ++   E +D  I    ++++ V +  DLR A +YIS+       
Sbjct: 4   HRASRVAEAIKKEVTQML-GGEIKDPRIG--FVTVTGVEVCPDLRHARIYISVYGSDEEK 60

Query: 70  -RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
            + + ALN    F+R  +G+ +R LRY PE+ FR+D S++   ++  L+    +   
Sbjct: 61  AQTLQALNKAKGFVRSELGKRIR-LRYTPEVEFRFDESIERGARIMELLNR--VQKD 114


>gi|146297074|ref|YP_001180845.1| ribosome-binding factor A [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|166218427|sp|A4XL69|RBFA_CALS8 RecName: Full=Ribosome-binding factor A
 gi|145410650|gb|ABP67654.1| ribosome-binding factor A [Caldicellulosiruptor saccharolyticus DSM
           8903]
          Length = 135

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 38/124 (30%), Positives = 64/124 (51%), Gaps = 4/124 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
               RA RV EE++  +  +I  +E +D  I  ++ISI +V MS DLR A V++S+    
Sbjct: 1   MQFERADRVAEEIKKEISDII-QHELKDPRICAELISIVKVNMSKDLRHAKVFVSIFDKN 59

Query: 67  SPD--RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             +    + AL     +IR  I R + NLR+ PE+ F  D S++   +++ ++    I  
Sbjct: 60  RENITSTMKALENAKPYIRREISRRI-NLRFSPEISFELDDSIEYGARISQILNQLNIAK 118

Query: 125 ALEK 128
             E+
Sbjct: 119 DEEE 122


>gi|114321096|ref|YP_742779.1| ribosome-binding factor A [Alkalilimnicola ehrlichii MLHE-1]
 gi|122311320|sp|Q0A798|RBFA_ALHEH RecName: Full=Ribosome-binding factor A
 gi|114227490|gb|ABI57289.1| ribosome-binding factor A [Alkalilimnicola ehrlichii MLHE-1]
          Length = 130

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 65/126 (51%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            P++  R  RVGE+++  L   ++ +E +D  +   ++++SEV +S DL  A V+++   
Sbjct: 1   MPRDFPRTRRVGEQIQRELAE-LIRDELRDPRLG--MVTVSEVTVSRDLAHAKVFVTALG 57

Query: 65  DVSPDR--VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
               D    +  L     ++R  +G+ LR +R VP L F++DT+     +L+ L+    +
Sbjct: 58  GSDEDNAKTVEVLTRAAGYLRKLLGQRLR-IRQVPALHFQHDTAFDRGDRLSRLI-DEAV 115

Query: 123 PVALEK 128
               ++
Sbjct: 116 EEDRQQ 121


>gi|220916338|ref|YP_002491642.1| ribosome-binding factor A [Anaeromyxobacter dehalogenans 2CP-1]
 gi|254789727|sp|B8JFY8|RBFA_ANAD2 RecName: Full=Ribosome-binding factor A
 gi|219954192|gb|ACL64576.1| ribosome-binding factor A [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 139

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-P 68
            R  RV EE R  L  ++     +D  I    ++++   MS DL+ ATVY+S+  D    
Sbjct: 5   NRPARVAEEFRHELSAILARG-LKDPRI-TGFVTVTGSKMSPDLKEATVYVSIHGDERVR 62

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
               + L     F++  + R+LR LR  P LRF YD S+    ++  L+   +  
Sbjct: 63  KDTFAGLQAAAGFLQREVSRALR-LRNTPHLRFVYDESVARGDRIERLLREARTQ 116


>gi|85373520|ref|YP_457582.1| ribosome-binding factor A [Erythrobacter litoralis HTCC2594]
 gi|84786603|gb|ABC62785.1| ribosome-binding factor A [Erythrobacter litoralis HTCC2594]
          Length = 112

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/108 (30%), Positives = 56/108 (51%), Gaps = 1/108 (0%)

Query: 19  VRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRVISALNCN 78
           +R  L  ++   E  D  +S   I+++EV M+ DLR AT Y+   L    D ++SAL  N
Sbjct: 1   MRHILSELLARQEVHDETVSAANIAVTEVRMTPDLRNATAYVKPLLGKEEDEIVSALRQN 60

Query: 79  IKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             +++  + + L  L++ P+L FR D S     ++  L+  PK+   L
Sbjct: 61  TAYLQKEVAKRL-GLKFAPKLMFRPDESFDEADRIEKLLRDPKVARDL 107


>gi|225181386|ref|ZP_03734830.1| ribosome-binding factor A [Dethiobacter alkaliphilus AHT 1]
 gi|225167967|gb|EEG76774.1| ribosome-binding factor A [Dethiobacter alkaliphilus AHT 1]
          Length = 122

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/112 (31%), Positives = 64/112 (57%), Gaps = 4/112 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           +RA RVGEE++  +  ++   E +D  +   +IS+++V ++ DLR A ++IS+       
Sbjct: 4   QRAHRVGEEIKREVSSIL-RTEIKDPRV-TGLISVTDVAVTRDLRHAKLFISMLGSEEEQ 61

Query: 70  R-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +  +SAL+  + FIR  IG+ +R LR+ PE+ F  D S+     +N ++   
Sbjct: 62  QETLSALSRAVGFIRSEIGKRIR-LRHTPEISFHLDKSIAYGAHINKILADL 112


>gi|119509684|ref|ZP_01628830.1| ribosome-binding factor A [Nodularia spumigena CCY9414]
 gi|119465703|gb|EAW46594.1| ribosome-binding factor A [Nodularia spumigena CCY9414]
          Length = 142

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 60/117 (51%), Gaps = 3/117 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           +RR  RV E ++  +  ++L+   +D  +   ++S++ V +S DL+ A VY+S+    S 
Sbjct: 4   NRRISRVAELIKREVSQMLLHG-IKDDRVGTGMVSVTYVDVSGDLQHAKVYVSIYGTESA 62

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               ++ L     F+R  +G  +R LR  PE+ F  D S++   K+ +L+   +   
Sbjct: 63  KSETMAGLKSATGFVRSELGSRVR-LRRTPEVIFIEDDSIEQGNKVLSLLNKLEDER 118


>gi|220934180|ref|YP_002513079.1| ribosome-binding factor A [Thioalkalivibrio sp. HL-EbGR7]
 gi|254789772|sp|B8GP03|RBFA_THISH RecName: Full=Ribosome-binding factor A
 gi|219995490|gb|ACL72092.1| ribosome-binding factor A [Thioalkalivibrio sp. HL-EbGR7]
          Length = 129

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 60/122 (49%), Gaps = 6/122 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            P++  R  RVG++++  L   ++  E +D  +   +++++ V +S DL  A V+ ++  
Sbjct: 1   MPRDFSRTERVGDQIQRELAE-LIRMELKDPRVG--MVTLAGVEVSRDLAHAKVWFTVLG 57

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                      L     F+R  +GR +R LR VP L F+YD + +   +L+AL+    + 
Sbjct: 58  SEQQIADTTEGLQRAAGFLRRELGRRMR-LRTVPHLHFQYDDTQEKGARLSALI-DKAVA 115

Query: 124 VA 125
             
Sbjct: 116 ED 117


>gi|224825866|ref|ZP_03698970.1| ribosome-binding factor A [Lutiella nitroferrum 2002]
 gi|224602090|gb|EEG08269.1| ribosome-binding factor A [Lutiella nitroferrum 2002]
          Length = 132

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 53/114 (46%), Gaps = 4/114 (3%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
            K   RA R+ E+++  L  ++     +D       I+I+ V ++ D   A +Y ++  D
Sbjct: 5   KKGFSRADRISEQIQRELAELLRKG-LKDPRAGW--ITITSVEVTRDYSHAKIYYTVMDD 61

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
            + +    AL     ++R  +GR+L  +   P+L F YD S++    +  L+  
Sbjct: 62  KTREVTQEALEHAAGYLRSELGRAL-QIFTTPQLHFVYDESIERGMHMTRLINQ 114


>gi|197121575|ref|YP_002133526.1| ribosome-binding factor A [Anaeromyxobacter sp. K]
 gi|238689882|sp|B4UHG2|RBFA_ANASK RecName: Full=Ribosome-binding factor A
 gi|196171424|gb|ACG72397.1| ribosome-binding factor A [Anaeromyxobacter sp. K]
          Length = 138

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-P 68
            R  RV EE R  L  ++     +D  I    ++++   MS DL+ ATVY+S+  D    
Sbjct: 5   NRPARVAEEFRHELSAILARG-LKDPRI-TGFVTVTGSKMSPDLKEATVYVSIHGDERVR 62

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
               + L     F++  + R+LR LR  P LRF YD S+    ++  L+   +  
Sbjct: 63  KDTFAGLQAAAGFLQREVSRALR-LRNTPHLRFVYDESVARGDRIERLLREARTQ 116


>gi|313199848|ref|YP_004038506.1| ribosome-binding factor a [Methylovorus sp. MP688]
 gi|312439164|gb|ADQ83270.1| ribosome-binding factor A [Methylovorus sp. MP688]
          Length = 123

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 58/116 (50%), Gaps = 6/116 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R+ RV E+++  L   +L  E +D  +   +++++EV +S DL  A V+ S   
Sbjct: 1   MAKEFSRSDRVAEQMQRELAD-LLQFEVKDPRVG--MVTVTEVEVSGDLAHAKVFYSA-- 55

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +     +   L     F+R ++ + L  LR VP+L F YD S+ +  K++ L+   
Sbjct: 56  EKGTPELQKGLEKTAGFLRSQLAKRLL-LRTVPQLHFVYDASIDNGMKISRLIDDA 110


>gi|34496918|ref|NP_901133.1| ribosome-binding factor A [Chromobacterium violaceum ATCC 12472]
 gi|39931751|sp|Q7NY12|RBFA_CHRVO RecName: Full=Ribosome-binding factor A
 gi|34330314|gb|AAQ59138.2| ribosome-binding factor A [Chromobacterium violaceum ATCC 12472]
          Length = 138

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 5/125 (4%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           K  K   R+ RV E+++  L   +     +D       I+I+ V ++ D   A VY ++ 
Sbjct: 3   KAKKGFSRSDRVAEQIQRELAE-LTRKGLKDPRAGW--ITITAVEVTRDYSHAKVYYTVM 59

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           +D + +    AL+ +  ++R  +GR+++ +  +P+L F YD S++    L +L+      
Sbjct: 60  VDSTREATQEALDSSAGYLRNELGRAIK-MFSMPQLHFVYDDSVERGMHLTSLINQVA-R 117

Query: 124 VALEK 128
              EK
Sbjct: 118 EDAEK 122


>gi|16331339|ref|NP_442067.1| ribosome-binding factor A [Synechocystis sp. PCC 6803]
 gi|3914560|sp|Q55625|RBFA_SYNY3 RecName: Full=Ribosome-binding factor A
 gi|1001511|dbj|BAA10137.1| sll0754 [Synechocystis sp. PCC 6803]
          Length = 133

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 62/123 (50%), Gaps = 6/123 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           SRR  RV   ++  +  ++L +E +D  +   ++S++EV +S DL+ A +++S+      
Sbjct: 4   SRRVSRVSSLIKREVSQMLL-HEIKDDRVGTGMVSVTEVEVSGDLQHAKIFVSIYGSPEA 62

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP---V 124
               ++ L+    F+R  +G+ +R LR  PE+ F  D SL+   K+  L+          
Sbjct: 63  KASTMAGLHSAAPFVRRELGQRMR-LRRTPEVSFLEDRSLERGDKILNLLNNLPQAIATE 121

Query: 125 ALE 127
            LE
Sbjct: 122 DLE 124


>gi|167644011|ref|YP_001681674.1| ribosome-binding factor A [Caulobacter sp. K31]
 gi|189039531|sp|B0T172|RBFA_CAUSK RecName: Full=Ribosome-binding factor A
 gi|167346441|gb|ABZ69176.1| ribosome-binding factor A [Caulobacter sp. K31]
          Length = 164

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 37/148 (25%), Positives = 71/148 (47%), Gaps = 22/148 (14%)

Query: 2   KNKNP-KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           K   P   S+R LR GE +R AL+ ++   +  D  ++   ++ISEV MS DL+ A  ++
Sbjct: 8   KKSGPVGPSQRQLRAGELIRHALVDILREEDLVDPALAGISVTISEVRMSADLKHAICFV 67

Query: 61  SLPL--------------------DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELR 100
                                     SP  V++ L    KF+RG++ +++ ++++ PEL+
Sbjct: 68  EPLGASIAPQVEREPSSPSRTVVVPGSPAEVVAGLTRLTKFLRGKLAKTI-DMKFTPELK 126

Query: 101 FRYDTSLQSYWKLNALMCLPKIPVALEK 128
           F +D +  S   ++ L   P++   + +
Sbjct: 127 FLHDETFNSATYMDRLFEDPRVQQDVRR 154


>gi|332653583|ref|ZP_08419328.1| ribosome-binding factor A [Ruminococcaceae bacterium D16]
 gi|332518729|gb|EGJ48332.1| ribosome-binding factor A [Ruminococcaceae bacterium D16]
          Length = 130

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 59/116 (50%), Gaps = 4/116 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S R  R+ EE++  L  +I     +D  +   +IS++ V  + DL+ A V+IS+    
Sbjct: 1   MASNRIGRINEEIQRELSSLIP--TVKDPRV-TGMISVTAVETTPDLKYAKVHISVLDKS 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
           +  +V+  L     ++R  +GR+L NLR  P+L F  D S+     + +++  P +
Sbjct: 58  NEAQVLKGLKSAGGYLRRELGRTL-NLRNTPQLSFVPDDSIDKGAHILSMLRDPNV 112


>gi|332981615|ref|YP_004463056.1| ribosome-binding factor A [Mahella australiensis 50-1 BON]
 gi|332699293|gb|AEE96234.1| ribosome-binding factor A [Mahella australiensis 50-1 BON]
          Length = 122

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
               R  R+ EE++  +  +I  NE +D  +   + S+++V ++ DL+ A VY+S+  D 
Sbjct: 1   MEFSRLARISEELKREISDII-RNELKDPRVP-MMTSVTKVEITNDLKYAKVYVSVLGDE 58

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                    LN    F+R  +G  +R LRY P++ F  DTS++    ++ L+   
Sbjct: 59  DTVKNAFDGLNSAAGFVRKEVGSRIR-LRYTPQIIFVRDTSIEYGAHISKLLHDI 112


>gi|167464644|ref|ZP_02329733.1| ribosome-binding factor A [Paenibacillus larvae subsp. larvae
           BRL-230010]
          Length = 118

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 64/111 (57%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R  RVGE+++  L  + + +E +D  I    ++I+ V ++ DL +A VY+S+   D   +
Sbjct: 5   RVGRVGEQIKKELSQI-VQSELKDPRIG--FLTITGVDVTNDLSLAKVYLSVLGSDEEKE 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             + AL     +IR  +G+ +R LR VPEL+F++DTS+    ++ +L+   
Sbjct: 62  ATLKALGVASGYIRSELGKRIR-LRKVPELQFKFDTSIDYGSRIESLLQDI 111


>gi|294500895|ref|YP_003564595.1| ribosome-binding factor A [Bacillus megaterium QM B1551]
 gi|295706241|ref|YP_003599316.1| ribosome-binding factor A [Bacillus megaterium DSM 319]
 gi|294350832|gb|ADE71161.1| ribosome-binding factor A [Bacillus megaterium QM B1551]
 gi|294803900|gb|ADF40966.1| ribosome-binding factor A [Bacillus megaterium DSM 319]
          Length = 121

 Score =  113 bits (284), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 34/118 (28%), Positives = 62/118 (52%), Gaps = 5/118 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           + RA RVGE+++  +  ++   + +D  I    +++++V +S DL+ A VYIS+  D   
Sbjct: 2   NIRATRVGEQMKKEMGEILNR-KIKDPRIG--FVTVTDVQVSGDLQQAKVYISVLGDAEQ 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
            +  +  L     FIR  IG+ +R LR  PE+ F +D S+    ++ +L+   K    
Sbjct: 59  RENTLKGLAKAKGFIRSEIGQRIR-LRKTPEITFEFDESIDYGNRIESLLHEIKKESD 115


>gi|163745464|ref|ZP_02152824.1| ribosome-binding factor A [Oceanibulbus indolifex HEL-45]
 gi|161382282|gb|EDQ06691.1| ribosome-binding factor A [Oceanibulbus indolifex HEL-45]
          Length = 146

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 61/122 (50%), Gaps = 1/122 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           ++    ++R LRVGE VR AL  V+   +  D  ++R  I++ EV MS DL++AT Y+  
Sbjct: 10  HEGSGPTQRQLRVGETVRRALSDVLARGDVHDTDLNRLSITVGEVRMSPDLKIATAYVLP 69

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 D V+  L  N   +R ++ + L  L++ P+LRF+ D +         +M    +
Sbjct: 70  LGGEGQDEVLKLLARNKNELRRQVAKKL-TLKFSPDLRFQLDRTFDQMDDTRRMMNQDVV 128

Query: 123 PV 124
             
Sbjct: 129 RR 130


>gi|253997784|ref|YP_003049847.1| ribosome-binding factor A [Methylovorus sp. SIP3-4]
 gi|253984463|gb|ACT49320.1| ribosome-binding factor A [Methylovorus sp. SIP3-4]
          Length = 123

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 58/116 (50%), Gaps = 6/116 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R+ R+ E+++  L   +L  E +D  +   +++++EV +S DL  A V+ S   
Sbjct: 1   MAKEFSRSDRIAEQMQRELAD-LLQFEVKDPRVG--MVTVTEVEVSGDLAHAKVFYSA-- 55

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +     +   L     F+R ++ + L  LR VP+L F YD S+ +  K++ L+   
Sbjct: 56  EKGTPELQKGLEKTAGFLRSQLAKRLL-LRTVPQLHFVYDASIDNGMKISRLIDDA 110


>gi|86157531|ref|YP_464316.1| ribosome-binding factor A [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123499936|sp|Q2IPZ5|RBFA_ANADE RecName: Full=Ribosome-binding factor A
 gi|85774042|gb|ABC80879.1| ribosome-binding factor A [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 138

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-P 68
            R  RV EE R  L  ++     +D  I    ++++   MS DL+ ATVY+S+  D    
Sbjct: 5   NRPARVAEEFRHELSALLARG-LKDPRI-TGFVTVTGSKMSPDLKEATVYVSIHGDERVR 62

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
               + L     F++  + R+LR LR  P LRF YD S+    ++  L+   +  
Sbjct: 63  KDTFAGLQAAAGFLQREVSRALR-LRNTPHLRFVYDESVARGDRIERLLREARTQ 116


>gi|217970110|ref|YP_002355344.1| ribosome-binding factor A [Thauera sp. MZ1T]
 gi|217507437|gb|ACK54448.1| ribosome-binding factor A [Thauera sp. MZ1T]
          Length = 141

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS-LP 63
            PK   R+ RV E++R  L   ++  E +D  +    I++++V ++ D   A V+ + + 
Sbjct: 1   MPKEYSRSQRVVEQIRRELAE-LIRLEVKDPRVG--FITLTDVEITPDYAHAKVFFTNMT 57

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
            +     ++  L     F+R  +GR +R +  +PEL F YD S++   +L+ L+    + 
Sbjct: 58  GEADVPEILQGLRRASGFLRRELGRRIR-IHTIPELHFHYDRSVEEGSRLSQLIDEV-VK 115

Query: 124 VALEK 128
               +
Sbjct: 116 EDEAR 120


>gi|298493008|ref|YP_003723185.1| ribosome-binding factor A ['Nostoc azollae' 0708]
 gi|298234926|gb|ADI66062.1| ribosome-binding factor A ['Nostoc azollae' 0708]
          Length = 132

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 63/120 (52%), Gaps = 3/120 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           +RR  RV E ++  +  ++LN   +D  +   ++S+++V +S DL+ A +++S+      
Sbjct: 4   NRRVSRVAELIKREVSQMLLNG-IKDDRVGTGMVSVTDVDVSGDLQHAKIFVSIYGTQEA 62

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
               ++ L     ++R  +G  +R LR  PE+ F  D SL+   K+ +L+   +   +LE
Sbjct: 63  KAETMAGLKSATGYVRSELGARVR-LRRTPEVIFVEDRSLERGTKVLSLLNQLQQERSLE 121


>gi|291616011|ref|YP_003518753.1| RbfA [Pantoea ananatis LMG 20103]
 gi|291151041|gb|ADD75625.1| RbfA [Pantoea ananatis LMG 20103]
 gi|327396262|dbj|BAK13684.1| ribosome-binding factor A RbfA [Pantoea ananatis AJ13355]
          Length = 140

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/128 (28%), Positives = 66/128 (51%), Gaps = 7/128 (5%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           K  K   R  RV +E++  +  ++   E +D  +   ++++S V +S DL  A V+++  
Sbjct: 5   KMAKEFGRPQRVSQELQKEIAMILQR-EIKDPRL-GMMVTVSGVEVSRDLAYAKVFVTFL 62

Query: 64  LDVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            D   + V +   AL     +IR  +G+++R LR VPEL F YD SL    +++ L+   
Sbjct: 63  NDKDEEAVQNGLKALKEASGYIRTLLGKAMR-LRIVPELTFFYDNSLIEGMRMSNLVTNV 121

Query: 121 KIPVALEK 128
            +   +E+
Sbjct: 122 -VKKDVER 128


>gi|218290089|ref|ZP_03494251.1| ribosome-binding factor A [Alicyclobacillus acidocaldarius LAA1]
 gi|218239798|gb|EED06987.1| ribosome-binding factor A [Alicyclobacillus acidocaldarius LAA1]
          Length = 118

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 5/116 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SP 68
            RA +V E+++  L  ++  +E +D  I    ++I+ V +S DL+ A VY+S+       
Sbjct: 4   IRAQKVAEQMKKELADIL-QHELKDPRIG--FVTITRVEVSGDLQHAKVYVSVYGPEVEK 60

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
           +  +  L     FIRG I R L ++R  PEL FR D S +   ++  ++   K   
Sbjct: 61  EATLGVLTKAAGFIRGEIARRL-HMRIAPELVFRLDESGEYSERIEQVLKSLKENE 115


>gi|220927911|ref|YP_002504820.1| ribosome-binding factor A [Clostridium cellulolyticum H10]
 gi|219998239|gb|ACL74840.1| ribosome-binding factor A [Clostridium cellulolyticum H10]
          Length = 117

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/112 (33%), Positives = 60/112 (53%), Gaps = 4/112 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           R +R+ EEV+  +  +I  N+ +D  +   ++SI    ++ DLR A VY+S+  +     
Sbjct: 4   RIVRISEEVKKEISNII-QNDIKDPRLPS-MVSIVSCSVTKDLRYAKVYVSVFGNDEQKK 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             ISAL     FIR  +G  +  LRY PE+ F  DTS++  + +N L+   K
Sbjct: 62  NAISALKSAAGFIRRELGHRV-QLRYTPEIHFELDTSIEHGFHINKLLDDAK 112


>gi|322382345|ref|ZP_08056252.1| ribosome-binding factor A-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321153698|gb|EFX46073.1| ribosome-binding factor A-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 113

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 63/108 (58%), Gaps = 5/108 (4%)

Query: 14  RVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPDRVI 72
           RVGE+++  L  + + +E +D  I    ++I+ V ++ DL +A VY+S+   D   +  +
Sbjct: 3   RVGEQIKKELSQI-VQSELKDPRIG--FLTITGVDVTNDLSLAKVYLSVLGSDEEKEATL 59

Query: 73  SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            AL     +IR  +G+ +R LR VPEL+F++DTS+    ++ +L+   
Sbjct: 60  KALGVASGYIRSELGKRIR-LRKVPELQFKFDTSIDYGSRIESLLQDI 106


>gi|261856062|ref|YP_003263345.1| ribosome-binding factor A [Halothiobacillus neapolitanus c2]
 gi|261836531|gb|ACX96298.1| ribosome-binding factor A [Halothiobacillus neapolitanus c2]
          Length = 139

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 61/122 (50%), Gaps = 4/122 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            P+   R  RV E++R  +   +L  E +   IS  ++++++  ++ DL  A ++ S+  
Sbjct: 1   MPQGFSRHQRVAEQIRREIAD-LLREEIRQAGIS--LLTVTDCEVTRDLGYAKIFYSVLN 57

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               +R  + L+    F+R  +   +R LR VP L F++D S++   +++AL+   +   
Sbjct: 58  SSERERAQAWLDSAAGFLRTELAHRMR-LRSVPRLTFQFDASIERGMQMDALISAVRKQD 116

Query: 125 AL 126
             
Sbjct: 117 DE 118


>gi|312134899|ref|YP_004002237.1| ribosome-binding factor a [Caldicellulosiruptor owensensis OL]
 gi|311774950|gb|ADQ04437.1| ribosome-binding factor A [Caldicellulosiruptor owensensis OL]
          Length = 133

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 63/121 (52%), Gaps = 4/121 (3%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
             R+ RV EE++  L  +I  +E +D  +  ++ISI +V MS DLR A VY+S+      
Sbjct: 4   FERSDRVSEEIKKELSDII-QHELKDPRLCAELISIVKVNMSKDLRHAKVYVSIFDKDKE 62

Query: 69  --DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             +  + AL     +IR  I R + +LR+ PE+ F  D S++   +++ ++    I    
Sbjct: 63  KVESTMKALENAKPYIRREISRRI-SLRFTPEITFELDDSIEYGARISQILNQLNISKED 121

Query: 127 E 127
           E
Sbjct: 122 E 122


>gi|262277757|ref|ZP_06055550.1| ribosome-binding factor A [alpha proteobacterium HIMB114]
 gi|262224860|gb|EEY75319.1| ribosome-binding factor A [alpha proteobacterium HIMB114]
          Length = 121

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/121 (24%), Positives = 52/121 (42%), Gaps = 1/121 (0%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MKN N   ++R L+ GE ++  L    +        I   +++I+EV +S DL+ A V+ 
Sbjct: 1   MKNNNQPFTQRQLKAGENLKKILARSFIQQNIILPEIDTKLVTITEVRVSPDLKHAKVFF 60

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                   D+ +  LN     I+    +     +++P L F  D S     K+  L+   
Sbjct: 61  MPLAGRDIDKFLKTLNEYSLEIKKSASKEWTA-KFMPNLNFVIDESFDYAEKIENLLLKD 119

Query: 121 K 121
           K
Sbjct: 120 K 120


>gi|261407935|ref|YP_003244176.1| ribosome-binding factor A [Paenibacillus sp. Y412MC10]
 gi|329929300|ref|ZP_08283053.1| ribosome-binding factor A [Paenibacillus sp. HGF5]
 gi|261284398|gb|ACX66369.1| ribosome-binding factor A [Paenibacillus sp. Y412MC10]
 gi|328936669|gb|EGG33112.1| ribosome-binding factor A [Paenibacillus sp. HGF5]
          Length = 117

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 5/109 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  RVGE+++  L   ++  E +D  I    I+++ V ++ DL  A VY+S+  D    
Sbjct: 4   IRTGRVGEQIKKELSQ-LIQTELKDPRIG--FITVTGVDVTNDLSQAKVYLSVLGDDEQK 60

Query: 70  RVI-SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                 L     F+R  +G+ +R LR+VPEL F++D S+     +  L+
Sbjct: 61  AASLKGLEKASGFLRSELGKRIR-LRHVPELIFKFDDSIAYGSHIEKLL 108


>gi|289163638|ref|YP_003453776.1| Ribosome-binding factor A [Legionella longbeachae NSW150]
 gi|288856811|emb|CBJ10622.1| Ribosome-binding factor A [Legionella longbeachae NSW150]
          Length = 121

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/123 (30%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
              N +R  RV E ++  L  +I   E +D  +    ++IS V ++ DL  A VY ++  
Sbjct: 1   MSHNFKRTDRVAEMIQRKLAQIIPK-EVKDPRL-TGFVTISAVKVAADLGHAKVYFTVLN 58

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
           D   + V S LN    ++R  + RS+  LR VP+L F YD S++   +L+ L+     P 
Sbjct: 59  D-DREMVASILNAASSYLRSVLARSI-TLRTVPQLHFVYDESIEYGQRLSRLIDKVAPPD 116

Query: 125 ALE 127
             E
Sbjct: 117 DHE 119


>gi|188532505|ref|YP_001906302.1| ribosome-binding factor A [Erwinia tasmaniensis Et1/99]
 gi|238689698|sp|B2VGN3|RBFA_ERWT9 RecName: Full=Ribosome-binding factor A
 gi|188027547|emb|CAO95394.1| Ribosome-binding factor A [Erwinia tasmaniensis Et1/99]
          Length = 137

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   ++++S V +S DL  A V+++   
Sbjct: 1   MAKEFGRPQRVSQELQKEIA-IILQREIKDPRL-GMMVTVSGVDVSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +     AL     +IR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEAAIKGGLRALGDASGYIRTLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTNV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VRNDEER 123


>gi|283797341|ref|ZP_06346494.1| ribosome-binding factor A [Clostridium sp. M62/1]
 gi|291075013|gb|EFE12377.1| ribosome-binding factor A [Clostridium sp. M62/1]
 gi|295090491|emb|CBK76598.1| ribosome-binding factor A [Clostridium cf. saccharolyticum K10]
 gi|295115415|emb|CBL36262.1| ribosome-binding factor A [butyrate-producing bacterium SM4/1]
          Length = 143

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +    KNS +  R+  EV+  L  +I   E +D  I   + ++  V ++ DL+    YIS
Sbjct: 11  RGNMRKNSIKNTRINSEVQRELSEIISR-EIKDPRIH-PMTTVVAVEVTPDLKYCKAYIS 68

Query: 62  LPLDVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +          I  L     F+R ++   + NLR  PE+ F  D S++    +  L+   
Sbjct: 69  VLGSEEAGKETIKGLKSAEGFVRRQLASRI-NLRNTPEITFVLDQSIEYGVNMTHLIN-- 125

Query: 121 KIPVALE 127
           ++   L+
Sbjct: 126 EVTKDLD 132


>gi|75908877|ref|YP_323173.1| ribosome-binding factor A [Anabaena variabilis ATCC 29413]
 gi|123609303|sp|Q3M9Q8|RBFA_ANAVT RecName: Full=Ribosome-binding factor A
 gi|75702602|gb|ABA22278.1| ribosome-binding factor A [Anabaena variabilis ATCC 29413]
          Length = 133

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 62/120 (51%), Gaps = 3/120 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           +RR  RV E ++  +  +++N   +D  +   ++S+++V +S DL+ A +Y+S+      
Sbjct: 4   NRRVSRVAELIKREVSQMLING-IKDDRVGTGMVSVTDVDVSGDLQHAKIYVSIYGTEEA 62

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
               ++ L     F+R  +G  +R LR  PE+ F  D S++   K+  L+   +   +L+
Sbjct: 63  KAETMAGLKSATGFVRSELGARVR-LRRTPEVTFIEDRSIERGTKVLTLLNKLENARSLD 121


>gi|222529044|ref|YP_002572926.1| ribosome-binding factor A [Caldicellulosiruptor bescii DSM 6725]
 gi|254789728|sp|B9MR49|RBFA_ANATD RecName: Full=Ribosome-binding factor A
 gi|222455891|gb|ACM60153.1| ribosome-binding factor A [Caldicellulosiruptor bescii DSM 6725]
          Length = 132

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 63/120 (52%), Gaps = 4/120 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
               R+ RV EE++  L  +I  ++ +D  +  ++ISI +V MS DLR A VY+S+    
Sbjct: 1   MQFERSDRVSEEIKKELSDII-QHDLKDPRLCAELISIVKVNMSKDLRHAKVYVSIFDKD 59

Query: 67  SP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               +  + AL     +IR  I R + +LR+ PE+ F  D S++   +++ ++    IP 
Sbjct: 60  KEKVETTMKALENAKPYIRREISRRI-SLRFTPEITFELDDSIEYGARISQILNQLNIPK 118


>gi|253573568|ref|ZP_04850911.1| ribosome-binding factor A [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251847096|gb|EES75101.1| ribosome-binding factor A [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 117

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 58/109 (53%), Gaps = 5/109 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  RVGE+++  L  V++ +E +D  I    ++++ V ++ DL  A VY+S+  D    
Sbjct: 4   NRTGRVGEQIKKELS-VLIQSELKDPRIG--FVTVTGVDVTNDLSQAKVYLSVFGDEEQK 60

Query: 70  R-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
              +  L     F+R  IG+ +R LR+ PEL F+ D S+    ++  L+
Sbjct: 61  NESLKGLEKATGFLRTEIGKRIR-LRHTPELIFKIDESIAYGSRIEKLL 108


>gi|17227559|ref|NP_484107.1| ribosome-binding factor A [Nostoc sp. PCC 7120]
 gi|20978596|sp|Q8Z0M8|RBFA_ANASP RecName: Full=Ribosome-binding factor A
 gi|17135041|dbj|BAB77587.1| ribosome binding facror A [Nostoc sp. PCC 7120]
          Length = 133

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 59/117 (50%), Gaps = 3/117 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           +RR  RV E ++  +  +++N   +D  +   ++S+++V +S DL+ A +Y+S+      
Sbjct: 4   NRRVSRVAELIKREVSQMLING-IKDDRVGTGMVSVTDVDVSGDLQHAKIYVSIYGTEEA 62

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               ++ L     F+R  +G  +R LR  PE+ F  D S++   K+  L+   +   
Sbjct: 63  KAETMAGLKSATGFVRSELGARVR-LRRTPEVTFIEDRSIERGTKVLTLLNKLENAR 118


>gi|292492787|ref|YP_003528226.1| ribosome-binding factor A [Nitrosococcus halophilus Nc4]
 gi|291581382|gb|ADE15839.1| ribosome-binding factor A [Nitrosococcus halophilus Nc4]
          Length = 127

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  R+GE ++  L   ++  E +D  +   ++++S V +S DLR A VY++   
Sbjct: 1   MSQEFSRTRRIGELLQRELAQ-LIQEELKDPRVK--LVTVSHVGVSPDLRQAKVYVTFLG 57

Query: 65  DVSPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                +   A LN    F++  + + +  LR +P LRF YD S++    L+AL+   
Sbjct: 58  GEKNIQQQLAVLNKAAGFLQHGLSQRV-ELRAIPRLRFVYDDSIERGRHLSALIDEA 113


>gi|56478756|ref|YP_160345.1| ribosome-binding factor A [Aromatoleum aromaticum EbN1]
 gi|61214724|sp|Q5NZS0|RBFA_AZOSE RecName: Full=Ribosome-binding factor A
 gi|56314799|emb|CAI09444.1| ribosome-binding factor A [Aromatoleum aromaticum EbN1]
          Length = 127

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 65/124 (52%), Gaps = 7/124 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI-SLP 63
            PK   R+ RV E+VR  L   ++  E +D  +    I++++V ++ D   A V+  S+ 
Sbjct: 1   MPKEFSRSQRVAEQVRRELAE-LIRLEVKDPRVG--FITLTDVEITPDYAHAKVFFTSMK 57

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
            +   D +++ L+    F+R  +G+ +R +  +PEL F YD+S++   +++ L+    + 
Sbjct: 58  GEEGLDEILTGLHRASGFLRRELGKRVR-IHTLPELHFHYDSSVERGSRMSQLIDQ--VV 114

Query: 124 VALE 127
              +
Sbjct: 115 RDDD 118


>gi|226940846|ref|YP_002795920.1| ribosome-binding factor A [Laribacter hongkongensis HLHK9]
 gi|226715773|gb|ACO74911.1| RbfA [Laribacter hongkongensis HLHK9]
          Length = 129

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 58/128 (45%), Gaps = 9/128 (7%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
            K   RA RV ++++  L   ++  E +D  I    I+++ V ++ D   A V+ ++   
Sbjct: 4   KKGFSRADRVADQIQRDLAE-LIRVELKDPRIG--FITLTGVEVTRDYSHAKVFYTVLNS 60

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC-----LP 120
                  S L     ++R  I R +R L  VPEL F YD S++    ++ L+        
Sbjct: 61  EDLSETQSTLERASGWLRSEIARGIR-LFTVPELHFVYDESVERGMYMDRLLDQVAEADA 119

Query: 121 KIPVALEK 128
           ++P   +K
Sbjct: 120 QLPRDDDK 127


>gi|259907043|ref|YP_002647399.1| ribosome-binding factor A [Erwinia pyrifoliae Ep1/96]
 gi|224962665|emb|CAX54120.1| Ribosome-binding factor A [Erwinia pyrifoliae Ep1/96]
 gi|283476839|emb|CAY72677.1| rbfA [Erwinia pyrifoliae DSM 12163]
 gi|310766255|gb|ADP11205.1| ribosome-binding factor A [Erwinia sp. Ejp617]
          Length = 137

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   ++++S V +S DL  A V+++   
Sbjct: 1   MAKEFGRPQRVSQELQKEIA-IILQREIKDPRL-GMMVTVSGVDVSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +     AL     +IR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEAAIKAGLRALGDASGYIRTLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLV-TNV 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VRNDEER 123


>gi|313156820|gb|EFR56260.1| ribosome-binding factor A [Alistipes sp. HGB5]
          Length = 113

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 57/115 (49%), Gaps = 3/115 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++ ++++  +  +       + ++   +++++ V +S D   A +Y+S+    
Sbjct: 1   METTRQQKIAKQIQKDVAEIFQKEG--EGIVRGSLVTVTAVRVSPDFGYAKIYVSVFPFG 58

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLP 120
               ++  L+ N KFIR  +G+ +RN ++ VPE++F  D SL+    +   +   
Sbjct: 59  RSAALMQELDRNNKFIRHALGQRIRNQVKNVPEIQFFLDDSLEYIDHIEQALKND 113


>gi|251791034|ref|YP_003005755.1| ribosome-binding factor A [Dickeya zeae Ech1591]
 gi|247539655|gb|ACT08276.1| ribosome-binding factor A [Dickeya zeae Ech1591]
          Length = 133

 Score =  110 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 65/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +I+  E +D  +   + ++S V +S DL  A V+++   
Sbjct: 1   MAKEFSRTQRVAQEMQKEIA-IIIQREVKDPRVG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D  P++V     AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 58  DNEPEQVKAGVKALQDASGFIRMLLGKAMR-LRVVPELTFSYDNSLVEGMRMSNLVTSV- 115

Query: 122 IPVALEK 128
           +    E+
Sbjct: 116 VKRDAER 122


>gi|307129386|ref|YP_003881402.1| 30S ribosome binding factor [Dickeya dadantii 3937]
 gi|306526915|gb|ADM96845.1| 30S ribosome binding factor [Dickeya dadantii 3937]
          Length = 133

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 66/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +I+  E +D  +   + ++S V +S DL  A V+++   
Sbjct: 1   MAKEFSRTQRVAQEMQKEIA-IIIQREVKDPRVG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D  P++V     AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 58  DNEPEQVKAGVKALQDASGFIRMLLGKAMR-LRVVPELTFSYDNSLVEGMRMSNLV-TKV 115

Query: 122 IPVALEK 128
           +   +E+
Sbjct: 116 VKRDVER 122


>gi|291514732|emb|CBK63942.1| ribosome-binding factor A [Alistipes shahii WAL 8301]
          Length = 113

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 53/115 (46%), Gaps = 3/115 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++ ++++  +  +         ++   +++++ V +S D   A +Y+S+    
Sbjct: 1   METTRQQKIAKQIQKDVAEIFQKEGA--PIVRGSLVTVTAVRISPDFSYAKIYVSIFPFE 58

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLP 120
               V+  L     FIR  +G+ LRN L+ VPE++F  D SL+    +   +   
Sbjct: 59  QSGEVMKRLEHQNWFIRRALGQRLRNQLKNVPEIQFLLDDSLEYIEHIEQALKED 113


>gi|74316714|ref|YP_314454.1| ribosome-binding factor A [Thiobacillus denitrificans ATCC 25259]
 gi|123612206|sp|Q3SKX2|RBFA_THIDA RecName: Full=Ribosome-binding factor A
 gi|74056209|gb|AAZ96649.1| ribosome-binding factor A [Thiobacillus denitrificans ATCC 25259]
          Length = 124

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 61/124 (49%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS-LP 63
            PK+  RA RV ++++  L   ++  E +D  +   +++I+EV ++ D+  A VY + + 
Sbjct: 1   MPKDFPRARRVADQIQRELPE-LIRQEVKDPRVG--MLTITEVEVNRDMEFAKVYFTTMG 57

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
            +      +  L     F+R ++   +  LR VP+L F YD S++    L+ L+    + 
Sbjct: 58  GEAEHAACLQGLQRASGFLRSQLSHRM-QLRVVPKLTFVYDRSVEHGMALSRLI-ETAVA 115

Query: 124 VALE 127
              +
Sbjct: 116 EDAK 119


>gi|317493627|ref|ZP_07952048.1| ribosome-binding protein A [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918570|gb|EFV39908.1| ribosome-binding protein A [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 136

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 66/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  I   ++++S V +S DL  A V+++   
Sbjct: 1   MAKEFSRTQRVSQEMQKEIA-IILQREVKDPRIG--MVTVSGVEVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D  P+ V     AL+    FIR  IG+++R LR VPEL F YD SL    +++ L+    
Sbjct: 58  DSDPNAVRVGLKALHEASGFIRMLIGKAMR-LRVVPELTFSYDNSLVEGMRMSNLVTSV- 115

Query: 122 IPVALEK 128
           +    E+
Sbjct: 116 VKNDEER 122


>gi|262274882|ref|ZP_06052693.1| ribosome-binding factor A [Grimontia hollisae CIP 101886]
 gi|262221445|gb|EEY72759.1| ribosome-binding factor A [Grimontia hollisae CIP 101886]
          Length = 130

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 63/126 (50%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  +  ++   E +D  I   ++++S V +S DL  A V+++   
Sbjct: 1   MAKEFSRTQRVSQQLQKEIALILQR-EIKDPRIG--MVTVSGVEVSRDLAYAKVFVTFLT 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             D +P   + AL+    +IR  +G+++R LR  PE+ F +D SL    +++ L+    +
Sbjct: 58  MGDQTPQGGLEALHEATGYIRSLLGKAIR-LRVTPEITFYFDASLTEGMRISNLVSQ-AV 115

Query: 123 PVALEK 128
                +
Sbjct: 116 KSDEAR 121


>gi|292486838|ref|YP_003529708.1| ribosome-binding factor A [Erwinia amylovora CFBP1430]
 gi|292900764|ref|YP_003540133.1| ribosome-binding factor A [Erwinia amylovora ATCC 49946]
 gi|291200612|emb|CBJ47744.1| ribosome-binding factor A [Erwinia amylovora ATCC 49946]
 gi|291552255|emb|CBA19292.1| Ribosome-binding factor A [Erwinia amylovora CFBP1430]
 gi|312170906|emb|CBX79165.1| Ribosome-binding factor A [Erwinia amylovora ATCC BAA-2158]
          Length = 137

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   ++++S V +S DL  A V+++   
Sbjct: 1   MAKEFGRPQRVSQELQKEIA-IILQREIKDPRL-GMMVTVSGVDVSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +     AL     +IR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEAAIKAGLRALGDASGYIRTLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLV-TNV 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VRNDEER 123


>gi|302872112|ref|YP_003840748.1| ribosome-binding factor A [Caldicellulosiruptor obsidiansis OB47]
 gi|302574971|gb|ADL42762.1| ribosome-binding factor A [Caldicellulosiruptor obsidiansis OB47]
          Length = 132

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 62/120 (51%), Gaps = 4/120 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
               R+ RV EE++  L  +I  +E +D  +  ++IS+ +V MS DLR A VY+S+    
Sbjct: 1   MQFERSDRVSEEIKKELSDII-QHELKDPRLCAELISVVKVNMSKDLRYAKVYVSIFDKD 59

Query: 67  SP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               +  + AL     +IR  I R + +LR+ PE+ F  D S++   +++ ++    I  
Sbjct: 60  KEKVESTMKALENAKPYIRREISRRI-SLRFTPEITFELDDSIEYGARISQILNQLNISK 118


>gi|126730446|ref|ZP_01746257.1| ribosome-binding factor A [Sagittula stellata E-37]
 gi|126709179|gb|EBA08234.1| ribosome-binding factor A [Sagittula stellata E-37]
          Length = 113

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 56/113 (49%), Gaps = 1/113 (0%)

Query: 15  VGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRVISA 74
           + E +R  L  V++  +  D  ++R  I++ EV +S DL+VAT Y+        D + + 
Sbjct: 1   MSEVIRRQLSDVLMRGDVHDPELNRLSITVGEVRVSPDLKVATAYVVPLGGQKADDMFAL 60

Query: 75  LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           L+ N   +R  + + L  L++ PELRFR D +  +  +   L     +   +E
Sbjct: 61  LDRNKGELRRAVSKGL-TLKFAPELRFRLDETFDNLDEARRLFSDDTVRRDVE 112


>gi|258511416|ref|YP_003184850.1| ribosome-binding factor A [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257478142|gb|ACV58461.1| ribosome-binding factor A [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 118

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 58/116 (50%), Gaps = 5/116 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SP 68
            RA +V E+++  L  ++  +E +D  I    ++I+ V +S DL+ A +Y+S+       
Sbjct: 4   IRAQKVAEQMKKELADIL-QHELKDPRIG--FVTITRVEVSGDLQHAKIYVSVYGPEAEK 60

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
           +  +  L     FIRG I R L ++R  PEL FR D S +   ++  ++   K   
Sbjct: 61  EATLGVLTKAAGFIRGEIARRL-HMRMAPELVFRLDESGEYSERIEHVLKSLKENE 115


>gi|83589899|ref|YP_429908.1| ribosome-binding factor A [Moorella thermoacetica ATCC 39073]
 gi|123524645|sp|Q2RJM4|RBFA_MOOTA RecName: Full=Ribosome-binding factor A
 gi|83572813|gb|ABC19365.1| ribosome-binding factor A [Moorella thermoacetica ATCC 39073]
          Length = 122

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 60/112 (53%), Gaps = 3/112 (2%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           R  RV EE++  +  +I  +E +D  +   ++S++ V +S D   A VY+S+  D    +
Sbjct: 6   RNQRVAEEMKKEIARII-RDEVKDPRLEAGLVSVTGVELSNDRHYAKVYVSIYGDEEARN 64

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           + +  L     FIR  IG+ L +LRY PE+ F+ D S++    +N L+   +
Sbjct: 65  QAMEGLARATSFIRREIGQRL-SLRYTPEITFKLDVSIEHGDHINRLLARVR 115


>gi|167753901|ref|ZP_02426028.1| hypothetical protein ALIPUT_02186 [Alistipes putredinis DSM 17216]
 gi|167658526|gb|EDS02656.1| hypothetical protein ALIPUT_02186 [Alistipes putredinis DSM 17216]
          Length = 114

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 23/116 (19%), Positives = 58/116 (50%), Gaps = 3/116 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++ ++++  +  +         ++   +++++ V +S D   A +Y+S+    
Sbjct: 1   METTRQQKIAKQIQRDMAEIFQKEGA--EIVRGVLVTVTAVRVSPDFSYAKIYVSVFPFE 58

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               V++ L  +  F+R  +G+ +RN L+ VPE++F  D SL+   +++  M   +
Sbjct: 59  QNAAVMATLEQHNWFLRRALGQRIRNQLKTVPEIQFFLDDSLEYIEQIDRAMHREE 114


>gi|326204067|ref|ZP_08193928.1| ribosome-binding factor A [Clostridium papyrosolvens DSM 2782]
 gi|325985834|gb|EGD46669.1| ribosome-binding factor A [Clostridium papyrosolvens DSM 2782]
          Length = 117

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 36/112 (32%), Positives = 59/112 (52%), Gaps = 4/112 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           R +R+ EEV+  +  +I  N+ +D  +   ++SI    ++ DLR A V++S+  +     
Sbjct: 4   RIIRISEEVKKEISNII-QNDIKDPRLPS-MVSIVSCNVTKDLRYAKVFVSVLGNEEQKK 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             ISAL     FIR  +G  +  LRY PE+ F  DTS++    +N L+   K
Sbjct: 62  NAISALKSAAGFIRRELGHRV-QLRYTPEIHFELDTSIEHGIHINKLLDDAK 112


>gi|304396349|ref|ZP_07378230.1| ribosome-binding factor A [Pantoea sp. aB]
 gi|308189114|ref|YP_003933245.1| Ribosome-binding factor A [Pantoea vagans C9-1]
 gi|304355858|gb|EFM20224.1| ribosome-binding factor A [Pantoea sp. aB]
 gi|308059624|gb|ADO11796.1| Ribosome-binding factor A [Pantoea vagans C9-1]
          Length = 136

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 63/128 (49%), Gaps = 7/128 (5%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
              K   R  RV +E++  +  ++   E +D  +   ++++S V +S DL  A V+++  
Sbjct: 1   MMAKEFGRPQRVSQELQKEIAMILQR-EIKDPRL-GMMVTVSGVEVSRDLAYAKVFVTFL 58

Query: 64  LDVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            D   D +     AL     +IR  +G+++R LR VPEL F YD SL    +++ L+   
Sbjct: 59  NDKDEDAIKHGLKALKEASGYIRILLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV 117

Query: 121 KIPVALEK 128
            +    E+
Sbjct: 118 -VKNDAER 124


>gi|254974857|ref|ZP_05271329.1| ribosome-binding factor A [Clostridium difficile QCD-66c26]
 gi|255092244|ref|ZP_05321722.1| ribosome-binding factor A [Clostridium difficile CIP 107932]
 gi|255313984|ref|ZP_05355567.1| ribosome-binding factor A [Clostridium difficile QCD-76w55]
 gi|255516664|ref|ZP_05384340.1| ribosome-binding factor A [Clostridium difficile QCD-97b34]
 gi|255649763|ref|ZP_05396665.1| ribosome-binding factor A [Clostridium difficile QCD-37x79]
 gi|260682919|ref|YP_003214204.1| ribosome-binding factor A [Clostridium difficile CD196]
 gi|260686517|ref|YP_003217650.1| ribosome-binding factor A [Clostridium difficile R20291]
 gi|306519868|ref|ZP_07406215.1| ribosome-binding factor A [Clostridium difficile QCD-32g58]
 gi|260209082|emb|CBA62230.1| ribosome-binding factor A [Clostridium difficile CD196]
 gi|260212533|emb|CBE03487.1| ribosome-binding factor A [Clostridium difficile R20291]
          Length = 126

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 63/110 (57%), Gaps = 4/110 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  R+ EE+R  +  +++N   +D  I   ++S+++V ++ DLR A VY+S+      +
Sbjct: 5   NRTRRIAEEIRKVVSTMLING-VKDPRI-TSMVSVTDVEVTNDLRYAYVYVSILGG-DEE 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
             ++ L     +IR  +G++++ LRY+PE+ F+ D S++    ++ L+  
Sbjct: 62  STLTGLKSAGGYIRREVGKNIK-LRYIPEIVFKLDDSIEKGMYMDNLIKR 110


>gi|161506149|ref|YP_001573261.1| ribosome-binding factor A [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160867496|gb|ABX24119.1| hypothetical protein SARI_04339 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 145

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V MS DL  A VY++   
Sbjct: 13  MAKEFGRPQRVAQEMQKEIA-IILQREIKDPRL-GMMTTVSGVEMSRDLAYAKVYVTFLN 70

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 71  DKDEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTNV- 128

Query: 122 IPVALEK 128
           +    E+
Sbjct: 129 VKHDEER 135


>gi|312127894|ref|YP_003992768.1| ribosome-binding factor a [Caldicellulosiruptor hydrothermalis 108]
 gi|311777913|gb|ADQ07399.1| ribosome-binding factor A [Caldicellulosiruptor hydrothermalis 108]
          Length = 132

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 62/120 (51%), Gaps = 4/120 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
               R+ RV EE++  L  +I  ++ +D  +  ++ISI +V MS DLR A VY+S+    
Sbjct: 1   MQFERSDRVSEEIKKELSDII-QHDLKDPRLCAELISIVKVNMSKDLRHAKVYVSIFDKD 59

Query: 67  SP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               +  + AL     +IR  I R + +LR+ PE+ F  D S++   +++ ++    I  
Sbjct: 60  KEKVETTMKALENAKPYIRREISRRI-SLRFTPEITFELDDSIEYGARISQILNQLNISK 118


>gi|251797396|ref|YP_003012127.1| ribosome-binding factor A [Paenibacillus sp. JDR-2]
 gi|247545022|gb|ACT02041.1| ribosome-binding factor A [Paenibacillus sp. JDR-2]
          Length = 118

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 32/112 (28%), Positives = 59/112 (52%), Gaps = 5/112 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-P 68
            R  RVGE+++  L  +I   E +D  I    I+++ V  + DL  A VY+S+       
Sbjct: 4   IRVGRVGEQIKKELSQII-QTELKDPRIG--FITVTGVEATSDLSQARVYLSVLGSEEQK 60

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +  + AL     ++R  +G+ +R LR+ PEL F++D+S++   ++  L+   
Sbjct: 61  EETLKALGKANGYLRSELGKRMR-LRHTPELLFKFDSSIEYGSRIEGLLEEI 111


>gi|261419465|ref|YP_003253147.1| ribosome-binding factor A [Geobacillus sp. Y412MC61]
 gi|297530560|ref|YP_003671835.1| ribosome-binding factor A [Geobacillus sp. C56-T3]
 gi|319766280|ref|YP_004131781.1| ribosome-binding factor A [Geobacillus sp. Y412MC52]
 gi|261375922|gb|ACX78665.1| ribosome-binding factor A [Geobacillus sp. Y412MC61]
 gi|297253812|gb|ADI27258.1| ribosome-binding factor A [Geobacillus sp. C56-T3]
 gi|317111146|gb|ADU93638.1| ribosome-binding factor A [Geobacillus sp. Y412MC52]
          Length = 127

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 60/113 (53%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           + RA RVGE+++  L  +I     +D  I    +++++V ++ DL+ A VYIS+  D   
Sbjct: 2   NIRATRVGEQMKKELSDIISRR-LKDPRIG--FVTVTDVRVTGDLQQAKVYISVLGDDKQ 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +  + AL     FIR  IG+ +R LR  PE+ F  D +++   ++  L+   
Sbjct: 59  RENTLKALEKAKGFIRSEIGQRIR-LRKTPEIFFEIDETIEYGSRIEQLIRQI 110


>gi|315648093|ref|ZP_07901194.1| ribosome-binding factor A [Paenibacillus vortex V453]
 gi|315276739|gb|EFU40082.1| ribosome-binding factor A [Paenibacillus vortex V453]
          Length = 117

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 5/109 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  RVGE+++  L   ++  E +D  I    I+++ V ++ DL  A +Y+S+  D    
Sbjct: 4   IRTGRVGEQIKKELSQ-LIQTEMKDPRIG--FITVTGVDVTNDLSQAKIYLSVLGDDEQK 60

Query: 70  RVI-SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                 L     F+R  +G+ +R LR+VPEL F++D S+     +  L+
Sbjct: 61  AASLKGLEKASGFLRSELGKRIR-LRHVPELIFKFDDSIAYGSHIEKLL 108


>gi|186681202|ref|YP_001864398.1| ribosome-binding factor A [Nostoc punctiforme PCC 73102]
 gi|28380131|sp|Q93LL7|RBFA_NOSP7 RecName: Full=Ribosome-binding factor A
 gi|14594717|gb|AAK68649.1| ribosome binding factor A [Nostoc punctiforme PCC 73102]
 gi|186463654|gb|ACC79455.1| ribosome-binding factor A [Nostoc punctiforme PCC 73102]
          Length = 139

 Score =  110 bits (275), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 59/113 (52%), Gaps = 3/113 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           +RR  RV E ++  +  ++LN   +D  +   ++S+++V +S DL+ A +Y+S+      
Sbjct: 4   NRRVSRVAELIKREVSQMLLNG-IKDDRVGTGMVSVTDVDVSGDLQHAKIYVSIYGTDEA 62

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
               ++ L     ++R  +G  +R LR  PE+ F  D S++   K+ AL+   
Sbjct: 63  KVETMAGLKSATGYVRSELGARVR-LRRTPEVIFLEDRSIERGNKVLALLSQL 114


>gi|294671352|ref|ZP_06736203.1| hypothetical protein NEIELOOT_03061 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291306984|gb|EFE48227.1| hypothetical protein NEIELOOT_03061 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 123

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 60/125 (48%), Gaps = 4/125 (3%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           NKN +   R  RV E++   L   ++    +D       I+I++V ++ D   ATVY ++
Sbjct: 2   NKNHRGYARQDRVKEQIMRELAE-LVRRGLKDPRAG--FITINDVEVTRDYSHATVYYTV 58

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             D + D    AL     F+R  + + ++  R +PEL F+YD SL+    ++ L+     
Sbjct: 59  LDDATRDITAEALEHAKGFLRSELSKRIKLFR-IPELHFQYDQSLERGMSISHLIEQVAA 117

Query: 123 PVALE 127
              +E
Sbjct: 118 EKPVE 122


>gi|254487255|ref|ZP_05100460.1| ribosome-binding factor A [Roseobacter sp. GAI101]
 gi|214044124|gb|EEB84762.1| ribosome-binding factor A [Roseobacter sp. GAI101]
          Length = 136

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 55/113 (48%), Gaps = 1/113 (0%)

Query: 15  VGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRVISA 74
           +GE +R AL  V+   +  D  ++R  I++ EV  S DL++AT ++        D V+  
Sbjct: 1   MGETIRRALSEVLARGDVHDPELNRMSITVGEVRASPDLKIATAFVLPLGGEGRDEVLKL 60

Query: 75  LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           L  N   +R ++ + L  L++ P+LRF+ D +     +   ++    +    E
Sbjct: 61  LARNKGELRRQLSKKLV-LKFAPDLRFQLDETFDRMDETRRMLAQDVVRRDAE 112


>gi|288556940|ref|YP_003428875.1| ribosome-binding factor A [Bacillus pseudofirmus OF4]
 gi|288548100|gb|ADC51983.1| ribosome-binding factor A [Bacillus pseudofirmus OF4]
          Length = 113

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 64/115 (55%), Gaps = 5/115 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA RVGE+++  L  +I+  E +D  IS   ++I+ V ++ DL+ A V+I++  D 
Sbjct: 1   MSNVRAHRVGEQMKKELSDIIMR-ELKDPRIS--FVTITGVDVTGDLQQAKVFITVLGDD 57

Query: 67  -SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              +  +  L+    FIR  IG+ +R LR  PE+ F +D S++   ++  L+   
Sbjct: 58  AQKESTLKGLSKAKGFIRSEIGKRIR-LRKTPEITFEFDESIEYGNRIETLINDL 111


>gi|125973505|ref|YP_001037415.1| ribosome-binding factor A [Clostridium thermocellum ATCC 27405]
 gi|281417708|ref|ZP_06248728.1| ribosome-binding factor A [Clostridium thermocellum JW20]
 gi|182676539|sp|A3DE43|RBFA_CLOTH RecName: Full=Ribosome-binding factor A
 gi|125713730|gb|ABN52222.1| ribosome-binding factor A [Clostridium thermocellum ATCC 27405]
 gi|281409110|gb|EFB39368.1| ribosome-binding factor A [Clostridium thermocellum JW20]
          Length = 123

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD- 69
           R  R+ EE++  +  +I  NE +D  +S+ +ISI+EV ++ DLR A VY+S+        
Sbjct: 3   RIERISEEIKREISDII-QNELKDPRLSK-LISITEVNVTKDLRYAKVYVSVMGSEEEKA 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             +  L     FIR  IGR +  LRY PE+ F  D S++    +  L+       
Sbjct: 61  NSLEGLKSAAGFIRREIGRRV-QLRYTPEIHFELDNSIERGAYITKLINETSAQN 114


>gi|255658257|ref|ZP_05403666.1| ribosome-binding factor A [Mitsuokella multacida DSM 20544]
 gi|260849568|gb|EEX69575.1| ribosome-binding factor A [Mitsuokella multacida DSM 20544]
          Length = 131

 Score =  109 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 57/119 (47%), Gaps = 5/119 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           R  +V E ++  +  +IL  E +D  I    ++++ V  + DLR A +Y+SL        
Sbjct: 5   RVEKVQELMKQEISEIILR-ELKDPRIG--FVTVTSVECTGDLREAKIYVSLMGSEQQVK 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
              + L  ++ FIR  IG+ +R LR+ PEL F  D SL     +  L+   +     +K
Sbjct: 62  DCWAGLQSSLGFIRREIGKRIR-LRFTPELSFVVDKSLDYSAHIQELLLKIEAEDKAKK 119


>gi|114331631|ref|YP_747853.1| ribosome-binding factor A [Nitrosomonas eutropha C91]
 gi|122313590|sp|Q0AFJ4|RBFA_NITEC RecName: Full=Ribosome-binding factor A
 gi|114308645|gb|ABI59888.1| ribosome-binding factor A [Nitrosomonas eutropha C91]
          Length = 117

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/117 (27%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            PK+  R LRV ++V+  L   ++ NE  D  I   +I+++ V ++ D   A V+ +   
Sbjct: 1   MPKDFSRTLRVADQVQRELAS-LIQNEIMDPRIG--MITLTGVEVTRDYTYAKVFYTTLG 57

Query: 65  -DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            + +       L     F+R ++   +R LR +P+L+F YD S++   KL+ L+   
Sbjct: 58  GNENAQLAEEGLKRAAGFLRSQLAGKIR-LRIIPKLQFVYDESIERGIKLSRLIDEA 113


>gi|312622700|ref|YP_004024313.1| ribosome-binding factor a [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312793239|ref|YP_004026162.1| ribosome-binding factor a [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312876949|ref|ZP_07736924.1| ribosome-binding factor A [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796264|gb|EFR12618.1| ribosome-binding factor A [Caldicellulosiruptor lactoaceticus 6A]
 gi|312180379|gb|ADQ40549.1| ribosome-binding factor A [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312203167|gb|ADQ46494.1| ribosome-binding factor A [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 132

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 62/120 (51%), Gaps = 4/120 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
               R+ RV EE++  L  +I  ++ +D  +  ++ISI +V MS DLR A VY+S+    
Sbjct: 1   MQFERSDRVSEEIKKELSDII-QHDLKDPRLCAELISIVKVNMSKDLRHAKVYVSIFDKD 59

Query: 67  SP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               +  + AL     +IR  I + + +LR+ PE+ F  D S++   +++ ++    I  
Sbjct: 60  KEKVESTMKALENAKPYIRREISKRI-SLRFTPEITFELDNSIEYGARISQILNQLNISK 118


>gi|257094532|ref|YP_003168173.1| ribosome-binding factor A [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257047056|gb|ACV36244.1| ribosome-binding factor A [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 136

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 5/118 (4%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
              +   R  R+ E++R  L   ++  E +D  +   +IS++EV +S D   A V+ S  
Sbjct: 2   SGNRGFARRDRIAEQIRRELAE-LIRTELRDPRVG--MISLTEVQVSADYAHAKVFFSTL 58

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 D V + L     F+R  +G+ + ++   PEL F +D SL+   +L+ L+   
Sbjct: 59  AGSEQLDAVYAGLQHAGGFLRRELGKRI-SIHATPELHFVFDASLEHGAQLSKLISEA 115


>gi|255038621|ref|YP_003089242.1| ribosome-binding factor A [Dyadobacter fermentans DSM 18053]
 gi|254951377|gb|ACT96077.1| ribosome-binding factor A [Dyadobacter fermentans DSM 18053]
          Length = 127

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 6/126 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R  +VG +++  L  +   +     L     ++I+ V ++ DL +A  Y+S   D 
Sbjct: 1   MESKRQQKVGRQIQKDLGEIFQKDAQH--LTHGSFVTITAVRVTPDLSIARAYLSFLPDK 58

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPKI--- 122
           +   ++  +  N +FIR ++   +R+ LR VP L+F  D + +   K++ L     I   
Sbjct: 59  NKTMLLETIRENTRFIRQKLAERVRHQLRIVPHLQFYIDDTAEYAAKMDQLFADLVIPPA 118

Query: 123 PVALEK 128
               E+
Sbjct: 119 QPDEEE 124


>gi|82702984|ref|YP_412550.1| ribosome-binding factor A [Nitrosospira multiformis ATCC 25196]
 gi|123544258|sp|Q2Y7W3|RBFA_NITMU RecName: Full=Ribosome-binding factor A
 gi|82411049|gb|ABB75158.1| ribosome-binding factor A [Nitrosospira multiformis ATCC 25196]
          Length = 126

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 61/122 (50%), Gaps = 6/122 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
            PK+  R LR+ ++++  L   ++ NE +D  I   +I+++ V +S D   A V+ +   
Sbjct: 1   MPKDYSRTLRIADQIQRELAD-LIRNELKDPRIG--MITLTGVEVSQDYAHAKVFYTTLH 57

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
            +     V + L     F+R ++   L+ LR +P+L F YD S++   +L+ L+    + 
Sbjct: 58  NESDNFLVQNGLENAAGFLRTQLLHRLK-LRVIPQLHFIYDESIERGVRLSQLI-DEAVA 115

Query: 124 VA 125
             
Sbjct: 116 SD 117


>gi|294085146|ref|YP_003551906.1| ribosome-binding factor A [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664721|gb|ADE39822.1| ribosome-binding factor A [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 129

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/113 (32%), Positives = 59/113 (52%), Gaps = 1/113 (0%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R LRVGE +R AL  ++   +F D  +    I+ISE+ +S DL  A VY      
Sbjct: 12  KGPSQRQLRVGETLRHALSDILFREDFFDPDLENVSITISEISISPDLSNARVYTMPLGG 71

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           V+ + V+ ALN     I+  + + + +LR  P L+F  D S ++  ++N L  
Sbjct: 72  VNVEVVLPALNRLAPKIQSMVAQRV-HLRRAPRLKFLLDESFENAARMNVLFN 123


>gi|300718576|ref|YP_003743379.1| ribosome-binding factor A [Erwinia billingiae Eb661]
 gi|299064412|emb|CAX61532.1| Ribosome-binding factor A [Erwinia billingiae Eb661]
          Length = 138

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   ++++S V +S DL  A V+++   
Sbjct: 1   MAKEFGRPQRVSQELQKEIAVILQR-EIKDPRL-GMMVTVSGVDLSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D +     AL     +IR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEDAIKGGLRALGDASGYIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTNV- 116

Query: 122 IPVALEK 128
           +   +E+
Sbjct: 117 VRNDVER 123


>gi|254496142|ref|ZP_05109040.1| ribosome-binding factor A [Legionella drancourtii LLAP12]
 gi|254354629|gb|EET13266.1| ribosome-binding factor A [Legionella drancourtii LLAP12]
          Length = 123

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 57/115 (49%), Gaps = 4/115 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +N +R  R+ E ++  L  +I   E +D  +    ++IS V ++ DL  A +Y ++  
Sbjct: 1   MGQNFKRTDRIAEMIQRKLAQIIPQ-EVKDPRL-NGFVTISAVKVAADLGHAKIYFTVLN 58

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                   + LN    ++R  + RS+  LR VP+L F YD S++   +L+ L+  
Sbjct: 59  A-DKKLAATILNAAASYLRSALARSI-TLRTVPQLHFIYDESIEYGQRLSRLIDD 111


>gi|260061333|ref|YP_003194413.1| ribosome-binding factor A [Robiginitalea biformata HTCC2501]
 gi|88785465|gb|EAR16634.1| ribosome-binding factor A [Robiginitalea biformata HTCC2501]
          Length = 135

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 53/115 (46%), Gaps = 2/115 (1%)

Query: 8   NSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS 67
            ++R  ++   ++  L  ++      D  +   ++S+++V ++ DL +A VY+S+     
Sbjct: 7   ETQRQKKIAGLLQQDLAEMLQRAAV-DGGLQGIILSVTKVHVTSDLSIAKVYVSIFPVKE 65

Query: 68  PDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
              +I  +       R  + R  RN LR VPEL+F  D SL+    +   +   +
Sbjct: 66  ATGLIKGIQAQKAQFRHELARRTRNQLRRVPELQFYLDDSLEYIENIEKSLKEGE 120


>gi|78222797|ref|YP_384544.1| ribosome-binding factor A [Geobacter metallireducens GS-15]
 gi|123571972|sp|Q39VA5|RBFA_GEOMG RecName: Full=Ribosome-binding factor A
 gi|78194052|gb|ABB31819.1| ribosome-binding factor A [Geobacter metallireducens GS-15]
          Length = 118

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/112 (26%), Positives = 60/112 (53%), Gaps = 5/112 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-P 68
           +R+ +V E +   +  +++    +D  I    ++I+ V +S D+R AT+Y ++       
Sbjct: 3   KRSDKVAEAIHELVSGLLVKG-LKDPRIG--FVTITGVKVSDDIRHATIYYTVMGSDEAK 59

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              +  LN ++ FIR  + + LR LR+ PEL F+YD S++   +++ L+   
Sbjct: 60  KSTLHGLNSSVGFIRKEVSKELR-LRFAPELIFKYDESIEYGNRIDQLLKEI 110


>gi|30248766|ref|NP_840836.1| ribosome-binding factor A [Nitrosomonas europaea ATCC 19718]
 gi|34098452|sp|Q82WC9|RBFA_NITEU RecName: Full=Ribosome-binding factor A
 gi|30180361|emb|CAD84673.1| Ribosome-binding factor A [Nitrosomonas europaea ATCC 19718]
          Length = 117

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             ++  R +RV ++++  L  +++ NE  D  +   +++++ V ++ D   A V+ +   
Sbjct: 1   MSRDFSRTVRVADQIQRELA-LLIQNEIMDPRVG--MVTLTGVEVTRDYAYAKVFYTTLG 57

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                  V   L     F+R ++   +R LR VP+L+F YD S++   KL+ L+   
Sbjct: 58  GDENIQLVEEGLKHAAGFLRSQLAGKIR-LRVVPQLQFVYDESVERGMKLSRLIDEA 113


>gi|126698909|ref|YP_001087806.1| ribosome-binding factor A [Clostridium difficile 630]
 gi|255100330|ref|ZP_05329307.1| ribosome-binding factor A [Clostridium difficile QCD-63q42]
 gi|255306268|ref|ZP_05350440.1| ribosome-binding factor A [Clostridium difficile ATCC 43255]
 gi|123174598|sp|Q18BH6|RBFA_CLOD6 RecName: Full=Ribosome-binding factor A
 gi|115250346|emb|CAJ68168.1| Ribosome-binding factor A [Clostridium difficile]
          Length = 126

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 64/110 (58%), Gaps = 4/110 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  R+ EE+R  +  +++N   +D  I   ++S+++V ++ DLR A VY+S+      +
Sbjct: 5   NRTRRIAEEIRKVVSTMLING-VKDPRI-TSMVSVTDVEVTNDLRYAYVYVSILGG-DEE 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
             ++ L     +IR  +G++++ LRY+PE+ F+ D S++    +++L+  
Sbjct: 62  STLTGLKSAGGYIRREVGKNIK-LRYIPEIVFKLDDSIEKGMYMDSLIKR 110


>gi|256003323|ref|ZP_05428314.1| ribosome-binding factor A [Clostridium thermocellum DSM 2360]
 gi|255992613|gb|EEU02704.1| ribosome-binding factor A [Clostridium thermocellum DSM 2360]
 gi|316940256|gb|ADU74290.1| ribosome-binding factor A [Clostridium thermocellum DSM 1313]
          Length = 123

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/115 (32%), Positives = 58/115 (50%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD- 69
           R  R+ EE++  +  +I  NE +D  +S+ +ISI+EV ++ DLR A VY+S+        
Sbjct: 3   RIERISEEIKREISDII-QNELKDPRLSK-LISITEVNVTKDLRYAKVYVSVMGSKEEKA 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             +  L     FIR  IGR +  LRY PE+ F  D S++    +  L+       
Sbjct: 61  NSLEGLKSAAGFIRREIGRRV-QLRYTPEIHFELDNSIERGAYITKLINETSAQN 114


>gi|188586071|ref|YP_001917616.1| ribosome-binding factor A [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|229568641|sp|B2A398|RBFA_NATTJ RecName: Full=Ribosome-binding factor A
 gi|179350758|gb|ACB85028.1| ribosome-binding factor A [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 131

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 61/118 (51%), Gaps = 5/118 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           R  ++ EE++  +  ++   E +D  +    ++++ V +S DLR A V++S+  +     
Sbjct: 5   RKEKLQEELKKIISDILQR-EVKDPSVG--FVTVTSVDLSGDLRHAKVFVSILGEKENQQ 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
             +  L     FIR  +G+ +R LR+VPE+ F++D S++    +N L+    +    E
Sbjct: 62  DSLRGLEKATGFIRSELGKRVR-LRHVPEIVFKFDESIEHGDHINKLLKQMNLGEDNE 118


>gi|304404294|ref|ZP_07385956.1| ribosome-binding factor A [Paenibacillus curdlanolyticus YK9]
 gi|304347272|gb|EFM13104.1| ribosome-binding factor A [Paenibacillus curdlanolyticus YK9]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           R  RVGE+++  L  +I   E +D  I    I+++ V ++ DL  A VY+S+       +
Sbjct: 5   RVGRVGEQIKKELSQII-QTELKDPRIG--FITVTGVDVTNDLSQAKVYLSVLGSDEQKE 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             + A+     FIR  +G+ +R LR+ P L F++D S+    ++ AL+   
Sbjct: 62  ETLKAIARGTGFIRSELGKRMR-LRHTPVLLFKFDASIAYGSRIEALLEQI 111


>gi|291532982|emb|CBL06095.1| ribosome-binding factor A [Megamonas hypermegale ART12/1]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S R  +V E ++     +I+  E +D  I    ++I+EV +S DL  A +Y+S+    
Sbjct: 1   MGSVRIEKVQELIKQEASEIIMR-ELKDPRIG--FVTITEVDVSSDLHNAKLYVSILGSD 57

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              +     LN ++ FIR  +   +R L+++PE++F  DTSLQ    +  L+   K+   
Sbjct: 58  KQIEDTWKGLNSSLGFIRRELAHRIR-LKFIPEIKFFMDTSLQYSAHIQELL--IKVQKD 114

Query: 126 LEK 128
            E+
Sbjct: 115 EEQ 117


>gi|300897931|ref|ZP_07116310.1| ribosome-binding factor A [Escherichia coli MS 198-1]
 gi|301022022|ref|ZP_07185965.1| ribosome-binding factor A [Escherichia coli MS 69-1]
 gi|284923191|emb|CBG36285.1| ribosome-binding factor A [Escherichia coli 042]
 gi|300358361|gb|EFJ74231.1| ribosome-binding factor A [Escherichia coli MS 198-1]
 gi|300397737|gb|EFJ81275.1| ribosome-binding factor A [Escherichia coli MS 69-1]
          Length = 143

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A VY++   
Sbjct: 11  MAKEFGRPQRVAQEMQKEIALILQR-EIKDPRL-GMMTTVSGVEMSRDLAYAKVYVTFLN 68

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 69  DKDEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 126

Query: 122 IPVALEK 128
           +    E+
Sbjct: 127 VKHDEER 133


>gi|149925036|ref|ZP_01913354.1| ribosome-binding factor A [Plesiocystis pacifica SIR-1]
 gi|149814100|gb|EDM73726.1| ribosome-binding factor A [Plesiocystis pacifica SIR-1]
          Length = 153

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 65/121 (53%), Gaps = 3/121 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDV-ISISEVCMSVDLRVATVYISLPLDV- 66
           SRR  RV E +R  +  ++L  E +D  +     +S++ V +S DL VAT+Y+ +  +  
Sbjct: 2   SRRRQRVEELLRREMAQMLLRGELRDPRLQPASAVSVTGVSVSPDLSVATIYVDVLTEAL 61

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             + V++AL      IR ++G  +  LR  PELRF +D S++   ++ A++   +    L
Sbjct: 62  RLESVLAALRAGGGAIRRKLGERV-QLRRTPELRFHHDDSIERGNRVEAILTELRDAGEL 120

Query: 127 E 127
           +
Sbjct: 121 D 121


>gi|325266651|ref|ZP_08133328.1| ribosome-binding factor A [Kingella denitrificans ATCC 33394]
 gi|324982094|gb|EGC17729.1| ribosome-binding factor A [Kingella denitrificans ATCC 33394]
          Length = 123

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 51/124 (41%), Gaps = 5/124 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK        R  RV E+V   L   ++  E +D       I+I++V +S D   ATVY 
Sbjct: 1   MKKPQRNGYARIDRVKEQVMRELAE-LVRTELKDPRAG--FITINDVEVSRDYSHATVYY 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++           AL     F+R  + R +   R  PEL F YD SL+    L+ L+   
Sbjct: 58  TVLNGDRAASAQ-ALEKAKGFLRSELSRRITVFR-TPELHFEYDESLERGVNLSQLIDQA 115

Query: 121 KIPV 124
               
Sbjct: 116 AAEK 119


>gi|284035918|ref|YP_003385848.1| ribosome-binding factor A [Spirosoma linguale DSM 74]
 gi|283815211|gb|ADB37049.1| ribosome-binding factor A [Spirosoma linguale DSM 74]
          Length = 126

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 55/118 (46%), Gaps = 3/118 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R  +V  +++  L  +   +     L +   I+++ V +S DL VA VY+S     
Sbjct: 1   MESKRQQKVSRQLQKDLSEIFQRDVPH--LFNGAFITVTSVRISPDLSVARVYLSFLATK 58

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           +   ++  +    K +R  +G  +R+ LR VPEL F  D +     K++ L     IP
Sbjct: 59  NKQLLLETIQEKGKVLRQHLGDRVRHQLRIVPELHFFLDDTADYADKMDKLFSGLDIP 116


>gi|56963991|ref|YP_175722.1| ribosome-binding factor A [Bacillus clausii KSM-K16]
 gi|61214762|sp|Q5WFU4|RBFA_BACSK RecName: Full=Ribosome-binding factor A
 gi|56910234|dbj|BAD64761.1| ribosome-binding factor A [Bacillus clausii KSM-K16]
          Length = 118

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 63/115 (54%), Gaps = 5/115 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + RA+RVGE+++  L  +++  + +D  +    ++++ V ++ DL+ AT +I++  D 
Sbjct: 1   MANNRAVRVGEQMKKELSDILIR-DIKDPRVR--FVTVTGVDVTGDLQQATAFITVLGDE 57

Query: 67  SPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              +   A L     FIR  +G+ +R LR  PEL F +D S+Q   ++ +L+   
Sbjct: 58  EERKATLAGLEKAKGFIRTELGKRIR-LRKTPELSFSFDESIQYGNRIESLLRDL 111


>gi|323692924|ref|ZP_08107146.1| ribosome-binding factor A [Clostridium symbiosum WAL-14673]
 gi|323503007|gb|EGB18847.1| ribosome-binding factor A [Clostridium symbiosum WAL-14673]
          Length = 139

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 4/116 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I   E +D  I   + ++  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRINSEVQKELSEIISR-ELKDPRIH-PMTTVVSVEVTPDLKFCKAYISVLG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                   +  L     FIR ++ + + NLR  PEL F  D S++    +  L+  
Sbjct: 59  SEEAGKDTVQGLKSAASFIRTQLAKRI-NLRNTPELSFILDQSIEYGVNMTRLINE 113


>gi|157692348|ref|YP_001486810.1| ribosome-binding factor A [Bacillus pumilus SAFR-032]
 gi|166918673|sp|A8FDD3|RBFA_BACP2 RecName: Full=Ribosome-binding factor A
 gi|157681106|gb|ABV62250.1| ribosome-binding factor A [Bacillus pumilus SAFR-032]
          Length = 116

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 61/113 (53%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S RA RVGE+++  L  ++   + +D  I    +++++V +S DL++A VYIS+  D   
Sbjct: 2   SMRATRVGEQMKKELGDILGR-KLKDPRIG--FLTVTDVEVSGDLQIAKVYISVLGDEKK 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +  +  L     +IR  IG  +R LR  PEL F +D S+    ++ +L+   
Sbjct: 59  REETLKGLAKAKGYIRSEIGNRIR-LRKTPELHFEFDESVDYGNRIESLIAEL 110


>gi|161551797|ref|YP_147118.2| ribosome-binding factor A [Geobacillus kaustophilus HTA426]
 gi|61214671|sp|Q5L0I6|RBFA_GEOKA RecName: Full=Ribosome-binding factor A
          Length = 127

 Score =  109 bits (273), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 60/113 (53%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           + RA RVGE+++  L  +I     +D  I    +++++V ++ DL+ A VYIS+  D   
Sbjct: 2   NIRATRVGEQMKKELSDIISRR-LKDPRIG--FVTVTDVRVTGDLQQAKVYISVLGDDKQ 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +  + AL     FIR  IG+ +R LR  PE+ F  D +++   ++  L+   
Sbjct: 59  RENTLKALEKAKGFIRSEIGQRIR-LRKTPEIFFEIDETMEYGSRIEQLIRQI 110


>gi|138894785|ref|YP_001125238.1| ribosome-binding factor A [Geobacillus thermodenitrificans NG80-2]
 gi|196247591|ref|ZP_03146293.1| ribosome-binding factor A [Geobacillus sp. G11MC16]
 gi|166218441|sp|A4IMD9|RBFA_GEOTN RecName: Full=Ribosome-binding factor A
 gi|134266298|gb|ABO66493.1| Ribosome-binding factor A [Geobacillus thermodenitrificans NG80-2]
 gi|196212375|gb|EDY07132.1| ribosome-binding factor A [Geobacillus sp. G11MC16]
          Length = 128

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 64/123 (52%), Gaps = 7/123 (5%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           + RA RVGE+++  L  +I   + +D  I    +++++V ++ DL+ A VYIS+  D   
Sbjct: 2   NIRATRVGEQMKKELSDIIGR-KLKDPRIG--FVTVTDVRVTGDLQQAKVYISVFGDDEQ 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC--LPKIPVA 125
            +  + AL     FIR  IG+ +R LR  PE+ F  D +++   ++  L+     +    
Sbjct: 59  RENTLKALEKAKGFIRSEIGQRIR-LRKTPEILFEIDETIEYGSRIERLIRQISDEDGRD 117

Query: 126 LEK 128
            E+
Sbjct: 118 SEE 120


>gi|218133593|ref|ZP_03462397.1| hypothetical protein BACPEC_01462 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990968|gb|EEC56974.1| hypothetical protein BACPEC_01462 [Bacteroides pectinophilus ATCC
           43243]
          Length = 136

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 61/120 (50%), Gaps = 4/120 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+N   KNS +  R+  EV+  L  +I  NE +D  I   + S+  V ++ DL+    YI
Sbjct: 1   MENDMRKNSIKNTRINGEVQRELSNIIH-NEIKDPRIH-PMTSVVTVEVAPDLKTCKAYI 58

Query: 61  SLPLDVSPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           S+  D    +  I+ L     +IR  +  ++ NLR  PE+RF  D S++   +++ L+  
Sbjct: 59  SVLGDEKAQQDTIAGLKSAEGYIRRELAHTV-NLRNTPEIRFILDQSIEYGVRMSRLIDE 117


>gi|320355001|ref|YP_004196340.1| ribosome-binding factor A [Desulfobulbus propionicus DSM 2032]
 gi|320123503|gb|ADW19049.1| ribosome-binding factor A [Desulfobulbus propionicus DSM 2032]
          Length = 131

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 59/124 (47%), Gaps = 4/124 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
               S R  RV E +++ L  ++L  +  D  +S  ++S   V ++ DL+ A VY ++P 
Sbjct: 11  GRPESSRPKRVAEAIKNELT-ILLLQQVADPRLSGVLVS--RVVVTPDLKQAKVYFTVPA 67

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                  +  ++    F R  + ++L NLRY PEL F YD   +   ++++L    +   
Sbjct: 68  GKDSGPALKGMHRAKGFFRSHLAKTL-NLRYTPELLFYYDNLNEEAERIDSLFRQIEDER 126

Query: 125 ALEK 128
             E+
Sbjct: 127 KHEQ 130


>gi|317129160|ref|YP_004095442.1| ribosome-binding factor A [Bacillus cellulosilyticus DSM 2522]
 gi|315474108|gb|ADU30711.1| ribosome-binding factor A [Bacillus cellulosilyticus DSM 2522]
          Length = 116

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 62/115 (53%), Gaps = 5/115 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA RVGE+++  +  +I   E +D  +    I+++ V ++ DL+ AT +I++  D 
Sbjct: 1   MSNVRANRVGEQIKKEITEIIQR-EIKDPRVG--FITVTAVDVTGDLQQATAFITVYGDD 57

Query: 67  SPD-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 ++AL     FIR  IG+ +  LR  P+L F++D S++   ++  L+   
Sbjct: 58  DQRSNTLAALEKAKGFIRSEIGKRI-QLRKTPDLSFKFDESIERGNRIEELLRKL 111


>gi|319649518|ref|ZP_08003674.1| ribosome-binding factor A [Bacillus sp. 2_A_57_CT2]
 gi|317398680|gb|EFV79362.1| ribosome-binding factor A [Bacillus sp. 2_A_57_CT2]
          Length = 126

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 62/113 (54%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S RA RVGE+++  L  +I   + +D  +    +++++V ++ DL+ ATV+IS+  D   
Sbjct: 2   SLRANRVGEQMKKELGEIIGR-KIKDPRVG--FVTVTDVQVTGDLQQATVFISVLGDEEQ 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +  +  L     FIR  IG+ +R LR  PE+ F +D S+    ++ +L+   
Sbjct: 59  RENTLRGLAKAKGFIRSEIGQRIR-LRKTPEILFEFDESIDYGNRIESLLHQI 110


>gi|215488485|ref|YP_002330916.1| ribosome-binding factor A [Escherichia coli O127:H6 str. E2348/69]
 gi|312968494|ref|ZP_07782703.1| ribosome-binding factor A [Escherichia coli 2362-75]
 gi|254789748|sp|B7UJ62|RBFA_ECO27 RecName: Full=Ribosome-binding factor A
 gi|215266557|emb|CAS10996.1| 30s ribosome binding factor RbfA [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312286712|gb|EFR14623.1| ribosome-binding factor A [Escherichia coli 2362-75]
          Length = 133

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A VY++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIALILQR-EIKDPRL-GMMTTVSGVEMSRDLAYAKVYVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|241760044|ref|ZP_04758142.1| ribosome-binding factor A [Neisseria flavescens SK114]
 gi|261364591|ref|ZP_05977474.1| ribosome-binding factor A [Neisseria mucosa ATCC 25996]
 gi|261381125|ref|ZP_05985698.1| ribosome-binding factor A [Neisseria subflava NJ9703]
 gi|319637963|ref|ZP_07992729.1| ribosome-binding factor A [Neisseria mucosa C102]
 gi|241319498|gb|EER55928.1| ribosome-binding factor A [Neisseria flavescens SK114]
 gi|284795927|gb|EFC51274.1| ribosome-binding factor A [Neisseria subflava NJ9703]
 gi|288567175|gb|EFC88735.1| ribosome-binding factor A [Neisseria mucosa ATCC 25996]
 gi|317401118|gb|EFV81773.1| ribosome-binding factor A [Neisseria mucosa C102]
          Length = 123

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+I+EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITINEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++  D + D    AL      +R  + + ++  +  PEL F+YD SL+    +++L+   
Sbjct: 57  TVLDDSTRDITEEALEHAKGHLRSELAKRIKLFK-TPELHFKYDESLERGMSISSLIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|194014192|ref|ZP_03052809.1| ribosome-binding factor A [Bacillus pumilus ATCC 7061]
 gi|194013218|gb|EDW22783.1| ribosome-binding factor A [Bacillus pumilus ATCC 7061]
          Length = 116

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 61/113 (53%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S RA RVGE+++  L  ++   + +D  I    +++++V ++ DL++A VYIS+  D   
Sbjct: 2   SMRATRVGEQMKKELGDILGR-KLKDPRIG--FLTVTDVEVTGDLQIAKVYISVLGDEKK 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +  +  L     +IR  IG  +R LR  PEL F +D S+    ++ +L+   
Sbjct: 59  REETLKGLAKAKGYIRSEIGNRIR-LRKTPELHFEFDESVDYGNRIESLIAEL 110


>gi|71908069|ref|YP_285656.1| ribosome-binding factor A [Dechloromonas aromatica RCB]
 gi|123627144|sp|Q47D95|RBFA_DECAR RecName: Full=Ribosome-binding factor A
 gi|71847690|gb|AAZ47186.1| ribosome-binding factor A [Dechloromonas aromatica RCB]
          Length = 123

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 7/125 (5%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK K     +R+ RV E+VR  L   ++  E +D  +   +IS++ V ++ D   A V+ 
Sbjct: 1   MKKKG---FQRSDRVAEQVRRDLAD-LIRTELKDPRVG--MISLTAVELTPDYAHAKVFF 54

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +       + V   L     F+R  +G+ + ++  +PEL F YD+S++    L+ L+   
Sbjct: 55  ATLNSEHLEEVERGLKRAAGFLRRELGKRI-HIHTLPELHFVYDSSIERGASLSLLIDQA 113

Query: 121 KIPVA 125
                
Sbjct: 114 NALSD 118


>gi|271499175|ref|YP_003332200.1| ribosome-binding factor A [Dickeya dadantii Ech586]
 gi|270342730|gb|ACZ75495.1| ribosome-binding factor A [Dickeya dadantii Ech586]
          Length = 133

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 65/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +I+  E +D  +   + ++S V +S DL  A V+++   
Sbjct: 1   MAKEFSRTQRVAQEMQKEIA-IIIQREVKDPRVG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D  P++V     AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 58  DNEPEQVKAGVKALQDASGFIRMLLGKAMR-LRVVPELTFSYDNSLVEGMRMSNLVTRV- 115

Query: 122 IPVALEK 128
           +    E+
Sbjct: 116 VKRDAER 122


>gi|237798564|ref|ZP_04587025.1| ribosome-binding factor A [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331021417|gb|EGI01474.1| ribosome-binding factor A [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 138

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITAVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             + + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDNAEDIAQTIKVLNSAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|320540178|ref|ZP_08039833.1| 30s ribosome binding factor [Serratia symbiotica str. Tucson]
 gi|320029844|gb|EFW11868.1| 30s ribosome binding factor [Serratia symbiotica str. Tucson]
          Length = 136

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 64/131 (48%), Gaps = 12/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R+ RV +E++  +  +IL  E +D  I   + ++S V +S DL  A VY++   
Sbjct: 1   MAKEFSRSQRVAQEMQKEIA-IILQREIKDPRIG--MATVSGVEISRDLAYAKVYVTFLN 57

Query: 65  DVSPDRVIS-------ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
            ++ +           AL     +IR  +G+++R LR VPEL F YD SL    +++ L+
Sbjct: 58  VLAENHDPDQVTNGIKALQDAAGYIRTLLGKAMR-LRVVPELTFVYDNSLVEGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               +    E+
Sbjct: 117 -TNVVKNDAER 126


>gi|323485576|ref|ZP_08090920.1| hypothetical protein HMPREF9474_02671 [Clostridium symbiosum
           WAL-14163]
 gi|323401094|gb|EGA93448.1| hypothetical protein HMPREF9474_02671 [Clostridium symbiosum
           WAL-14163]
          Length = 139

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 52/116 (44%), Gaps = 4/116 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I   E +D  I   + ++  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRINSEVQKELSEIISR-ELKDPRIH-PMTTVVSVEVTPDLKFCKAYISVLG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                   +  L     FIR ++ + + NLR  PEL F  D S++    +  L+  
Sbjct: 59  SEEAGKDTVQGLKSAASFIRTQLAKRI-NLRNTPELSFILDQSIEYGVNMTRLINE 113


>gi|255066483|ref|ZP_05318338.1| ribosome-binding factor A [Neisseria sicca ATCC 29256]
 gi|255049363|gb|EET44827.1| ribosome-binding factor A [Neisseria sicca ATCC 29256]
          Length = 123

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+I+EV ++ D   ATV+ 
Sbjct: 1   MRKLQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITINEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++  D + D    AL      +R  + + ++  +  PEL F+YD SL+    +++L+   
Sbjct: 57  TVLDDSTRDITEEALEHAKGHLRSELAKRIKLFK-TPELHFKYDESLERGMSISSLIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|329119691|ref|ZP_08248372.1| ribosome-binding factor A [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464288|gb|EGF10592.1| ribosome-binding factor A [Neisseria bacilliformis ATCC BAA-1200]
          Length = 123

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 4/125 (3%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           NK  +   R  RV E++   L  + +    +D       I+I+EV +S D   AT+Y ++
Sbjct: 2   NKTRRGYARQDRVKEQIMRELAEM-VRTGLKDPRAG--FITINEVDVSRDYSHATIYYTV 58

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             D + D   +AL      +R  + + ++  +  PEL F+YD SL+    ++ L+     
Sbjct: 59  LDDSTRDITEAALEHAKGHLRSELAKRIKLFK-TPELHFKYDQSLERGMSISHLIEQVAA 117

Query: 123 PVALE 127
              +E
Sbjct: 118 EKPVE 122


>gi|297584083|ref|YP_003699863.1| ribosome-binding factor A [Bacillus selenitireducens MLS10]
 gi|297142540|gb|ADH99297.1| ribosome-binding factor A [Bacillus selenitireducens MLS10]
          Length = 115

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 62/115 (53%), Gaps = 5/115 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           RA RVGE+++  L  +I     +D  I    ++++ V ++ DL+ AT ++++  D    +
Sbjct: 5   RANRVGEQIKKELTDIIQRG-IKDPRIG--FVTVTAVDVTGDLQQATAFVTVYGDDDERE 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
           + + AL     +IR  IG+ ++ LR  PEL F++D S++   +++ L+       
Sbjct: 62  KSLLALEKANGYIRSEIGKRIK-LRKTPELDFKFDESIERGNRIDELLRNLNKEE 115


>gi|89895262|ref|YP_518749.1| hypothetical protein DSY2516 [Desulfitobacterium hafniense Y51]
 gi|219669693|ref|YP_002460128.1| ribosome-binding factor A [Desulfitobacterium hafniense DCB-2]
 gi|122482377|sp|Q24UI7|RBFA_DESHY RecName: Full=Ribosome-binding factor A
 gi|254789746|sp|B8FR05|RBFA_DESHD RecName: Full=Ribosome-binding factor A
 gi|89334710|dbj|BAE84305.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219539953|gb|ACL21692.1| ribosome-binding factor A [Desulfitobacterium hafniense DCB-2]
          Length = 125

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 61/120 (50%), Gaps = 5/120 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VSP 68
            R+ R+ E ++  +   ++  E +D  I    ++++ V ++ DL  A VY+S+  D    
Sbjct: 4   HRSNRLAETLKQEISQ-LIREELKDPRIG--FVTVTSVEVADDLGNAKVYVSVLGDSQQA 60

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
              + AL     F+R  IG+ +R LR+ PE+ F+YDTS++    +  L+   K     ++
Sbjct: 61  KDSLDALKRAAGFVRSEIGKRVR-LRHAPEIVFKYDTSIEHGAHIAQLLRGVKQEEEKDE 119


>gi|182676604|sp|A7Z4T6|RBFA_BACA2 RecName: Full=Ribosome-binding factor A
 gi|328553440|gb|AEB23932.1| ribosome-binding factor A [Bacillus amyloliquefaciens TA208]
          Length = 117

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 61/113 (53%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVS 67
           S RA RVGE+++  L  +I   + +D  I    +++++V +S DL++A VYIS+   +  
Sbjct: 2   SMRANRVGEQMKKELGDIISR-KLKDPRIG--FLTVTDVRVSGDLQIAKVYISVLGGEKK 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +  +  L     FIR  IG  +R LR  PEL F +D S++   ++  L+   
Sbjct: 59  KEEALKGLEKAKGFIRSEIGSRIR-LRKTPELEFEFDESIEYGNRIETLIHEL 110


>gi|121587846|ref|ZP_01677603.1| ribosome-binding factor A [Vibrio cholerae 2740-80]
 gi|121728384|ref|ZP_01681412.1| ribosome-binding factor A [Vibrio cholerae V52]
 gi|147673152|ref|YP_001216138.1| ribosome-binding factor A [Vibrio cholerae O395]
 gi|153215853|ref|ZP_01950185.1| ribosome-binding factor A [Vibrio cholerae 1587]
 gi|153802002|ref|ZP_01956588.1| ribosome-binding factor A [Vibrio cholerae MZO-3]
 gi|153818692|ref|ZP_01971359.1| ribosome-binding factor A [Vibrio cholerae NCTC 8457]
 gi|153822541|ref|ZP_01975208.1| ribosome-binding factor A [Vibrio cholerae B33]
 gi|153826508|ref|ZP_01979175.1| ribosome-binding factor A [Vibrio cholerae MZO-2]
 gi|153829183|ref|ZP_01981850.1| ribosome-binding factor A [Vibrio cholerae 623-39]
 gi|227080825|ref|YP_002809376.1| ribosome-binding factor A [Vibrio cholerae M66-2]
 gi|229505734|ref|ZP_04395244.1| ribosome-binding factor A [Vibrio cholerae BX 330286]
 gi|229509233|ref|ZP_04398718.1| ribosome-binding factor A [Vibrio cholerae B33]
 gi|229512906|ref|ZP_04402373.1| ribosome-binding factor A [Vibrio cholerae TMA 21]
 gi|229530449|ref|ZP_04419837.1| ribosome-binding factor A [Vibrio cholerae 12129(1)]
 gi|229608845|ref|YP_002879493.1| ribosome-binding factor A [Vibrio cholerae MJ-1236]
 gi|254226549|ref|ZP_04920132.1| ribosome-binding factor A [Vibrio cholerae V51]
 gi|254291883|ref|ZP_04962665.1| ribosome-binding factor A [Vibrio cholerae AM-19226]
 gi|254850878|ref|ZP_05240228.1| ribosome-binding factor A [Vibrio cholerae MO10]
 gi|297580770|ref|ZP_06942696.1| ribosome-binding factor A [Vibrio cholerae RC385]
 gi|298500760|ref|ZP_07010563.1| ribosome-binding factor A [Vibrio cholerae MAK 757]
 gi|9655080|gb|AAF93810.1| ribosome-binding factor A [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121547882|gb|EAX57966.1| ribosome-binding factor A [Vibrio cholerae 2740-80]
 gi|121629318|gb|EAX61750.1| ribosome-binding factor A [Vibrio cholerae V52]
 gi|124114570|gb|EAY33390.1| ribosome-binding factor A [Vibrio cholerae 1587]
 gi|124122461|gb|EAY41204.1| ribosome-binding factor A [Vibrio cholerae MZO-3]
 gi|125620953|gb|EAZ49304.1| ribosome-binding factor A [Vibrio cholerae V51]
 gi|126510772|gb|EAZ73366.1| ribosome-binding factor A [Vibrio cholerae NCTC 8457]
 gi|126519959|gb|EAZ77182.1| ribosome-binding factor A [Vibrio cholerae B33]
 gi|146315035|gb|ABQ19574.1| ribosome-binding factor A [Vibrio cholerae O395]
 gi|148875372|gb|EDL73507.1| ribosome-binding factor A [Vibrio cholerae 623-39]
 gi|149739688|gb|EDM53895.1| ribosome-binding factor A [Vibrio cholerae MZO-2]
 gi|150422169|gb|EDN14134.1| ribosome-binding factor A [Vibrio cholerae AM-19226]
 gi|227008713|gb|ACP04925.1| ribosome-binding factor A [Vibrio cholerae M66-2]
 gi|227012469|gb|ACP08679.1| ribosome-binding factor A [Vibrio cholerae O395]
 gi|229332222|gb|EEN97710.1| ribosome-binding factor A [Vibrio cholerae 12129(1)]
 gi|229350155|gb|EEO15108.1| ribosome-binding factor A [Vibrio cholerae TMA 21]
 gi|229353805|gb|EEO18741.1| ribosome-binding factor A [Vibrio cholerae B33]
 gi|229357957|gb|EEO22874.1| ribosome-binding factor A [Vibrio cholerae BX 330286]
 gi|229371500|gb|ACQ61923.1| ribosome-binding factor A [Vibrio cholerae MJ-1236]
 gi|254846583|gb|EET24997.1| ribosome-binding factor A [Vibrio cholerae MO10]
 gi|297535186|gb|EFH74021.1| ribosome-binding factor A [Vibrio cholerae RC385]
 gi|297540541|gb|EFH76599.1| ribosome-binding factor A [Vibrio cholerae MAK 757]
          Length = 136

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/130 (27%), Positives = 68/130 (52%), Gaps = 10/130 (7%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+N  PK   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V++
Sbjct: 1   MRNDMPKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFV 57

Query: 61  SLP--LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL-- 116
           +     + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L  
Sbjct: 58  TFLCIGEQTPESCLAALREHEVQIRMMLGKQIR-LRLTPEIRFYYDNTLVEGMRMSNLVT 116

Query: 117 --MCLPKIPV 124
             +   K   
Sbjct: 117 EVINSDKRRK 126


>gi|330813315|ref|YP_004357554.1| translation initiation factor 2 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486410|gb|AEA80815.1| translation initiation factor 2 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 125

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 55/118 (46%), Gaps = 1/118 (0%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           N +   ++R L+ GE ++  +  + + ++     IS   I+I+EV +S DLR A VY   
Sbjct: 5   NTSKPLTQRQLKAGENLKKIIANIFIKDQIVLPDISTRNITITEVRVSPDLRHAIVYFIP 64

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 +     LN     ++ R+ +S  + +++P+LRF  D S      +  L+   
Sbjct: 65  LSGDKSEIAFKTLNQFSYEVKKRV-KSSWSAKFLPDLRFVLDKSFDYAENIEKLISTN 121


>gi|238020387|ref|ZP_04600813.1| hypothetical protein GCWU000324_00267 [Kingella oralis ATCC 51147]
 gi|237867367|gb|EEP68373.1| hypothetical protein GCWU000324_00267 [Kingella oralis ATCC 51147]
          Length = 125

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 5/126 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK +      R  RV E++   L   ++  E +D      +I+I++V ++ D   ATVY 
Sbjct: 1   MKKQQRNGYARVDRVKEQIMRELAE-LVRTELKDPRAG--LITINDVEVTRDYSHATVYY 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++           AL     F+R ++ R +   R VPEL F YD SL+    L+ L+   
Sbjct: 58  TVLNGDRAASA-EALEHAKGFLRSKLSRRITVFR-VPELHFEYDHSLERGMTLSHLIEQA 115

Query: 121 KIPVAL 126
                +
Sbjct: 116 AAEPDV 121


>gi|229544438|ref|ZP_04433496.1| ribosome-binding factor A [Bacillus coagulans 36D1]
 gi|229324923|gb|EEN90600.1| ribosome-binding factor A [Bacillus coagulans 36D1]
          Length = 115

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 31/111 (27%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SPD 69
           RA RVGE+++  L  +I   + +D  +    +++++V ++ DL+ A VY+++  D     
Sbjct: 4   RANRVGEQMKKELSDIIGR-KLKDPRVG--FVTVTDVEVTGDLQQAKVYLTVLGDEVQKK 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  L     FIR  +G+ +R LR  PEL F  D S++   ++  L+   
Sbjct: 61  DTLDGLEKAKGFIRSEVGKRIR-LRKTPELIFEIDESIEYGNRIETLIKKI 110


>gi|77919157|ref|YP_356972.1| ribosome-binding factor A [Pelobacter carbinolicus DSM 2380]
 gi|123574181|sp|Q3A4A5|RBFA_PELCD RecName: Full=Ribosome-binding factor A
 gi|77545240|gb|ABA88802.1| ribosome-binding factor A [Pelobacter carbinolicus DSM 2380]
          Length = 119

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 57/111 (51%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           R  RVGE+++  +  ++L    +D  +    ++I+ V ++ D+ +A VY ++  +     
Sbjct: 5   RPHRVGEQLQKEISALLLKG-LKDPRVG--FVTITAVSVTPDMHLARVYYTVYGEEEQRK 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                L     F R  +GR LR +RYVP+L F +D +L+   ++ +L+   
Sbjct: 62  ETQKGLESATPFFRRELGRRLR-MRYVPDLVFEFDKALEYGNRIESLLRQL 111


>gi|332976851|gb|EGK13676.1| ribosome-binding factor A [Desmospora sp. 8437]
          Length = 119

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/118 (31%), Positives = 63/118 (53%), Gaps = 7/118 (5%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            RA RVGE+V+  L +V+  +E +D  +    ++++ V MS DL+ A VYIS+  D    
Sbjct: 4   IRASRVGEQVKKELSYVL-QHEMKDPRVG--FVTVTAVEMSGDLQQAKVYISVLGDEEKK 60

Query: 70  -RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
              +  L     F+R  IGR +  LR+ PEL F++D S++    ++ L+   ++    
Sbjct: 61  KETLEGLEKAKGFLRTEIGRRV-QLRHTPELIFKFDESIEHGQHISKLL--EEVNRNE 115


>gi|293393152|ref|ZP_06637467.1| ribosome-binding factor A [Serratia odorifera DSM 4582]
 gi|291424298|gb|EFE97512.1| ribosome-binding factor A [Serratia odorifera DSM 4582]
          Length = 136

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 63/131 (48%), Gaps = 12/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V +S DL  A VY++   
Sbjct: 1   MAKEFSRGQRVAQEMQKEIA-IILQREVKDPRVG--MATVSGVEVSRDLAYAKVYVTFLN 57

Query: 65  DVSPDRVIS-------ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
            ++ +           AL     +IR  +G+++R LR VPEL F YD SL    +++ L+
Sbjct: 58  VLTENHDPDLVTNGIKALQDASGYIRTLLGKAMR-LRVVPELTFAYDNSLVEGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               +    E+
Sbjct: 117 TNV-VKNDAER 126


>gi|158336219|ref|YP_001517393.1| ribosome-binding factor A [Acaryochloris marina MBIC11017]
 gi|189039525|sp|B0CDK8|RBFA_ACAM1 RecName: Full=Ribosome-binding factor A
 gi|158306460|gb|ABW28077.1| ribosome-binding factor A [Acaryochloris marina MBIC11017]
          Length = 138

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           RR  RV E ++  +  ++L +  +D  +   +IS++ V +S DL+ A +++S+       
Sbjct: 5   RRVSRVAELIKREVSQMLL-HSIKDDRVGSGMISVTAVDLSGDLQHAKIFVSIYGTDEAR 63

Query: 70  -RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
              ++ L     ++R ++G  + +LR  PE+ F  D S +   ++ +L+       
Sbjct: 64  AETMAGLESATGYVRKQLGHRI-HLRRTPEVIFCEDRSFEEGNQVLSLLHKLDHER 118


>gi|70734338|ref|YP_257978.1| ribosome-binding factor A [Pseudomonas fluorescens Pf-5]
 gi|123658131|sp|Q4KIF5|RBFA_PSEF5 RecName: Full=Ribosome-binding factor A
 gi|68348637|gb|AAY96243.1| ribosome-binding factor A [Pseudomonas fluorescens Pf-5]
          Length = 133

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 64/124 (51%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A ++I++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREVKDPRVG--LVTITAVEVSRDVGHAKIFITVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             + +++   I  LN    F+R ++ + ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QENAEQIAQSIKVLNSAAGFLRMQLAKEMK-LRSVPQLHFHYDESVARGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|229520935|ref|ZP_04410357.1| ribosome-binding factor A [Vibrio cholerae TM 11079-80]
 gi|229342168|gb|EEO07164.1| ribosome-binding factor A [Vibrio cholerae TM 11079-80]
          Length = 136

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/130 (27%), Positives = 68/130 (52%), Gaps = 10/130 (7%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+N  PK   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V++
Sbjct: 1   MRNDMPKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFV 57

Query: 61  SLP--LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL-- 116
           +     + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L  
Sbjct: 58  TFLCIGEQTPESCLAALREHEVQIRMMLGKQIR-LRLTPEIRFYYDNTLVEGMRMSNLVT 116

Query: 117 --MCLPKIPV 124
             +   K   
Sbjct: 117 EVINSDKRRK 126


>gi|329295927|ref|ZP_08253263.1| ribosome-binding factor A [Plautia stali symbiont]
          Length = 135

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 65/127 (51%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   ++++S V +S DL  A V+++   
Sbjct: 1   MAKEFGRPQRVAQELQKEIA-IILQREIKDPRL-GMMVTVSGVEVSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   + V +   AL     +IR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DQDEEAVKNGLKALKEASGYIRILLGKAMR-LRIVPELTFFYDNSLIEGMRMSNLVSDV- 116

Query: 122 IPVALEK 128
           I    E+
Sbjct: 117 IRNDAER 123


>gi|310641597|ref|YP_003946355.1| ribosome-binding factor a [Paenibacillus polymyxa SC2]
 gi|309246547|gb|ADO56114.1| Ribosome-binding factor A [Paenibacillus polymyxa SC2]
          Length = 116

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 59/113 (52%), Gaps = 5/113 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  RVGE+++  L  +++  E +D  I    I+++ V ++ DL  A VY+S+  D    
Sbjct: 4   IRTGRVGEQIKKELS-LLIQTELKDPRIG--FITVTGVDVTNDLSQAKVYLSVLGDEEQK 60

Query: 70  RVI-SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                AL+    ++R  +G+ +R LR++PEL F+ D S+    ++  L+    
Sbjct: 61  TSSLKALDKANGYLRSELGKRIR-LRHIPELIFKIDESIAYGSRIEKLLSDID 112


>gi|311744913|ref|ZP_07718698.1| ribosome-binding factor A [Algoriphagus sp. PR1]
 gi|126577416|gb|EAZ81636.1| ribosome-binding factor A [Algoriphagus sp. PR1]
          Length = 128

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 59/119 (49%), Gaps = 4/119 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R  +  + ++  +  +   +     L+ R +I+++ V +S DL +A VY+S  L  
Sbjct: 1   MESKRQQKYAKLIQKEIGDIFQKDAKH--LVGRAMITVTHVLVSPDLGLAKVYLSFLLA- 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSL-RNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
            P+     +N + K IR ++ + + +++R +PEL F  D S      +  ++   +IP 
Sbjct: 58  DPESTYKLINDHKKEIRHQLAKRIGKSVRVIPELAFFPDDSASYAQHIEKVISDLEIPK 116


>gi|307546726|ref|YP_003899205.1| ribosome-binding factor A [Halomonas elongata DSM 2581]
 gi|307218750|emb|CBV44020.1| ribosome-binding factor A [Halomonas elongata DSM 2581]
          Length = 139

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 70/125 (56%), Gaps = 8/125 (6%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           +  +R  RV ++++  L  V++  E +D  +   ++++S V +S DL  A V+++L  + 
Sbjct: 2   REFKRTDRVADQLQKELA-VLIQREIKDPRLG--MVTVSGVEVSRDLGYADVHVTLLGEQ 58

Query: 67  SPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
             +R+   ++ L     F+R +I R ++ LR+VPELRF YD S+    +L++L+    + 
Sbjct: 59  DAERIKENMAVLKRAAGFLRSQIARRIK-LRHVPELRFHYDESVVRGQRLSSLI-DEAVA 116

Query: 124 VALEK 128
              ++
Sbjct: 117 NDRDR 121


>gi|237706080|ref|ZP_04536561.1| ribosome-binding factor A [Escherichia sp. 3_2_53FAA]
 gi|254038333|ref|ZP_04872391.1| ribosome-binding factor A [Escherichia sp. 1_1_43]
 gi|293412542|ref|ZP_06655265.1| ribosome-binding factor A [Escherichia coli B354]
 gi|293416600|ref|ZP_06659239.1| ribosome-binding factor A [Escherichia coli B185]
 gi|332280002|ref|ZP_08392415.1| ribosome-binding factor A [Shigella sp. D9]
 gi|26110178|gb|AAN82364.1|AE016767_124 Ribosome-binding factor A [Escherichia coli CFT073]
 gi|91074162|gb|ABE09043.1| ribosome-binding factor A [Escherichia coli UTI89]
 gi|226839957|gb|EEH71978.1| ribosome-binding factor A [Escherichia sp. 1_1_43]
 gi|226899120|gb|EEH85379.1| ribosome-binding factor A [Escherichia sp. 3_2_53FAA]
 gi|291431956|gb|EFF04939.1| ribosome-binding factor A [Escherichia coli B185]
 gi|291469313|gb|EFF11804.1| ribosome-binding factor A [Escherichia coli B354]
 gi|332102354|gb|EGJ05700.1| ribosome-binding factor A [Shigella sp. D9]
          Length = 139

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A VY++   
Sbjct: 7   MAKEFGRPQRVAQEMQKEIALILQR-EIKDPRL-GMMTTVSGVEMSRDLAYAKVYVTFLN 64

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 65  DKDEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 122

Query: 122 IPVALEK 128
           +    E+
Sbjct: 123 VKHDEER 129


>gi|119898397|ref|YP_933610.1| ribosome-binding factor A [Azoarcus sp. BH72]
 gi|166218420|sp|A1K7B8|RBFA_AZOSB RecName: Full=Ribosome-binding factor A
 gi|119670810|emb|CAL94723.1| RbfA protein [Azoarcus sp. BH72]
          Length = 126

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 6/123 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI-SLP 63
            PK   R+ RV E++R  L   ++  E +D  +    I++++V +S D   A V+  S+ 
Sbjct: 1   MPKEYSRSQRVVEQIRRELAE-LIRLEVKDPRVG--FITLTDVEISPDYAHAKVFFTSMT 57

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
            + S   ++  L     F+R  +GR +R +   PEL F YD S++   +L+ L+    + 
Sbjct: 58  GEESVPEILQGLRRASGFLRRELGRRVR-IHTTPELHFHYDRSVEEGSRLSRLIDD-AVR 115

Query: 124 VAL 126
              
Sbjct: 116 EDE 118


>gi|327441009|dbj|BAK17374.1| ribosome-binding factor A [Solibacillus silvestris StLB046]
          Length = 114

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VS 67
           S R+ RV E+++  +  +I   + +D  +    +++++V ++ DL+ ATVYI+   +   
Sbjct: 2   SLRSNRVAEQMKKEITEIIAR-KIKDPRVG--FVTVTDVAVTGDLQQATVYITSLGNDRE 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
               + AL     FIR  +G  +R LR  PEL F +DT+++   K++AL+ 
Sbjct: 59  RAETLQALEKASGFIRSEVGSRIR-LRRTPELAFEFDTAIEYGNKIDALLR 108


>gi|317046742|ref|YP_004114390.1| ribosome-binding factor A [Pantoea sp. At-9b]
 gi|316948359|gb|ADU67834.1| ribosome-binding factor A [Pantoea sp. At-9b]
          Length = 135

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   ++++S V +S DL  A V+++   
Sbjct: 1   MAKEFGRPQRVSQELQKEIA-IILQREIKDPRL-GMMVTVSGVEVSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   + V +   AL     +IR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEEAVKNGLKALKEASGYIRTLVGKAMR-LRIVPELTFFYDNSLIEGMRMSNLVTNV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKNDAER 123


>gi|157368737|ref|YP_001476726.1| ribosome-binding factor A [Serratia proteamaculans 568]
 gi|166918678|sp|A8G908|RBFA_SERP5 RecName: Full=Ribosome-binding factor A
 gi|157320501|gb|ABV39598.1| ribosome-binding factor A [Serratia proteamaculans 568]
          Length = 136

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 64/131 (48%), Gaps = 12/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V +S DL  A VY++   
Sbjct: 1   MAKEFSRGQRVAQEMQKEIA-IILQREVKDPRVG--MATVSGVEVSRDLAYAKVYVTFLN 57

Query: 65  DVSPDRVIS-------ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
            ++ +   +       AL     +IR  +G+++R LR VPEL F YD SL    +++ L+
Sbjct: 58  VLTENADPNLVPNGIKALEDASGYIRTLLGKAMR-LRVVPELTFAYDNSLVEGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               +    E+
Sbjct: 117 -TNVVKNDAER 126


>gi|86607701|ref|YP_476463.1| ribosome-binding factor A [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|123504067|sp|Q2JPS6|RBFA_SYNJB RecName: Full=Ribosome-binding factor A
 gi|86556243|gb|ABD01200.1| ribosome-binding factor A [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 144

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 61/113 (53%), Gaps = 3/113 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           RR  RV E ++  +  ++L +E +D  +   ++SI +V +S DL+ A +++S+  D +  
Sbjct: 5   RRVARVAELIKREVSQILL-SEIKDDRVGAGMVSIVDVEVSNDLQNARIFVSIYGDETAQ 63

Query: 70  R-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
              +  L     F+R  IG+ L +LR VP + F  D SL+   ++ AL+   +
Sbjct: 64  HQAMEGLAAATPFVRREIGQRL-SLRRVPTVVFLQDRSLERGSRVLALLNQLR 115


>gi|331082954|ref|ZP_08332074.1| ribosome-binding factor A [Lachnospiraceae bacterium 6_1_63FAA]
 gi|330399949|gb|EGG79607.1| ribosome-binding factor A [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 128

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 60/128 (46%), Gaps = 8/128 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV  EV+  L   ++    +D  I   + S++ V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRVNAEVQHELAN-LIREGIKDPRIH-PMTSVTAVEVAPDLKTCRAYISVMG 58

Query: 65  DVSPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL---- 119
           +       I+ L     +IR ++ +++ NLR  PE+RF  D S++    ++ L+      
Sbjct: 59  NEEAKNNTIAGLKSAEGYIRRQLAKNI-NLRNTPEIRFILDESIEYGVAMSKLIDEVTGK 117

Query: 120 PKIPVALE 127
            ++    E
Sbjct: 118 EEVQEDGE 125


>gi|255655323|ref|ZP_05400732.1| ribosome-binding factor A [Clostridium difficile QCD-23m63]
 gi|296451308|ref|ZP_06893048.1| ribosome-binding factor A [Clostridium difficile NAP08]
 gi|296880340|ref|ZP_06904303.1| ribosome-binding factor A [Clostridium difficile NAP07]
 gi|296259914|gb|EFH06769.1| ribosome-binding factor A [Clostridium difficile NAP08]
 gi|296428581|gb|EFH14465.1| ribosome-binding factor A [Clostridium difficile NAP07]
          Length = 126

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 64/110 (58%), Gaps = 4/110 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  R+ EE+R  +  +++N   +D  I   ++S+++V ++ DLR A VY+S+      +
Sbjct: 5   NRTRRISEEIRKVVSTMLING-VKDPRI-TSMVSVTDVEVTNDLRYAYVYVSILGG-DEE 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
             ++ L     +IR  +G++++ LRY+PE+ F+ D S++    +++L+  
Sbjct: 62  STLTGLKSAGGYIRREVGKNIK-LRYIPEIVFKIDDSIEKGMYMDSLIKR 110


>gi|156935693|ref|YP_001439609.1| ribosome-binding factor A [Cronobacter sakazakii ATCC BAA-894]
 gi|156533947|gb|ABU78773.1| hypothetical protein ESA_03560 [Cronobacter sakazakii ATCC BAA-894]
          Length = 150

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V +S DL  A V+++   
Sbjct: 18  MAKEFGRPQRVAQEMQKEIA-IILQREIKDPRV-GLMTTVSGVEVSRDLAYAKVFVTFLN 75

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 76  DKDEAAVKAGIKALQDASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 133

Query: 122 IPVALEK 128
           +    E+
Sbjct: 134 VKHDEER 140


>gi|239826659|ref|YP_002949283.1| ribosome-binding factor A [Geobacillus sp. WCH70]
 gi|259552007|sp|C5D9D1|RBFA_GEOSW RecName: Full=Ribosome-binding factor A
 gi|239806952|gb|ACS24017.1| ribosome-binding factor A [Geobacillus sp. WCH70]
          Length = 126

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           RA RVGE+++  L  +I   + +D  I    +++++V ++ DL+ A VYIS+  D     
Sbjct: 4   RATRVGEQMKKELSDIIGR-KLKDPRIG--FVTVTDVRVTGDLQQAKVYISVLGDEEQRQ 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  L     FIR  IG+ +R LR  PE+ F  D S++   ++  L+   
Sbjct: 61  NTLKGLEKAKGFIRSEIGQRIR-LRKTPEIFFEIDESIEYGNRIEQLIRQI 110


>gi|15803709|ref|NP_289743.1| ribosome-binding factor A [Escherichia coli O157:H7 EDL933]
 gi|15833302|ref|NP_312075.1| ribosome-binding factor A [Escherichia coli O157:H7 str. Sakai]
 gi|16131059|ref|NP_417636.1| 30s ribosome binding factor [Escherichia coli str. K-12 substr.
           MG1655]
 gi|30064507|ref|NP_838678.1| ribosome-binding factor A [Shigella flexneri 2a str. 2457T]
 gi|56480279|ref|NP_708968.2| ribosome-binding factor A [Shigella flexneri 2a str. 301]
 gi|74313704|ref|YP_312123.1| ribosome-binding factor A [Shigella sonnei Ss046]
 gi|82545593|ref|YP_409540.1| ribosome-binding factor A [Shigella boydii Sb227]
 gi|82778481|ref|YP_404830.1| ribosome-binding factor A [Shigella dysenteriae Sd197]
 gi|89109932|ref|AP_003712.1| 30s ribosome binding factor [Escherichia coli str. K-12 substr.
           W3110]
 gi|110643408|ref|YP_671138.1| ribosome-binding factor A [Escherichia coli 536]
 gi|110807036|ref|YP_690556.1| ribosome-binding factor A [Shigella flexneri 5 str. 8401]
 gi|117625463|ref|YP_858786.1| ribosome-binding factor A [Escherichia coli APEC O1]
 gi|157154949|ref|YP_001464643.1| ribosome-binding factor A [Escherichia coli E24377A]
 gi|157162652|ref|YP_001459970.1| ribosome-binding factor A [Escherichia coli HS]
 gi|161486110|ref|NP_755790.2| ribosome-binding factor A [Escherichia coli CFT073]
 gi|162138367|ref|YP_542574.2| ribosome-binding factor A [Escherichia coli UTI89]
 gi|168749237|ref|ZP_02774259.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4113]
 gi|168754148|ref|ZP_02779155.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4401]
 gi|168762133|ref|ZP_02787140.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4501]
 gi|168769585|ref|ZP_02794592.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4486]
 gi|168773166|ref|ZP_02798173.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4196]
 gi|168781310|ref|ZP_02806317.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4076]
 gi|168786052|ref|ZP_02811059.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC869]
 gi|168797768|ref|ZP_02822775.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC508]
 gi|170018581|ref|YP_001723535.1| ribosome-binding factor A [Escherichia coli ATCC 8739]
 gi|170082704|ref|YP_001732024.1| 30s ribosome binding factor [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170680547|ref|YP_001745441.1| ribosome-binding factor A [Escherichia coli SMS-3-5]
 gi|187731087|ref|YP_001881916.1| ribosome-binding factor A [Shigella boydii CDC 3083-94]
 gi|188492975|ref|ZP_03000245.1| ribosome-binding factor A [Escherichia coli 53638]
 gi|191168041|ref|ZP_03029841.1| ribosome-binding factor A [Escherichia coli B7A]
 gi|191172235|ref|ZP_03033778.1| ribosome-binding factor A [Escherichia coli F11]
 gi|193062103|ref|ZP_03043199.1| ribosome-binding factor A [Escherichia coli E22]
 gi|193067230|ref|ZP_03048198.1| ribosome-binding factor A [Escherichia coli E110019]
 gi|194427732|ref|ZP_03060279.1| ribosome-binding factor A [Escherichia coli B171]
 gi|194433785|ref|ZP_03066060.1| ribosome-binding factor A [Shigella dysenteriae 1012]
 gi|194438794|ref|ZP_03070880.1| ribosome-binding factor A [Escherichia coli 101-1]
 gi|195938387|ref|ZP_03083769.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4024]
 gi|208807175|ref|ZP_03249512.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4206]
 gi|208814431|ref|ZP_03255760.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4045]
 gi|208819440|ref|ZP_03259760.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4042]
 gi|209397218|ref|YP_002272638.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4115]
 gi|209920644|ref|YP_002294728.1| ribosome-binding factor A [Escherichia coli SE11]
 gi|217327738|ref|ZP_03443821.1| ribosome-binding factor A [Escherichia coli O157:H7 str. TW14588]
 gi|218550452|ref|YP_002384243.1| ribosome-binding factor A [Escherichia fergusonii ATCC 35469]
 gi|218555739|ref|YP_002388652.1| ribosome-binding factor A [Escherichia coli IAI1]
 gi|218560239|ref|YP_002393152.1| ribosome-binding factor A [Escherichia coli S88]
 gi|218691459|ref|YP_002399671.1| ribosome-binding factor A [Escherichia coli ED1a]
 gi|218696874|ref|YP_002404541.1| ribosome-binding factor A [Escherichia coli 55989]
 gi|218701938|ref|YP_002409567.1| ribosome-binding factor A [Escherichia coli IAI39]
 gi|218706789|ref|YP_002414308.1| ribosome-binding factor A [Escherichia coli UMN026]
 gi|227887890|ref|ZP_04005695.1| ribosome binding factor A [Escherichia coli 83972]
 gi|238902271|ref|YP_002928067.1| 30s ribosome binding factor [Escherichia coli BW2952]
 gi|253771997|ref|YP_003034828.1| ribosome-binding factor A [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254163111|ref|YP_003046219.1| ribosome-binding factor A [Escherichia coli B str. REL606]
 gi|254795118|ref|YP_003079955.1| ribosome-binding factor A [Escherichia coli O157:H7 str. TW14359]
 gi|256018913|ref|ZP_05432778.1| ribosome-binding factor A [Shigella sp. D9]
 gi|256024257|ref|ZP_05438122.1| ribosome-binding factor A [Escherichia sp. 4_1_40B]
 gi|260845982|ref|YP_003223760.1| 30S ribosome binding factor RbfA [Escherichia coli O103:H2 str.
           12009]
 gi|260857296|ref|YP_003231187.1| 30S ribosome binding factor RbfA [Escherichia coli O26:H11 str.
           11368]
 gi|260869919|ref|YP_003236321.1| 30S ribosome binding factor RbfA [Escherichia coli O111:H- str.
           11128]
 gi|261228179|ref|ZP_05942460.1| 30s ribosome binding factor [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261255035|ref|ZP_05947568.1| 30S ribosome binding factor RbfA [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291284543|ref|YP_003501361.1| Ribosome-binding factor A [Escherichia coli O55:H7 str. CB9615]
 gi|293406779|ref|ZP_06650705.1| ribosome-binding factor A [Escherichia coli FVEC1412]
 gi|293449503|ref|ZP_06663924.1| ribosome-binding factor A [Escherichia coli B088]
 gi|298382519|ref|ZP_06992116.1| ribosome-binding factor A [Escherichia coli FVEC1302]
 gi|300817581|ref|ZP_07097797.1| ribosome-binding factor A [Escherichia coli MS 107-1]
 gi|300823870|ref|ZP_07103994.1| ribosome-binding factor A [Escherichia coli MS 119-7]
 gi|300904353|ref|ZP_07122206.1| ribosome-binding factor A [Escherichia coli MS 84-1]
 gi|300918922|ref|ZP_07135481.1| ribosome-binding factor A [Escherichia coli MS 115-1]
 gi|300926094|ref|ZP_07141912.1| ribosome-binding factor A [Escherichia coli MS 182-1]
 gi|300929857|ref|ZP_07145303.1| ribosome-binding factor A [Escherichia coli MS 187-1]
 gi|300938077|ref|ZP_07152855.1| ribosome-binding factor A [Escherichia coli MS 21-1]
 gi|300948817|ref|ZP_07162885.1| ribosome-binding factor A [Escherichia coli MS 116-1]
 gi|300955753|ref|ZP_07168098.1| ribosome-binding factor A [Escherichia coli MS 175-1]
 gi|300977834|ref|ZP_07174074.1| ribosome-binding factor A [Escherichia coli MS 200-1]
 gi|300990767|ref|ZP_07179339.1| ribosome-binding factor A [Escherichia coli MS 45-1]
 gi|301025988|ref|ZP_07189470.1| ribosome-binding factor A [Escherichia coli MS 196-1]
 gi|301047990|ref|ZP_07195032.1| ribosome-binding factor A [Escherichia coli MS 185-1]
 gi|301301777|ref|ZP_07207911.1| ribosome-binding factor A [Escherichia coli MS 124-1]
 gi|301326410|ref|ZP_07219764.1| ribosome-binding factor A [Escherichia coli MS 78-1]
 gi|301644878|ref|ZP_07244850.1| ribosome-binding factor A [Escherichia coli MS 146-1]
 gi|306816489|ref|ZP_07450621.1| ribosome-binding factor A [Escherichia coli NC101]
 gi|307139854|ref|ZP_07499210.1| ribosome-binding factor A [Escherichia coli H736]
 gi|307313126|ref|ZP_07592752.1| ribosome-binding factor A [Escherichia coli W]
 gi|309785494|ref|ZP_07680125.1| ribosome-binding factor A [Shigella dysenteriae 1617]
 gi|309793745|ref|ZP_07688171.1| ribosome-binding factor A [Escherichia coli MS 145-7]
 gi|312972561|ref|ZP_07786734.1| ribosome-binding factor A [Escherichia coli 1827-70]
 gi|331643867|ref|ZP_08344998.1| ribosome-binding factor A [Escherichia coli H736]
 gi|331654773|ref|ZP_08355773.1| ribosome-binding factor A [Escherichia coli M718]
 gi|331659456|ref|ZP_08360398.1| ribosome-binding factor A [Escherichia coli TA206]
 gi|331664781|ref|ZP_08365686.1| ribosome-binding factor A [Escherichia coli TA143]
 gi|331669996|ref|ZP_08370841.1| ribosome-binding factor A [Escherichia coli TA271]
 gi|331674705|ref|ZP_08375464.1| ribosome-binding factor A [Escherichia coli TA280]
 gi|331679248|ref|ZP_08379920.1| ribosome-binding factor A [Escherichia coli H591]
 gi|331684816|ref|ZP_08385408.1| ribosome-binding factor A [Escherichia coli H299]
 gi|67471971|sp|P0A7G2|RBFA_ECOLI RecName: Full=Ribosome-binding factor A; AltName: Full=Protein P15B
 gi|67471972|sp|P0A7G3|RBFA_ECOL6 RecName: Full=Ribosome-binding factor A
 gi|67471973|sp|P0A7G4|RBFA_ECO57 RecName: Full=Ribosome-binding factor A
 gi|67471974|sp|P0A7G5|RBFA_SHIFL RecName: Full=Ribosome-binding factor A
 gi|123147649|sp|Q0TCU2|RBFA_ECOL5 RecName: Full=Ribosome-binding factor A
 gi|123342479|sp|Q0T0B4|RBFA_SHIF8 RecName: Full=Ribosome-binding factor A
 gi|123558564|sp|Q31W46|RBFA_SHIBS RecName: Full=Ribosome-binding factor A
 gi|123561526|sp|Q32BG6|RBFA_SHIDS RecName: Full=Ribosome-binding factor A
 gi|123616074|sp|Q3YX74|RBFA_SHISS RecName: Full=Ribosome-binding factor A
 gi|166218437|sp|A1AG72|RBFA_ECOK1 RecName: Full=Ribosome-binding factor A
 gi|166918674|sp|A7ZS64|RBFA_ECO24 RecName: Full=Ribosome-binding factor A
 gi|166918675|sp|A8A4Y3|RBFA_ECOHS RecName: Full=Ribosome-binding factor A
 gi|172046242|sp|Q1R6H1|RBFA_ECOUT RecName: Full=Ribosome-binding factor A
 gi|189039540|sp|B1IQV4|RBFA_ECOLC RecName: Full=Ribosome-binding factor A
 gi|226723599|sp|B1XGX9|RBFA_ECODH RecName: Full=Ribosome-binding factor A
 gi|226723600|sp|B6I1P2|RBFA_ECOSE RecName: Full=Ribosome-binding factor A
 gi|226736644|sp|B7MB88|RBFA_ECO45 RecName: Full=Ribosome-binding factor A
 gi|226736645|sp|B7NKN6|RBFA_ECO7I RecName: Full=Ribosome-binding factor A
 gi|226736646|sp|B7M075|RBFA_ECO8A RecName: Full=Ribosome-binding factor A
 gi|226736647|sp|B7NDF3|RBFA_ECOLU RecName: Full=Ribosome-binding factor A
 gi|226736648|sp|B1LFR9|RBFA_ECOSM RecName: Full=Ribosome-binding factor A
 gi|226736649|sp|B7LR36|RBFA_ESCF3 RecName: Full=Ribosome-binding factor A
 gi|238058487|sp|B5YS57|RBFA_ECO5E RecName: Full=Ribosome-binding factor A
 gi|238691777|sp|B2U208|RBFA_SHIB3 RecName: Full=Ribosome-binding factor A
 gi|254789749|sp|B7LHN2|RBFA_ECO55 RecName: Full=Ribosome-binding factor A
 gi|254789750|sp|B7N0V2|RBFA_ECO81 RecName: Full=Ribosome-binding factor A
 gi|259551972|sp|C4ZSQ8|RBFA_ECOBW RecName: Full=Ribosome-binding factor A
 gi|12517778|gb|AAG58303.1|AE005545_5 ribosome-binding factor A [Escherichia coli O157:H7 str. EDL933]
 gi|42218|emb|CAA32020.1| P15B gene product (AA 1 - 133) [Escherichia coli]
 gi|42222|emb|CAA31634.1| unnamed protein product [Escherichia coli]
 gi|606107|gb|AAA57970.1| P15B [Escherichia coli str. K-12 substr. MG1655]
 gi|1789558|gb|AAC76201.1| 30s ribosome binding factor [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13363521|dbj|BAB37471.1| ribosome-binding factor A [Escherichia coli O157:H7 str. Sakai]
 gi|30042766|gb|AAP18489.1| ribosome-binding factor A [Shigella flexneri 2a str. 2457T]
 gi|56383830|gb|AAN44675.2| ribosome-binding factor A [Shigella flexneri 2a str. 301]
 gi|73857181|gb|AAZ89888.1| ribosome-binding factor A [Shigella sonnei Ss046]
 gi|81242629|gb|ABB63339.1| ribosome-binding factor A [Shigella dysenteriae Sd197]
 gi|81247004|gb|ABB67712.1| ribosome-binding factor A [Shigella boydii Sb227]
 gi|85675963|dbj|BAE77213.1| 30s ribosome binding factor [Escherichia coli str. K12 substr.
           W3110]
 gi|110345000|gb|ABG71237.1| ribosome-binding factor A [Escherichia coli 536]
 gi|110616584|gb|ABF05251.1| ribosome-binding factor A [Shigella flexneri 5 str. 8401]
 gi|115514587|gb|ABJ02662.1| ribosome-binding factor A [Escherichia coli APEC O1]
 gi|157068332|gb|ABV07587.1| ribosome-binding factor A [Escherichia coli HS]
 gi|157076979|gb|ABV16687.1| ribosome-binding factor A [Escherichia coli E24377A]
 gi|169753509|gb|ACA76208.1| ribosome-binding factor A [Escherichia coli ATCC 8739]
 gi|169890539|gb|ACB04246.1| 30s ribosome binding factor [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170518265|gb|ACB16443.1| ribosome-binding factor A [Escherichia coli SMS-3-5]
 gi|187428079|gb|ACD07353.1| ribosome-binding factor A [Shigella boydii CDC 3083-94]
 gi|187770833|gb|EDU34677.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4196]
 gi|188016404|gb|EDU54526.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4113]
 gi|188488174|gb|EDU63277.1| ribosome-binding factor A [Escherichia coli 53638]
 gi|189001131|gb|EDU70117.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4076]
 gi|189358437|gb|EDU76856.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4401]
 gi|189361487|gb|EDU79906.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4486]
 gi|189367587|gb|EDU86003.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4501]
 gi|189373921|gb|EDU92337.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC869]
 gi|189379719|gb|EDU98135.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC508]
 gi|190901910|gb|EDV61659.1| ribosome-binding factor A [Escherichia coli B7A]
 gi|190907545|gb|EDV67141.1| ribosome-binding factor A [Escherichia coli F11]
 gi|192932323|gb|EDV84921.1| ribosome-binding factor A [Escherichia coli E22]
 gi|192959187|gb|EDV89622.1| ribosome-binding factor A [Escherichia coli E110019]
 gi|194414240|gb|EDX30515.1| ribosome-binding factor A [Escherichia coli B171]
 gi|194418048|gb|EDX34142.1| ribosome-binding factor A [Shigella dysenteriae 1012]
 gi|194422266|gb|EDX38267.1| ribosome-binding factor A [Escherichia coli 101-1]
 gi|208726976|gb|EDZ76577.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4206]
 gi|208735708|gb|EDZ84395.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4045]
 gi|208739563|gb|EDZ87245.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4042]
 gi|209158618|gb|ACI36051.1| ribosome-binding factor A [Escherichia coli O157:H7 str. EC4115]
 gi|209758348|gb|ACI77486.1| ribosome-binding factor A [Escherichia coli]
 gi|209758350|gb|ACI77487.1| ribosome-binding factor A [Escherichia coli]
 gi|209758352|gb|ACI77488.1| ribosome-binding factor A [Escherichia coli]
 gi|209758354|gb|ACI77489.1| ribosome-binding factor A [Escherichia coli]
 gi|209758356|gb|ACI77490.1| ribosome-binding factor A [Escherichia coli]
 gi|209913903|dbj|BAG78977.1| ribosome-binding factor A [Escherichia coli SE11]
 gi|217320105|gb|EEC28530.1| ribosome-binding factor A [Escherichia coli O157:H7 str. TW14588]
 gi|218353606|emb|CAU99796.1| 30s ribosome binding factor [Escherichia coli 55989]
 gi|218357993|emb|CAQ90639.1| 30s ribosome binding factor [Escherichia fergusonii ATCC 35469]
 gi|218362507|emb|CAR00131.1| 30s ribosome binding factor [Escherichia coli IAI1]
 gi|218367008|emb|CAR04779.1| 30s ribosome binding factor [Escherichia coli S88]
 gi|218371924|emb|CAR19780.1| 30s ribosome binding factor [Escherichia coli IAI39]
 gi|218429023|emb|CAR09970.2| 30s ribosome binding factor [Escherichia coli ED1a]
 gi|218433886|emb|CAR14803.1| 30s ribosome binding factor [Escherichia coli UMN026]
 gi|222034886|emb|CAP77629.1| ribosome-binding factor A [Escherichia coli LF82]
 gi|227835286|gb|EEJ45752.1| ribosome binding factor A [Escherichia coli 83972]
 gi|238859805|gb|ACR61803.1| 30s ribosome binding factor [Escherichia coli BW2952]
 gi|242378712|emb|CAQ33502.1| 30S ribosome binding factor [Escherichia coli BL21(DE3)]
 gi|253323041|gb|ACT27643.1| ribosome-binding factor A [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253975012|gb|ACT40683.1| ribosome-binding factor A [Escherichia coli B str. REL606]
 gi|253979168|gb|ACT44838.1| ribosome-binding factor A [Escherichia coli BL21(DE3)]
 gi|254594518|gb|ACT73879.1| 30s ribosome binding factor [Escherichia coli O157:H7 str. TW14359]
 gi|257755945|dbj|BAI27447.1| 30S ribosome binding factor RbfA [Escherichia coli O26:H11 str.
           11368]
 gi|257761129|dbj|BAI32626.1| 30S ribosome binding factor RbfA [Escherichia coli O103:H2 str.
           12009]
 gi|257766275|dbj|BAI37770.1| 30S ribosome binding factor RbfA [Escherichia coli O111:H- str.
           11128]
 gi|260447804|gb|ACX38226.1| ribosome-binding factor A [Escherichia coli DH1]
 gi|281180211|dbj|BAI56541.1| ribosome-binding factor A [Escherichia coli SE15]
 gi|281602551|gb|ADA75535.1| Ribosome-binding factor A [Shigella flexneri 2002017]
 gi|290764416|gb|ADD58377.1| Ribosome-binding factor A [Escherichia coli O55:H7 str. CB9615]
 gi|291322593|gb|EFE62022.1| ribosome-binding factor A [Escherichia coli B088]
 gi|291426785|gb|EFE99817.1| ribosome-binding factor A [Escherichia coli FVEC1412]
 gi|294493732|gb|ADE92488.1| ribosome-binding factor A [Escherichia coli IHE3034]
 gi|298277659|gb|EFI19175.1| ribosome-binding factor A [Escherichia coli FVEC1302]
 gi|299879883|gb|EFI88094.1| ribosome-binding factor A [Escherichia coli MS 196-1]
 gi|300300133|gb|EFJ56518.1| ribosome-binding factor A [Escherichia coli MS 185-1]
 gi|300308211|gb|EFJ62731.1| ribosome-binding factor A [Escherichia coli MS 200-1]
 gi|300317386|gb|EFJ67170.1| ribosome-binding factor A [Escherichia coli MS 175-1]
 gi|300403704|gb|EFJ87242.1| ribosome-binding factor A [Escherichia coli MS 84-1]
 gi|300407075|gb|EFJ90613.1| ribosome-binding factor A [Escherichia coli MS 45-1]
 gi|300413948|gb|EFJ97258.1| ribosome-binding factor A [Escherichia coli MS 115-1]
 gi|300417859|gb|EFK01170.1| ribosome-binding factor A [Escherichia coli MS 182-1]
 gi|300451706|gb|EFK15326.1| ribosome-binding factor A [Escherichia coli MS 116-1]
 gi|300456937|gb|EFK20430.1| ribosome-binding factor A [Escherichia coli MS 21-1]
 gi|300462219|gb|EFK25712.1| ribosome-binding factor A [Escherichia coli MS 187-1]
 gi|300523638|gb|EFK44707.1| ribosome-binding factor A [Escherichia coli MS 119-7]
 gi|300529879|gb|EFK50941.1| ribosome-binding factor A [Escherichia coli MS 107-1]
 gi|300842758|gb|EFK70518.1| ribosome-binding factor A [Escherichia coli MS 124-1]
 gi|300846899|gb|EFK74659.1| ribosome-binding factor A [Escherichia coli MS 78-1]
 gi|301076823|gb|EFK91629.1| ribosome-binding factor A [Escherichia coli MS 146-1]
 gi|305850054|gb|EFM50513.1| ribosome-binding factor A [Escherichia coli NC101]
 gi|306907037|gb|EFN37545.1| ribosome-binding factor A [Escherichia coli W]
 gi|307555263|gb|ADN48038.1| ribosome-binding factor A [Escherichia coli ABU 83972]
 gi|307625232|gb|ADN69536.1| ribosome-binding factor A [Escherichia coli UM146]
 gi|308122702|gb|EFO59964.1| ribosome-binding factor A [Escherichia coli MS 145-7]
 gi|308926614|gb|EFP72090.1| ribosome-binding factor A [Shigella dysenteriae 1617]
 gi|309703595|emb|CBJ02935.1| ribosome-binding factor A [Escherichia coli ETEC H10407]
 gi|310332503|gb|EFP99716.1| ribosome-binding factor A [Escherichia coli 1827-70]
 gi|312947726|gb|ADR28553.1| ribosome-binding factor A [Escherichia coli O83:H1 str. NRG 857C]
 gi|313648591|gb|EFS13033.1| ribosome-binding factor A [Shigella flexneri 2a str. 2457T]
 gi|315062475|gb|ADT76802.1| 30S ribosome binding factor [Escherichia coli W]
 gi|315137755|dbj|BAJ44914.1| ribosome-binding factor A [Escherichia coli DH1]
 gi|315257093|gb|EFU37061.1| ribosome-binding factor A [Escherichia coli MS 85-1]
 gi|315288931|gb|EFU48329.1| ribosome-binding factor A [Escherichia coli MS 110-3]
 gi|315294912|gb|EFU54251.1| ribosome-binding factor A [Escherichia coli MS 153-1]
 gi|315297881|gb|EFU57151.1| ribosome-binding factor A [Escherichia coli MS 16-3]
 gi|315617250|gb|EFU97859.1| ribosome-binding factor A [Escherichia coli 3431]
 gi|320175531|gb|EFW50627.1| Ribosome-binding factor A [Shigella dysenteriae CDC 74-1112]
 gi|320181443|gb|EFW56361.1| Ribosome-binding factor A [Shigella boydii ATCC 9905]
 gi|320186656|gb|EFW61380.1| Ribosome-binding factor A [Shigella flexneri CDC 796-83]
 gi|320189521|gb|EFW64180.1| Ribosome-binding factor A [Escherichia coli O157:H7 str. EC1212]
 gi|320194653|gb|EFW69283.1| Ribosome-binding factor A [Escherichia coli WV_060327]
 gi|320202081|gb|EFW76656.1| Ribosome-binding factor A [Escherichia coli EC4100B]
 gi|320640239|gb|EFX09811.1| ribosome-binding factor A [Escherichia coli O157:H7 str. G5101]
 gi|320645536|gb|EFX14545.1| ribosome-binding factor A [Escherichia coli O157:H- str. 493-89]
 gi|320650846|gb|EFX19303.1| ribosome-binding factor A [Escherichia coli O157:H- str. H 2687]
 gi|320656227|gb|EFX24139.1| ribosome-binding factor A [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320661917|gb|EFX29325.1| ribosome-binding factor A [Escherichia coli O55:H7 str. USDA 5905]
 gi|320666752|gb|EFX33731.1| ribosome-binding factor A [Escherichia coli O157:H7 str. LSU-61]
 gi|323154381|gb|EFZ40582.1| ribosome-binding factor A [Escherichia coli EPECa14]
 gi|323162861|gb|EFZ48696.1| ribosome-binding factor A [Escherichia coli E128010]
 gi|323165125|gb|EFZ50915.1| ribosome-binding factor A [Shigella sonnei 53G]
 gi|323173573|gb|EFZ59202.1| ribosome-binding factor A [Escherichia coli LT-68]
 gi|323178880|gb|EFZ64456.1| ribosome-binding factor A [Escherichia coli 1180]
 gi|323183122|gb|EFZ68520.1| ribosome-binding factor A [Escherichia coli 1357]
 gi|323189210|gb|EFZ74494.1| ribosome-binding factor A [Escherichia coli RN587/1]
 gi|323376937|gb|ADX49205.1| ribosome-binding factor A [Escherichia coli KO11]
 gi|323936137|gb|EGB32431.1| ribosome-binding protein A [Escherichia coli E1520]
 gi|323941731|gb|EGB37910.1| ribosome-binding proteinA [Escherichia coli E482]
 gi|323946977|gb|EGB42993.1| ribosome-binding protein A [Escherichia coli H120]
 gi|323951313|gb|EGB47188.1| ribosome-binding proteinA [Escherichia coli H252]
 gi|323957684|gb|EGB53398.1| ribosome-binding proteinA [Escherichia coli H263]
 gi|323961061|gb|EGB56676.1| ribosome-binding proteinA [Escherichia coli H489]
 gi|323966349|gb|EGB61783.1| ribosome-binding proteinA [Escherichia coli M863]
 gi|323970268|gb|EGB65539.1| ribosome-binding proteinA [Escherichia coli TA007]
 gi|323979114|gb|EGB74192.1| ribosome-binding proteinA [Escherichia coli TW10509]
 gi|324008766|gb|EGB77985.1| ribosome-binding factor A [Escherichia coli MS 57-2]
 gi|324012107|gb|EGB81326.1| ribosome-binding factor A [Escherichia coli MS 60-1]
 gi|324018309|gb|EGB87528.1| ribosome-binding factor A [Escherichia coli MS 117-3]
 gi|324115227|gb|EGC09191.1| ribosome-binding proteinA [Escherichia fergusonii B253]
 gi|325498750|gb|EGC96609.1| ribosome-binding factor A [Escherichia fergusonii ECD227]
 gi|326337869|gb|EGD61703.1| Ribosome-binding factor A [Escherichia coli O157:H7 str. 1125]
 gi|326347438|gb|EGD71163.1| Ribosome-binding factor A [Escherichia coli O157:H7 str. 1044]
 gi|327251948|gb|EGE63634.1| ribosome-binding factor A [Escherichia coli STEC_7v]
 gi|331037338|gb|EGI09562.1| ribosome-binding factor A [Escherichia coli H736]
 gi|331048155|gb|EGI20232.1| ribosome-binding factor A [Escherichia coli M718]
 gi|331054038|gb|EGI26067.1| ribosome-binding factor A [Escherichia coli TA206]
 gi|331058029|gb|EGI30011.1| ribosome-binding factor A [Escherichia coli TA143]
 gi|331062909|gb|EGI34823.1| ribosome-binding factor A [Escherichia coli TA271]
 gi|331068144|gb|EGI39540.1| ribosome-binding factor A [Escherichia coli TA280]
 gi|331073313|gb|EGI44636.1| ribosome-binding factor A [Escherichia coli H591]
 gi|331078431|gb|EGI49637.1| ribosome-binding factor A [Escherichia coli H299]
 gi|332086101|gb|EGI91263.1| ribosome-binding factor A [Shigella boydii 5216-82]
 gi|332086394|gb|EGI91541.1| ribosome-binding factor A [Shigella dysenteriae 155-74]
 gi|332090730|gb|EGI95824.1| ribosome-binding factor A [Shigella boydii 3594-74]
 gi|332345124|gb|AEE58458.1| ribosome-binding factor RbfA [Escherichia coli UMNK88]
 gi|332752327|gb|EGJ82717.1| ribosome-binding factor A [Shigella flexneri 4343-70]
 gi|332752854|gb|EGJ83239.1| ribosome-binding factor A [Shigella flexneri K-671]
 gi|332754590|gb|EGJ84956.1| ribosome-binding factor A [Shigella flexneri 2747-71]
 gi|332765164|gb|EGJ95391.1| ribosome-binding factor A [Shigella flexneri 2930-71]
 gi|332998809|gb|EGK18405.1| ribosome-binding factor A [Shigella flexneri VA-6]
 gi|333000039|gb|EGK19622.1| ribosome-binding factor A [Shigella flexneri K-218]
 gi|333014561|gb|EGK33908.1| ribosome-binding factor A [Shigella flexneri K-304]
          Length = 133

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A VY++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIALILQR-EIKDPRL-GMMTTVSGVEMSRDLAYAKVYVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|205373416|ref|ZP_03226220.1| ribosome-binding factor A [Bacillus coahuilensis m4-4]
          Length = 117

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 65/120 (54%), Gaps = 4/120 (3%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S R+ R+GE+++  L  +I   + +D  I    +++++V ++ DL+ A VYI++  D   
Sbjct: 2   SLRSNRIGEQMKKELGDIISR-KIKDPRIG--FVTVTDVQVTGDLQQAKVYITVLDDSKR 58

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
           +  +  L+    FIR  IG  +R LR  PEL F +D S+Q   ++ +++   K     E+
Sbjct: 59  EDTLKGLSKAKGFIRSEIGSRIR-LRKTPELLFEFDESIQYGNRIESIIRDIKEDEKSEE 117


>gi|283788205|ref|YP_003368070.1| ribosome-binding factor A [Citrobacter rodentium ICC168]
 gi|182676606|sp|A9MP37|RBFA_SALAR RecName: Full=Ribosome-binding factor A
 gi|282951659|emb|CBG91359.1| ribosome-binding factor A [Citrobacter rodentium ICC168]
          Length = 133

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V MS DL  A VY++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIA-IILQREIKDPRL-GMMTTVSGVEMSRDLAYAKVYVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLV-TNV 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|39996689|ref|NP_952640.1| ribosome-binding factor A [Geobacter sulfurreducens PCA]
 gi|61215118|sp|Q74CT2|RBFA_GEOSL RecName: Full=Ribosome-binding factor A
 gi|39983570|gb|AAR34963.1| ribosome-binding factor A [Geobacter sulfurreducens PCA]
 gi|298505700|gb|ADI84423.1| ribosome-binding factor A [Geobacter sulfurreducens KN400]
          Length = 118

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
             R+ +V E +   +  +I+    +D  I    I+I+ V ++ D+R AT+Y ++  D   
Sbjct: 2   FNRSEKVAEAIHELVSGLIVKG-MKDPRIG--FITITGVKVTDDIRQATIYYTVMGDDEA 58

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                  L     F+R  IG+ LR L++ PEL F+YD S++   +++ L+   +   
Sbjct: 59  RVSTARGLASATGFLRREIGKQLR-LKFAPELHFKYDQSIEYGNRIDQLLKEIETEK 114


>gi|154497686|ref|ZP_02036064.1| hypothetical protein BACCAP_01662 [Bacteroides capillosus ATCC
           29799]
 gi|150273184|gb|EDN00329.1| hypothetical protein BACCAP_01662 [Bacteroides capillosus ATCC
           29799]
          Length = 129

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 4/116 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S R  R+ EE++  L  +I     +D  +   ++SI+ V  + DLR A +++S+    
Sbjct: 1   MASNRIGRINEEIQRELSGLIR--TVKDPRVHG-LVSITAVDTTTDLRYAKIHVSVLDKS 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + V+  L     ++R  +G +L +LRY PEL F  D S+     + +++  P++
Sbjct: 58  DVNEVVKGLKSAAGYLRRELGAAL-SLRYTPELIFEKDDSMAQGAHILSMLRDPEV 112


>gi|300691720|ref|YP_003752715.1| ribosome-binding factor A [Ralstonia solanacearum PSI07]
 gi|299078780|emb|CBJ51440.1| Ribosome-binding factor A [Ralstonia solanacearum PSI07]
          Length = 123

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 60/127 (47%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K+   S R LR+ ++++  L  +I   E ++  +   ++++  V ++ D   A +Y 
Sbjct: 1   MPKKSGSASGRNLRIADQIQRDLAELIQR-ELKNPQMG--LVTLQSVSLTPDYAHAKIYF 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++     PD   + LN    ++   + + L ++  VP L F YD S++   +++ L+   
Sbjct: 58  TVLGA-EPDAAAAILNEKAGYLHSLLFKRL-HIHTVPTLHFHYDGSVERGAEMSRLIDQA 115

Query: 121 KIPVALE 127
               A +
Sbjct: 116 NASRAKD 122


>gi|170765473|ref|ZP_02900284.1| ribosome-binding factor A [Escherichia albertii TW07627]
 gi|170124619|gb|EDS93550.1| ribosome-binding factor A [Escherichia albertii TW07627]
          Length = 133

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V MS DL  A VY++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIA-IILQREIKDPRL-GMMTTVSGVEMSRDLAYAKVYVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|221632779|ref|YP_002522001.1| ribosome-binding factor A [Thermomicrobium roseum DSM 5159]
 gi|254789771|sp|B9KZ59|RBFA_THERP RecName: Full=Ribosome-binding factor A
 gi|221155649|gb|ACM04776.1| ribosome-binding factor A [Thermomicrobium roseum DSM 5159]
          Length = 129

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 59/123 (47%), Gaps = 5/123 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-D 65
             S R  R+ E +R  +  +I   E +D  +    +S++ V MS DLR A V++S+    
Sbjct: 1   MPSYRQARLAEFLRDEIAAIIQR-ELRDPRLG--FVSVTRVEMSPDLRHAKVFVSIYGSH 57

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              +  + AL     FIR  I   L + R++PEL F+ D SL+   ++  L+   +    
Sbjct: 58  EEQEAALEALQGAAGFIRRLIAPHL-HTRHIPELHFKLDRSLEHAEQVARLLRQIQQERQ 116

Query: 126 LEK 128
            ++
Sbjct: 117 RDE 119


>gi|323489592|ref|ZP_08094819.1| ribosome-binding factor A [Planococcus donghaensis MPA1U2]
 gi|323396723|gb|EGA89542.1| ribosome-binding factor A [Planococcus donghaensis MPA1U2]
          Length = 116

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 64/115 (55%), Gaps = 5/115 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA RV E+++  L  +I   + +D  I    +++++V ++ DL+ ATVYIS+  +    +
Sbjct: 4   RANRVAEQMKKELSDIISR-KLKDPRIG--FVTVTDVEVTGDLQQATVYISVLGEDHAKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
           + +  L  +  FIR  IG+ +R LR  PEL F  D+S+    +++ L+   + P 
Sbjct: 61  QTLLGLTKSKGFIRSEIGQRIR-LRKTPELSFEIDSSVAYGNRIDTLLRDIQEPK 114


>gi|220931629|ref|YP_002508537.1| ribosome-binding factor A [Halothermothrix orenii H 168]
 gi|254789753|sp|B8CW73|RBFA_HALOH RecName: Full=Ribosome-binding factor A
 gi|219992939|gb|ACL69542.1| ribosome-binding factor A [Halothermothrix orenii H 168]
          Length = 122

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 38/113 (33%), Positives = 61/113 (53%), Gaps = 5/113 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SP 68
           +RA R+GE ++  +  +IL  E +D  I    IS+++V +S DLR A V++S+  D    
Sbjct: 4   QRARRLGELLKKEISDIILR-EVKDPRIG--FISVTDVEVSNDLRHAKVFVSVYGDEKER 60

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
              +  L     +IR  IG  ++   Y PE+ FRYD SL+   ++N L+   K
Sbjct: 61  KETMEGLEKATGYIRKLIGERVKVY-YTPEILFRYDDSLEHGARINELLKKVK 112


>gi|311068188|ref|YP_003973111.1| ribosome-binding factor A [Bacillus atrophaeus 1942]
 gi|310868705|gb|ADP32180.1| ribosome-binding factor A [Bacillus atrophaeus 1942]
          Length = 117

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 61/120 (50%), Gaps = 5/120 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S RA RVGE+++  L  +I   + +D  I    +++++V ++ DL++A VYIS+  D   
Sbjct: 2   SMRANRVGEQMKKELGDIISR-KLKDPRIG--FLTVTDVRVTGDLQIAKVYISVLGDEKK 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
            +  +  L     FIR  IG  +R LR  PE+ F +D S+    ++  L+         E
Sbjct: 59  REEALKGLEKAKGFIRSEIGSRIR-LRKTPEIEFEFDESIDYGNRIETLIHQLHSDKDSE 117


>gi|284052769|ref|ZP_06382979.1| ribosome-binding factor A [Arthrospira platensis str. Paraca]
 gi|291565861|dbj|BAI88133.1| ribosome-binding factor A [Arthrospira platensis NIES-39]
          Length = 137

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 32/112 (28%), Positives = 57/112 (50%), Gaps = 3/112 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           RR  RV   ++  +  V+L  + +D  +   ++SI+EV +S DL+ A +++S+       
Sbjct: 5   RRVSRVASLIKREVSQVLL-YDIKDDRVGTGMVSITEVEVSGDLQHAKIFVSIYGTEEAR 63

Query: 70  R-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           R  +  L     +IR  +G+ +R LR  PE+ F  D SL+   K+  L+   
Sbjct: 64  RSTMEGLRSATGYIRSHLGKHIR-LRRTPEVVFLEDRSLERGDKIIDLLNQI 114


>gi|154686082|ref|YP_001421243.1| ribosome-binding factor A [Bacillus amyloliquefaciens FZB42]
 gi|308173628|ref|YP_003920333.1| ribosome-binding factor A [Bacillus amyloliquefaciens DSM 7]
 gi|154351933|gb|ABS74012.1| RbfA [Bacillus amyloliquefaciens FZB42]
 gi|307606492|emb|CBI42863.1| ribosome-binding factor A [Bacillus amyloliquefaciens DSM 7]
 gi|328911769|gb|AEB63365.1| Ribosome-binding factor A [Bacillus amyloliquefaciens LL3]
          Length = 115

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           RA RVGE+++  L  +I   + +D  I    +++++V +S DL++A VYIS+   +   +
Sbjct: 2   RANRVGEQMKKELGDIISR-KLKDPRIG--FLTVTDVRVSGDLQIAKVYISVLGGEKKKE 58

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  L     FIR  IG  +R LR  PEL F +D S++   ++  L+   
Sbjct: 59  EALKGLEKAKGFIRSEIGSRIR-LRKTPELEFEFDESIEYGNRIETLIHEL 108


>gi|86605483|ref|YP_474246.1| ribosome-binding factor A [Synechococcus sp. JA-3-3Ab]
 gi|123507268|sp|Q2JW85|RBFA_SYNJA RecName: Full=Ribosome-binding factor A
 gi|86554025|gb|ABC98983.1| ribosome-binding factor A [Synechococcus sp. JA-3-3Ab]
          Length = 149

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 64/120 (53%), Gaps = 3/120 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SP 68
           RR  RV E ++  +  ++L +E +D  +   ++SI +V +S DL+ A +++S+  D  + 
Sbjct: 5   RRVARVAELIKREVSQILL-SEIKDDRVGAGMVSIVDVEVSNDLQNARIFVSIYGDEAAQ 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
            + +  L     F+R  IG+ L  LR VP + F  D SL+   ++ AL+   + P   ++
Sbjct: 64  QQTMEGLASATPFVRREIGQRL-GLRRVPTVVFLQDRSLERGSRVLALLNQLRQPAEAQQ 122


>gi|115372769|ref|ZP_01460075.1| ribosome-binding factor A [Stigmatella aurantiaca DW4/3-1]
 gi|310823418|ref|YP_003955776.1| ribosome-binding factor a [Stigmatella aurantiaca DW4/3-1]
 gi|3914548|sp|O05340|RBFA_STIAU RecName: Full=Ribosome-binding factor A
 gi|1934985|emb|CAA61164.1| ribosome binding factor A [Stigmatella aurantiaca]
 gi|115370250|gb|EAU69179.1| ribosome-binding factor A [Stigmatella aurantiaca DW4/3-1]
 gi|309396490|gb|ADO73949.1| Ribosome-binding factor A [Stigmatella aurantiaca DW4/3-1]
          Length = 119

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VSP 68
            R  RVG+E+++A+  ++   E +D  I    I+I+ V +S DLRVA V+ S+       
Sbjct: 5   SRPERVGQEIQAAIGQLLTRGELRDPRIG--FITITGVKVSPDLRVAQVFYSMMGTAQER 62

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                 L+    F+R  +  ++ NLR  PE+ F +D S+    K++ L+   K   
Sbjct: 63  AETQKGLDAAKGFVRREVTAAV-NLRVSPEVFFTFDESVGEGDKIDRLLREVKQKE 117


>gi|157148736|ref|YP_001456055.1| ribosome-binding factor A [Citrobacter koseri ATCC BAA-895]
 gi|166218429|sp|A8AQ56|RBFA_CITK8 RecName: Full=Ribosome-binding factor A
 gi|157085941|gb|ABV15619.1| hypothetical protein CKO_04566 [Citrobacter koseri ATCC BAA-895]
          Length = 133

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V MS DL  A VY++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIA-IILQREIKDPRL-GMMTTVSGVEMSRDLAYAKVYVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEDAVKAGIKALQEASGFIRTLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTNV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|302185433|ref|ZP_07262106.1| ribosome-binding factor A [Pseudomonas syringae pv. syringae 642]
          Length = 138

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITAVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             S + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDSAEEIAQTIKVLNSAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|307243339|ref|ZP_07525503.1| ribosome-binding factor A [Peptostreptococcus stomatis DSM 17678]
 gi|306493286|gb|EFM65275.1| ribosome-binding factor A [Peptostreptococcus stomatis DSM 17678]
          Length = 115

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 64/121 (52%), Gaps = 6/121 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S R  R+ EEVR  +  +++N   +D  I   +IS+++V ++ DLR A VYIS+    
Sbjct: 1   MASNRIKRISEEVRKVVSSMLING-IKDPRI-TSMISVTDVEVTNDLRYAFVYISILGG- 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             +  +  LN    +IR  +GR ++ LRY PE+ F+ D S++    ++ L+    +    
Sbjct: 58  DREASLEGLNSARGYIRREVGRQVK-LRYAPEIVFKIDDSIERGMYMDELIKS--VNKDE 114

Query: 127 E 127
           E
Sbjct: 115 E 115


>gi|311030084|ref|ZP_07708174.1| ribosome-binding factor A [Bacillus sp. m3-13]
          Length = 130

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 61/123 (49%), Gaps = 6/123 (4%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              + R+ RVGE+++  L  +I   + +D  +    +++++V ++ DL+ A V+IS+  D
Sbjct: 8   KGMTLRSNRVGEQMKKELSDIIGR-KIKDPRVG--FVTVTDVQVTGDLQQAKVFISVLGD 64

Query: 66  VSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                  +  L     FIR  IGR +R LR  PEL F +D S+     +N+L+       
Sbjct: 65  DEKRQDTLIGLAKAKGFIRSEIGRRIR-LRKTPELFFEFDESIAYGNHINSLIHELN-RK 122

Query: 125 ALE 127
             +
Sbjct: 123 DSD 125


>gi|54295601|ref|YP_128016.1| ribosome-binding factor A [Legionella pneumophila str. Lens]
 gi|296108415|ref|YP_003620116.1| ribosome-binding factor A [Legionella pneumophila 2300/99 Alcoy]
 gi|61214769|sp|Q5WT37|RBFA_LEGPL RecName: Full=Ribosome-binding factor A
 gi|53755433|emb|CAH16929.1| Ribosome-binding factor A [Legionella pneumophila str. Lens]
 gi|295650317|gb|ADG26164.1| ribosome-binding factor A [Legionella pneumophila 2300/99 Alcoy]
          Length = 123

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 4/115 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
              N +R  R+ E ++  L  +I   E +D  +    ++IS V ++ DL  A +Y ++  
Sbjct: 1   MNNNFKRTDRIAEMIQRKLALIIPQ-EIKDPRLKG-FVTISAVKVAADLGHAKIYFTVLN 58

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           +     V + LN    ++R  + RS+  LR VP+L F YD S++   +L+ L+  
Sbjct: 59  E-DKSVVTNILNGAASYLRSALARSI-TLRTVPQLHFIYDESIEYGQRLSRLIDE 111


>gi|91206050|ref|YP_538405.1| ribosome-binding factor A [Rickettsia bellii RML369-C]
 gi|157826584|ref|YP_001495648.1| ribosome-binding factor A [Rickettsia bellii OSU 85-389]
 gi|122425244|sp|Q1RH48|RBFA_RICBR RecName: Full=Ribosome-binding factor A
 gi|166219400|sp|A8GUU4|RBFA_RICB8 RecName: Full=Ribosome-binding factor A
 gi|91069594|gb|ABE05316.1| Ribosome-binding factor A [Rickettsia bellii RML369-C]
 gi|157801888|gb|ABV78611.1| ribosome-binding factor A [Rickettsia bellii OSU 85-389]
          Length = 123

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 58/120 (48%), Gaps = 2/120 (1%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK    +NS R  +V   +  AL+ ++   +  D  +    ++I+++ ++ DL++A  Y 
Sbjct: 1   MKKLTSENSHRQQKVASIINEALIEILHRGKMLDPRLYDCPLTITKIIVTADLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                  +P  +  +LN +   IR  +   + N++Y P++RF YD    +  K+  L+  
Sbjct: 61  LPFNTKLTPQEITESLNNSKNAIRNFVTGKI-NMKYSPDIRFHYDHGFDNALKVEQLLKD 119


>gi|52842970|ref|YP_096769.1| ribosome-binding factor A [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54298755|ref|YP_125124.1| ribosome-binding factor A [Legionella pneumophila str. Paris]
 gi|148361085|ref|YP_001252292.1| ribosome binding factor A [Legionella pneumophila str. Corby]
 gi|61214776|sp|Q5X1C4|RBFA_LEGPA RecName: Full=Ribosome-binding factor A
 gi|61214803|sp|Q5ZRV5|RBFA_LEGPH RecName: Full=Ribosome-binding factor A
 gi|166218446|sp|A5IHU6|RBFA_LEGPC RecName: Full=Ribosome-binding factor A
 gi|52630081|gb|AAU28822.1| ribosome binding factor A [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53752540|emb|CAH13972.1| Ribosome-binding factor A [Legionella pneumophila str. Paris]
 gi|148282858|gb|ABQ56946.1| ribosome binding factor A [Legionella pneumophila str. Corby]
 gi|307611643|emb|CBX01329.1| ribosome-binding factor A [Legionella pneumophila 130b]
          Length = 123

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 4/115 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
              N +R  R+ E ++  L  +I   E +D  +    ++IS V ++ DL  A +Y ++  
Sbjct: 1   MSNNFKRTDRIAEMIQRKLALIIPQ-EIKDPRLKG-FVTISAVKVAADLGHAKIYFTVLN 58

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           +     V + LN    ++R  + RS+  LR VP+L F YD S++   +L+ L+  
Sbjct: 59  E-DKSVVTNILNGAASYLRSALARSI-TLRTVPQLHFIYDESIEYGQRLSRLIDE 111


>gi|51892661|ref|YP_075352.1| ribosome-binding factor A [Symbiobacterium thermophilum IAM 14863]
 gi|61214894|sp|Q67P85|RBFA_SYMTH RecName: Full=Ribosome-binding factor A
 gi|51856350|dbj|BAD40508.1| ribosome-binding factor A [Symbiobacterium thermophilum IAM 14863]
          Length = 125

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 60/108 (55%), Gaps = 5/108 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VSPD 69
           RA+RVGE++R  L   +L +E +D  I    +SI +V +S D+R A +Y+S+  +     
Sbjct: 6   RAIRVGEQMREELAQ-LLRDEVKDPRIG--FVSIVKVEVSRDIRHAKIYVSVLGNDQQKK 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
             ++ L     F+R  + + L  LRY+PEL F  D S++   ++  L+
Sbjct: 63  ETMAGLASATGFLRSELAKRL-QLRYMPELHFALDESIEHGQRIAQLL 109


>gi|225023302|ref|ZP_03712494.1| hypothetical protein EIKCOROL_00155 [Eikenella corrodens ATCC
           23834]
 gi|224943947|gb|EEG25156.1| hypothetical protein EIKCOROL_00155 [Eikenella corrodens ATCC
           23834]
          Length = 123

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 54/124 (43%), Gaps = 5/124 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M   +     R  RV E++   L   ++    +D       I+I+EV ++ D   ATVY 
Sbjct: 1   MAKTHRG-YARQDRVREQIMRELAE-LVRTGLKDPRAG--FITINEVELTRDYSHATVYY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++  D + +    AL      +R  + R ++  +  PEL F+YD SL+    ++ L+   
Sbjct: 57  TVLDDATREITAEALEHAKGHLRSELSRRIKLFK-TPELHFKYDQSLERGMSISQLIEQV 115

Query: 121 KIPV 124
               
Sbjct: 116 AAEE 119


>gi|330937948|gb|EGH41735.1| ribosome-binding factor A [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 138

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITAVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             S + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDSAEEIAQTIKVLNAAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|331648968|ref|ZP_08350056.1| ribosome-binding factor A [Escherichia coli M605]
 gi|331042715|gb|EGI14857.1| ribosome-binding factor A [Escherichia coli M605]
          Length = 133

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A VY++   
Sbjct: 1   MAKEFDRPQRVAQEMQKEIALILQR-EIKDPRL-GMMTTVSGVEMSRDLAYAKVYVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|66047406|ref|YP_237247.1| ribosome-binding factor A [Pseudomonas syringae pv. syringae B728a]
 gi|75500704|sp|Q4ZNR3|RBFA_PSEU2 RecName: Full=Ribosome-binding factor A
 gi|63258113|gb|AAY39209.1| Ribosome-binding factor A [Pseudomonas syringae pv. syringae B728a]
          Length = 138

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITAVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             S + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDSAEEIAQTIKVLNSAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|298368699|ref|ZP_06980017.1| ribosome-binding factor A [Neisseria sp. oral taxon 014 str. F0314]
 gi|298282702|gb|EFI24189.1| ribosome-binding factor A [Neisseria sp. oral taxon 014 str. F0314]
          Length = 123

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 55/124 (44%), Gaps = 5/124 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+I+EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITINEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++  D + D    AL      +R  + + ++  +  PEL F+YD SL+    +++L+   
Sbjct: 57  TVLDDSTRDITEEALEHAKGHLRSELAKRIKLFK-TPELHFKYDESLERGMSISSLIDQV 115

Query: 121 KIPV 124
               
Sbjct: 116 AAEK 119


>gi|332999246|gb|EGK18832.1| ribosome-binding factor A [Shigella flexneri K-272]
 gi|333014968|gb|EGK34312.1| ribosome-binding factor A [Shigella flexneri K-227]
          Length = 133

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A VY++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIALILQR-EIKDPRL-GMMTTVSSVEMSRDLAYAKVYVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|52080272|ref|YP_079063.1| ribosome-binding factor A [Bacillus licheniformis ATCC 14580]
 gi|52785649|ref|YP_091478.1| ribosome-binding factor A [Bacillus licheniformis ATCC 14580]
 gi|319645948|ref|ZP_08000178.1| ribosome-binding factor A [Bacillus sp. BT1B_CT2]
 gi|61214855|sp|Q65JH9|RBFA_BACLD RecName: Full=Ribosome-binding factor A
 gi|52003483|gb|AAU23425.1| ribosome-binding factor A [Bacillus licheniformis ATCC 14580]
 gi|52348151|gb|AAU40785.1| RbfA [Bacillus licheniformis ATCC 14580]
 gi|317391698|gb|EFV72495.1| ribosome-binding factor A [Bacillus sp. BT1B_CT2]
          Length = 117

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           RA RVGE+++  L  +I   + +D  I    +++++V +S DL++A VYIS+  D    +
Sbjct: 4   RATRVGEQMKKELGDIIGR-KLKDPRIG--FLTVTDVRVSGDLQIAKVYISVLGDEKKRE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             +  L     FIR  +G  +R LR  PE+ F +D S+    ++  L+         
Sbjct: 61  ETLKGLAKAKGFIRSELGNRIR-LRKTPEIHFEFDESIDYGNRIETLIHELNANKEE 116


>gi|330950304|gb|EGH50564.1| ribosome-binding factor A [Pseudomonas syringae Cit 7]
          Length = 138

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITAVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             S + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDSAEEIAQTIKVLNAAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|30021900|ref|NP_833531.1| ribosome-binding factor A [Bacillus cereus ATCC 14579]
 gi|163941548|ref|YP_001646432.1| ribosome-binding factor A [Bacillus weihenstephanensis KBAB4]
 gi|206972662|ref|ZP_03233603.1| ribosome-binding factor A [Bacillus cereus AH1134]
 gi|218235779|ref|YP_002368612.1| ribosome-binding factor A [Bacillus cereus B4264]
 gi|218898963|ref|YP_002447374.1| ribosome-binding factor A [Bacillus cereus G9842]
 gi|228902314|ref|ZP_04066471.1| Ribosome-binding factor A [Bacillus thuringiensis IBL 4222]
 gi|228909635|ref|ZP_04073458.1| Ribosome-binding factor A [Bacillus thuringiensis IBL 200]
 gi|228922565|ref|ZP_04085865.1| Ribosome-binding factor A [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228940899|ref|ZP_04103458.1| Ribosome-binding factor A [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228954087|ref|ZP_04116116.1| Ribosome-binding factor A [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228960027|ref|ZP_04121691.1| Ribosome-binding factor A [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228966756|ref|ZP_04127800.1| Ribosome-binding factor A [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228973828|ref|ZP_04134404.1| Ribosome-binding factor A [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228980417|ref|ZP_04140727.1| Ribosome-binding factor A [Bacillus thuringiensis Bt407]
 gi|229012994|ref|ZP_04170159.1| Ribosome-binding factor A [Bacillus mycoides DSM 2048]
 gi|229047497|ref|ZP_04193087.1| Ribosome-binding factor A [Bacillus cereus AH676]
 gi|229061414|ref|ZP_04198759.1| Ribosome-binding factor A [Bacillus cereus AH603]
 gi|229071309|ref|ZP_04204532.1| Ribosome-binding factor A [Bacillus cereus F65185]
 gi|229081066|ref|ZP_04213576.1| Ribosome-binding factor A [Bacillus cereus Rock4-2]
 gi|229111282|ref|ZP_04240835.1| Ribosome-binding factor A [Bacillus cereus Rock1-15]
 gi|229129087|ref|ZP_04258060.1| Ribosome-binding factor A [Bacillus cereus BDRD-Cer4]
 gi|229134618|ref|ZP_04263428.1| Ribosome-binding factor A [Bacillus cereus BDRD-ST196]
 gi|229146382|ref|ZP_04274753.1| Ribosome-binding factor A [Bacillus cereus BDRD-ST24]
 gi|229152010|ref|ZP_04280205.1| Ribosome-binding factor A [Bacillus cereus m1550]
 gi|229168550|ref|ZP_04296273.1| Ribosome-binding factor A [Bacillus cereus AH621]
 gi|229180087|ref|ZP_04307431.1| Ribosome-binding factor A [Bacillus cereus 172560W]
 gi|229191980|ref|ZP_04318950.1| Ribosome-binding factor A [Bacillus cereus ATCC 10876]
 gi|296504306|ref|YP_003666006.1| ribosome-binding factor A [Bacillus thuringiensis BMB171]
 gi|33301481|sp|Q819Y8|RBFA_BACCR RecName: Full=Ribosome-binding factor A
 gi|226723592|sp|A9VT48|RBFA_BACWK RecName: Full=Ribosome-binding factor A
 gi|226736636|sp|B7IUG9|RBFA_BACC2 RecName: Full=Ribosome-binding factor A
 gi|226736637|sp|B7HDT4|RBFA_BACC4 RecName: Full=Ribosome-binding factor A
 gi|29897456|gb|AAP10732.1| Ribosome-binding factor A [Bacillus cereus ATCC 14579]
 gi|163863745|gb|ABY44804.1| ribosome-binding factor A [Bacillus weihenstephanensis KBAB4]
 gi|206732419|gb|EDZ49600.1| ribosome-binding factor A [Bacillus cereus AH1134]
 gi|218163736|gb|ACK63728.1| ribosome-binding factor A [Bacillus cereus B4264]
 gi|218545696|gb|ACK98090.1| ribosome-binding factor A [Bacillus cereus G9842]
 gi|228591531|gb|EEK49380.1| Ribosome-binding factor A [Bacillus cereus ATCC 10876]
 gi|228603296|gb|EEK60773.1| Ribosome-binding factor A [Bacillus cereus 172560W]
 gi|228614956|gb|EEK72058.1| Ribosome-binding factor A [Bacillus cereus AH621]
 gi|228631359|gb|EEK87993.1| Ribosome-binding factor A [Bacillus cereus m1550]
 gi|228637015|gb|EEK93474.1| Ribosome-binding factor A [Bacillus cereus BDRD-ST24]
 gi|228648879|gb|EEL04904.1| Ribosome-binding factor A [Bacillus cereus BDRD-ST196]
 gi|228654324|gb|EEL10189.1| Ribosome-binding factor A [Bacillus cereus BDRD-Cer4]
 gi|228672058|gb|EEL27349.1| Ribosome-binding factor A [Bacillus cereus Rock1-15]
 gi|228702110|gb|EEL54586.1| Ribosome-binding factor A [Bacillus cereus Rock4-2]
 gi|228711763|gb|EEL63715.1| Ribosome-binding factor A [Bacillus cereus F65185]
 gi|228717837|gb|EEL69485.1| Ribosome-binding factor A [Bacillus cereus AH603]
 gi|228723744|gb|EEL75099.1| Ribosome-binding factor A [Bacillus cereus AH676]
 gi|228748248|gb|EEL98108.1| Ribosome-binding factor A [Bacillus mycoides DSM 2048]
 gi|228779237|gb|EEM27494.1| Ribosome-binding factor A [Bacillus thuringiensis Bt407]
 gi|228785853|gb|EEM33856.1| Ribosome-binding factor A [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228792855|gb|EEM40413.1| Ribosome-binding factor A [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228799543|gb|EEM46496.1| Ribosome-binding factor A [Bacillus thuringiensis serovar pakistani
           str. T13001]
 gi|228805653|gb|EEM52243.1| Ribosome-binding factor A [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228818735|gb|EEM64801.1| Ribosome-binding factor A [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228836994|gb|EEM82335.1| Ribosome-binding factor A [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228849924|gb|EEM94755.1| Ribosome-binding factor A [Bacillus thuringiensis IBL 200]
 gi|228857283|gb|EEN01786.1| Ribosome-binding factor A [Bacillus thuringiensis IBL 4222]
 gi|296325358|gb|ADH08286.1| ribosome-binding factor A [Bacillus thuringiensis BMB171]
 gi|326941577|gb|AEA17473.1| ribosome-binding factor A [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 118

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA RVGE+++  L  +I   + +D  I    +++++V +S DL++A VYIS+  D    +
Sbjct: 4   RANRVGEQMKKELGDIISR-KIKDPRIG--FVTVTDVQVSGDLQIAKVYISVLGDEEQKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             +  L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+   +I    ++
Sbjct: 61  NTLKGLAKAKGFIRSEIGQRIR-LRKTPEITFEFDESIGYGHRIDTLLH--EINKDGKR 116


>gi|67922611|ref|ZP_00516117.1| Ribosome-binding factor A [Crocosphaera watsonii WH 8501]
 gi|67855539|gb|EAM50792.1| Ribosome-binding factor A [Crocosphaera watsonii WH 8501]
          Length = 147

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 58/121 (47%), Gaps = 3/121 (2%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K  N  NSRR  RV   ++  +  ++L  + +D  +   ++S++ V +S DL+ A +++S
Sbjct: 15  KGANMANSRRVSRVSSLIKREISQMLL-FDIKDDRVGSGMVSVTNVYVSGDLQHAKIFVS 73

Query: 62  LPLDVSPD-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +          +  L  +  ++R  +   +R LR  PE+ F  D  ++   K+  L+   
Sbjct: 74  IYGTEEAKIETMEGLKSSEGYVRKELAHRIR-LRRAPEVTFFEDHGIERGDKMLHLLDEI 132

Query: 121 K 121
           +
Sbjct: 133 R 133


>gi|167552067|ref|ZP_02345820.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|168243119|ref|ZP_02668051.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|168262704|ref|ZP_02684677.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168463492|ref|ZP_02697409.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|194446175|ref|YP_002042542.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194448489|ref|YP_002047314.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197263114|ref|ZP_03163188.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|238690662|sp|B4TJ05|RBFA_SALHS RecName: Full=Ribosome-binding factor A
 gi|238693632|sp|B4T6Z7|RBFA_SALNS RecName: Full=Ribosome-binding factor A
 gi|194404838|gb|ACF65060.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194406793|gb|ACF67012.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|195633310|gb|EDX51724.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197241369|gb|EDY23989.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|205323213|gb|EDZ11052.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205337734|gb|EDZ24498.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|205348416|gb|EDZ35047.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 133

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V MS DL  A V+++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIA-IILQREIKDPRL-GMMTTVSGVEMSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V +   AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DQDEAAVKNGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTNV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|28871623|ref|NP_794242.1| ribosome-binding factor A [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213966646|ref|ZP_03394797.1| ribosome-binding factor A [Pseudomonas syringae pv. tomato T1]
 gi|301383156|ref|ZP_07231574.1| ribosome-binding factor A [Pseudomonas syringae pv. tomato Max13]
 gi|302063409|ref|ZP_07254950.1| ribosome-binding factor A [Pseudomonas syringae pv. tomato K40]
 gi|302133782|ref|ZP_07259772.1| ribosome-binding factor A [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|32171593|sp|Q87WQ6|RBFA_PSESM RecName: Full=Ribosome-binding factor A
 gi|28854875|gb|AAO57937.1| ribosome-binding factor A [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213928496|gb|EEB62040.1| ribosome-binding factor A [Pseudomonas syringae pv. tomato T1]
 gi|330963976|gb|EGH64236.1| ribosome-binding factor A [Pseudomonas syringae pv. actinidiae str.
           M302091]
 gi|331016649|gb|EGH96705.1| ribosome-binding factor A [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 138

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITAVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             + + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDNAEDIAQTIKVLNAAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAQD 119


>gi|228992539|ref|ZP_04152466.1| Ribosome-binding factor A [Bacillus pseudomycoides DSM 12442]
 gi|228767173|gb|EEM15809.1| Ribosome-binding factor A [Bacillus pseudomycoides DSM 12442]
          Length = 117

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VSPD 69
           RA RVGE+++  L  +I   + +D  I    +++++V +S DL++A VYIS+  D    +
Sbjct: 4   RANRVGEQMKKELGEIISR-KIKDPRIG--FVTVTDVQVSGDLQIAKVYISVLGDEQQKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             +  L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+   +I    ++
Sbjct: 61  NTLKGLAKAKGFIRAEIGQRIR-LRKTPEITFEFDESIAYGHRIDTLLH--EINKDGKR 116


>gi|242240748|ref|YP_002988929.1| ribosome-binding factor A [Dickeya dadantii Ech703]
 gi|242132805|gb|ACS87107.1| ribosome-binding factor A [Dickeya dadantii Ech703]
          Length = 132

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 66/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV +E++  +  +I+  E +D  +   + ++S V +S DL  A V+++   
Sbjct: 1   MAREFSRTQRVAQEMQKEIA-IIIQREIKDPRVG--MATVSSVDVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D  P+++   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 58  DNEPEQIKLGIKALQDASGFIRMLLGKAMR-LRIVPELTFAYDNSLVEGMRMSNLVSNV- 115

Query: 122 IPVALEK 128
           +    E+
Sbjct: 116 VKRDAER 122


>gi|16762050|ref|NP_457667.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29143539|ref|NP_806881.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56415217|ref|YP_152292.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62181796|ref|YP_218213.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161616291|ref|YP_001590256.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|168819646|ref|ZP_02831646.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|197247816|ref|YP_002148211.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197364147|ref|YP_002143784.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|204928299|ref|ZP_03219499.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|213029804|ref|ZP_03344251.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. 404ty]
 gi|213052980|ref|ZP_03345858.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213416951|ref|ZP_03350095.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213425435|ref|ZP_03358185.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213582314|ref|ZP_03364140.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213620436|ref|ZP_03373262.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213646147|ref|ZP_03376200.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213852745|ref|ZP_03382277.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224585083|ref|YP_002638882.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238910080|ref|ZP_04653917.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|289810349|ref|ZP_06540978.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289825799|ref|ZP_06544967.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|20978598|sp|Q8Z3H8|RBFA_SALTI RecName: Full=Ribosome-binding factor A
 gi|61214734|sp|Q5PLB1|RBFA_SALPA RecName: Full=Ribosome-binding factor A
 gi|75480587|sp|Q57JI0|RBFA_SALCH RecName: Full=Ribosome-binding factor A
 gi|189039556|sp|A9N731|RBFA_SALPB RecName: Full=Ribosome-binding factor A
 gi|226723607|sp|B5F6T7|RBFA_SALA4 RecName: Full=Ribosome-binding factor A
 gi|238690733|sp|B5BGJ4|RBFA_SALPK RecName: Full=Ribosome-binding factor A
 gi|254789762|sp|C0PZ53|RBFA_SALPC RecName: Full=Ribosome-binding factor A
 gi|25302109|pir||AG0901 ribosome-binding factor A (P15B protein) [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16504353|emb|CAD07805.1| ribosome-binding factor A (P15B protein) [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29139173|gb|AAO70741.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56129474|gb|AAV78980.1| ribosome-binding factor A (P15B protein) [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129429|gb|AAX67132.1| tRNA pseudouridine 5S synthase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161365655|gb|ABX69423.1| hypothetical protein SPAB_04097 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197095624|emb|CAR61192.1| ribosome-binding factor A (P15B protein) [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|197211519|gb|ACH48916.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|204322621|gb|EDZ07818.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|205343329|gb|EDZ30093.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|224469611|gb|ACN47441.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|320087732|emb|CBY97496.1| Ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|322716283|gb|EFZ07854.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 133

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A V+++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIALILQR-EIKDPRV-GMMTTVSGVEMSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V +   AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DQDEAAVKNGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTNV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|49478390|ref|YP_037872.1| ribosome-binding factor A [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|52141678|ref|YP_085152.1| ribosome-binding factor A [Bacillus cereus E33L]
 gi|118479031|ref|YP_896182.1| ribosome-binding factor A [Bacillus thuringiensis str. Al Hakam]
 gi|196042166|ref|ZP_03109449.1| ribosome-binding factor A [Bacillus cereus NVH0597-99]
 gi|196044539|ref|ZP_03111774.1| ribosome-binding factor A [Bacillus cereus 03BB108]
 gi|225865790|ref|YP_002751168.1| ribosome-binding factor A [Bacillus cereus 03BB102]
 gi|229092851|ref|ZP_04223985.1| Ribosome-binding factor A [Bacillus cereus Rock3-42]
 gi|229186048|ref|ZP_04313218.1| Ribosome-binding factor A [Bacillus cereus BGSC 6E1]
 gi|301055301|ref|YP_003793512.1| ribosome-binding factor A [Bacillus anthracis CI]
 gi|61214843|sp|Q636L5|RBFA_BACCZ RecName: Full=Ribosome-binding factor A
 gi|61215017|sp|Q6HF04|RBFA_BACHK RecName: Full=Ribosome-binding factor A
 gi|166218421|sp|A0RHI2|RBFA_BACAH RecName: Full=Ribosome-binding factor A
 gi|254789732|sp|C1EP33|RBFA_BACC3 RecName: Full=Ribosome-binding factor A
 gi|49329946|gb|AAT60592.1| ribosome-binding factor A [Bacillus thuringiensis serovar konkukian
           str. 97-27]
 gi|51975147|gb|AAU16697.1| ribosome-binding factor A [Bacillus cereus E33L]
 gi|118418256|gb|ABK86675.1| ribosome-binding factor A [Bacillus thuringiensis str. Al Hakam]
 gi|196024574|gb|EDX63246.1| ribosome-binding factor A [Bacillus cereus 03BB108]
 gi|196027018|gb|EDX65642.1| ribosome-binding factor A [Bacillus cereus NVH0597-99]
 gi|225790371|gb|ACO30588.1| ribosome-binding factor A [Bacillus cereus 03BB102]
 gi|228597467|gb|EEK55117.1| Ribosome-binding factor A [Bacillus cereus BGSC 6E1]
 gi|228690473|gb|EEL44256.1| Ribosome-binding factor A [Bacillus cereus Rock3-42]
 gi|300377470|gb|ADK06374.1| ribosome-binding factor A [Bacillus cereus biovar anthracis str.
           CI]
          Length = 118

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA RVGE+++  L  +I   + +D  +    +++++V +S DL++ATVYIS+  D    +
Sbjct: 4   RANRVGEQMKKELGDIISR-KIKDPRVG--FVTVTDVQVSGDLQIATVYISVLGDEEQKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             +  L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+    I    ++
Sbjct: 61  NTLKGLAKAKGFIRSEIGQRIR-LRKTPEISFEFDESIGYGHRIDTLLHQ--INKDGKR 116


>gi|218782568|ref|YP_002433886.1| ribosome-binding factor A [Desulfatibacillum alkenivorans AK-01]
 gi|226736643|sp|B8FCY7|RBFA_DESAA RecName: Full=Ribosome-binding factor A
 gi|218763952|gb|ACL06418.1| ribosome-binding factor A [Desulfatibacillum alkenivorans AK-01]
          Length = 123

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD- 69
           R  RV   ++  L  +I      D  +     +I+ V M+ DL++A VY  +  +     
Sbjct: 6   RQDRVAGRIQQELSALIQKR-INDPRLEWA--TITGVKMTKDLKIARVYYCVFGEEEKKI 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +V  A      FI+  + + L  LRY+PEL F +D S     K+ +++   
Sbjct: 63  KVGEAFQQAHGFIKRELAKKL-GLRYMPELEFFFDESFDYGRKIESILREI 112


>gi|330969653|gb|EGH69719.1| ribosome-binding factor A [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 138

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITAVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             S + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDSSEEIAQTIKVLNSAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|253686987|ref|YP_003016177.1| ribosome-binding factor A [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259552038|sp|C6DKK4|RBFA_PECCP RecName: Full=Ribosome-binding factor A
 gi|251753565|gb|ACT11641.1| ribosome-binding factor A [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 132

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 65/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +I+  E +D  I   + ++S V +S DL  A V+++   
Sbjct: 1   MAKEFSRTQRVAQEMQKEIA-IIIQREVKDPRIG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRVISALN---CNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D  P++V +AL        FIR  +G+++R LR VP L F YD SL    +++ L+    
Sbjct: 58  DNEPEQVKTALKALQDASGFIRTLVGKAMR-LRVVPALTFSYDNSLVEGMRMSNLVTNV- 115

Query: 122 IPVALEK 128
           +    E+
Sbjct: 116 VRNDTER 122


>gi|171769878|sp|A7MQE0|RBFA_ENTS8 RecName: Full=Ribosome-binding factor A
          Length = 133

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V +S DL  A V+++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIA-IILQREIKDPRV-GLMTTVSGVEVSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEAAVKAGIKALQDASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|295399855|ref|ZP_06809836.1| ribosome-binding factor A [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312111633|ref|YP_003989949.1| ribosome-binding factor A [Geobacillus sp. Y4.1MC1]
 gi|294978258|gb|EFG53855.1| ribosome-binding factor A [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311216734|gb|ADP75338.1| ribosome-binding factor A [Geobacillus sp. Y4.1MC1]
          Length = 126

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           RA RVGE+++  L  +I   + +D  I    +++++V ++ DL+ A VYIS+  D     
Sbjct: 4   RATRVGEQMKKELSDIIGR-KLKDPRIG--FVTVTDVRVTGDLQQAKVYISIFGDEEQRQ 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  L     FIR  IG+ +R LR  PE+ F  D S++   ++  L+   
Sbjct: 61  NTLKGLEKAKGFIRSEIGQRIR-LRKTPEIFFEIDESIEYGTRIEQLIRQI 110


>gi|152972091|ref|YP_001337237.1| ribosome-binding factor A [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|206575945|ref|YP_002236422.1| ribosome-binding factor A [Klebsiella pneumoniae 342]
 gi|238896674|ref|YP_002921419.1| ribosome-binding factor A [Klebsiella pneumoniae NTUH-K2044]
 gi|262042725|ref|ZP_06015879.1| ribosome-binding factor A [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288933405|ref|YP_003437464.1| ribosome-binding factor A [Klebsiella variicola At-22]
 gi|290511544|ref|ZP_06550913.1| ribosome-binding factor A [Klebsiella sp. 1_1_55]
 gi|329997776|ref|ZP_08302915.1| ribosome-binding factor A [Klebsiella sp. MS 92-3]
 gi|166218444|sp|A6TEI6|RBFA_KLEP7 RecName: Full=Ribosome-binding factor A
 gi|226723604|sp|B5XSX5|RBFA_KLEP3 RecName: Full=Ribosome-binding factor A
 gi|150956940|gb|ABR78970.1| ribosome-binding factor A [Klebsiella pneumoniae subsp. pneumoniae
           MGH 78578]
 gi|206565003|gb|ACI06779.1| ribosome-binding factor A [Klebsiella pneumoniae 342]
 gi|238549001|dbj|BAH65352.1| ribosome-binding factor A [Klebsiella pneumoniae subsp. pneumoniae
           NTUH-K2044]
 gi|259039950|gb|EEW41067.1| ribosome-binding factor A [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288888134|gb|ADC56452.1| ribosome-binding factor A [Klebsiella variicola At-22]
 gi|289776537|gb|EFD84536.1| ribosome-binding factor A [Klebsiella sp. 1_1_55]
 gi|328538910|gb|EGF64971.1| ribosome-binding factor A [Klebsiella sp. MS 92-3]
          Length = 133

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V MS DL  A VY++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIA-IILQREIKDPRL-GMMTTVSGVEMSRDLAYAKVYVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEAAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDDER 123


>gi|229098280|ref|ZP_04229227.1| Ribosome-binding factor A [Bacillus cereus Rock3-29]
 gi|229104373|ref|ZP_04235042.1| Ribosome-binding factor A [Bacillus cereus Rock3-28]
 gi|229117297|ref|ZP_04246675.1| Ribosome-binding factor A [Bacillus cereus Rock1-3]
 gi|228666197|gb|EEL21661.1| Ribosome-binding factor A [Bacillus cereus Rock1-3]
 gi|228679071|gb|EEL33279.1| Ribosome-binding factor A [Bacillus cereus Rock3-28]
 gi|228685178|gb|EEL39109.1| Ribosome-binding factor A [Bacillus cereus Rock3-29]
          Length = 118

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA RVGE+++  L  +I   + +D  +    +++++V +S DL++A VYIS+  D    +
Sbjct: 4   RANRVGEQMKKELGDIISR-KIKDPRVG--FVTVTDVQVSGDLQIAKVYISVLGDDEQKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             +  L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+   +I    ++
Sbjct: 61  STLKGLAKAKGFIRSEIGQRIR-LRKTPEISFEFDESIGYGHRIDTLLH--EINKDGKR 116


>gi|229525297|ref|ZP_04414702.1| ribosome-binding factor A [Vibrio cholerae bv. albensis VL426]
 gi|229338878|gb|EEO03895.1| ribosome-binding factor A [Vibrio cholerae bv. albensis VL426]
          Length = 136

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 36/130 (27%), Positives = 68/130 (52%), Gaps = 10/130 (7%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+N  PK   R+ RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V++
Sbjct: 1   MRNDMPKEFSRSQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFV 57

Query: 61  SLP--LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL-- 116
           +     + +P+  + AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L  
Sbjct: 58  TFLCIGEQTPESCLEALREHEVQIRMMLGKQIR-LRLTPEVRFYYDNTLVEGMRMSNLVT 116

Query: 117 --MCLPKIPV 124
             +   K   
Sbjct: 117 EVINSDKRRK 126


>gi|71736021|ref|YP_276310.1| ribosome-binding factor A [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|257482260|ref|ZP_05636301.1| ribosome-binding factor A [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289627534|ref|ZP_06460488.1| ribosome-binding factor A [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289646962|ref|ZP_06478305.1| ribosome-binding factor A [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|298488457|ref|ZP_07006488.1| Ribosome-binding factor A [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|123635189|sp|Q48E78|RBFA_PSE14 RecName: Full=Ribosome-binding factor A
 gi|71556574|gb|AAZ35785.1| ribosome-binding factor A [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|298157082|gb|EFH98171.1| Ribosome-binding factor A [Pseudomonas savastanoi pv. savastanoi
           NCPPB 3335]
 gi|320322527|gb|EFW78620.1| ribosome-binding factor A [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320330004|gb|EFW85991.1| ribosome-binding factor A [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330868247|gb|EGH02956.1| ribosome-binding factor A [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330987056|gb|EGH85159.1| ribosome-binding factor A [Pseudomonas syringae pv. lachrymans str.
           M301315]
          Length = 138

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITAVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             S + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDSAEEIAQTIKVLNSAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAQD 119


>gi|260596203|ref|YP_003208774.1| ribosome-binding factor A [Cronobacter turicensis z3032]
 gi|260215380|emb|CBA27405.1| Ribosome-binding factor A [Cronobacter turicensis z3032]
          Length = 133

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V +S DL  A V+++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIA-IILQREIKDPRV-GLMTTVSGVEVSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDDAAVKAGIKALQDASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|237730087|ref|ZP_04560568.1| ribosome-binding factor A [Citrobacter sp. 30_2]
 gi|226908693|gb|EEH94611.1| ribosome-binding factor A [Citrobacter sp. 30_2]
          Length = 140

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A V+++   
Sbjct: 7   MAKEFGRPQRVAQEMQKEIALILQR-EIKDPRV-GMMTTVSGVEMSRDLAYAKVFVTFLN 64

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V +   AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 65  DQDEAAVKNGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 122

Query: 122 IPVALEK 128
           +    E+
Sbjct: 123 VKHDDER 129


>gi|299534738|ref|ZP_07048068.1| ribosome-binding factor A [Lysinibacillus fusiformis ZC1]
 gi|298729826|gb|EFI70371.1| ribosome-binding factor A [Lysinibacillus fusiformis ZC1]
          Length = 113

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 62/113 (54%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VS 67
           S R+ RV E+++  L  ++   + +D  +    ++++ V ++ DL+ AT+YI+   +   
Sbjct: 2   SLRSNRVAEQMKKELGDILGR-KIKDPRVG--FVTVTGVEVTGDLQQATIYITSLGNERE 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +  + AL     FIR  IG  +R LR  PEL F +D+S++   ++++L+   
Sbjct: 59  REETLKALVKASGFIRSEIGSRIR-LRRTPELIFEFDSSIEYGNRIDSLLRDL 110


>gi|302392346|ref|YP_003828166.1| ribosome-binding factor A [Acetohalobium arabaticum DSM 5501]
 gi|302204423|gb|ADL13101.1| ribosome-binding factor A [Acetohalobium arabaticum DSM 5501]
          Length = 122

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  RV E ++  +  ++   E +D  I    ++I++V +S DLR A V++S+    
Sbjct: 1   MGNYRPRRVAELIKKEVSQMLQQ-EIKDPRIG--FVTITDVEVSEDLRHAKVFVSVLDAE 57

Query: 67  S-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              +  +  L   + +IR  +G+ +R LR+ PE+ FRYD S++   ++  ++        
Sbjct: 58  ETKEETMEGLENAVGYIRRELGQRIR-LRHTPEILFRYDDSIKRGARIFEILKDLD--QD 114

Query: 126 LEK 128
            ++
Sbjct: 115 EKE 117


>gi|167635838|ref|ZP_02394147.1| ribosome-binding factor A [Bacillus anthracis str. A0442]
 gi|170687860|ref|ZP_02879074.1| ribosome-binding factor A [Bacillus anthracis str. A0465]
 gi|218904938|ref|YP_002452772.1| ribosome-binding factor A [Bacillus cereus AH820]
 gi|228916448|ref|ZP_04080014.1| Ribosome-binding factor A [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228928859|ref|ZP_04091891.1| Ribosome-binding factor A [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228935125|ref|ZP_04097952.1| Ribosome-binding factor A [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228947530|ref|ZP_04109820.1| Ribosome-binding factor A [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|229123324|ref|ZP_04252528.1| Ribosome-binding factor A [Bacillus cereus 95/8201]
 gi|254683482|ref|ZP_05147342.1| ribosome-binding factor A [Bacillus anthracis str. CNEVA-9066]
 gi|254722003|ref|ZP_05183792.1| ribosome-binding factor A [Bacillus anthracis str. A1055]
 gi|254739625|ref|ZP_05197319.1| ribosome-binding factor A [Bacillus anthracis str. Kruger B]
 gi|226736635|sp|B7JJ88|RBFA_BACC0 RecName: Full=Ribosome-binding factor A
 gi|167528795|gb|EDR91553.1| ribosome-binding factor A [Bacillus anthracis str. A0442]
 gi|170668176|gb|EDT18925.1| ribosome-binding factor A [Bacillus anthracis str. A0465]
 gi|218535717|gb|ACK88115.1| ribosome-binding factor A [Bacillus cereus AH820]
 gi|228660100|gb|EEL15736.1| Ribosome-binding factor A [Bacillus cereus 95/8201]
 gi|228812050|gb|EEM58381.1| Ribosome-binding factor A [Bacillus thuringiensis serovar monterrey
           BGSC 4AJ1]
 gi|228824490|gb|EEM70295.1| Ribosome-binding factor A [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228830666|gb|EEM76271.1| Ribosome-binding factor A [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228843027|gb|EEM88109.1| Ribosome-binding factor A [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 118

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA RVGE+++  L  +I   + +D  +    +++++V +S DL++ATVYIS+  D    +
Sbjct: 4   RANRVGEQMKKELGDIISR-KIKDPRVG--FVTVTDVQVSGDLQIATVYISVLGDEEQKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+   
Sbjct: 61  NTLKGLAKAKGFIRSEIGQRIR-LRKTPEISFEFDESIGYGHRIDTLLHEI 110


>gi|47569088|ref|ZP_00239777.1| ribosome-binding factor A [Bacillus cereus G9241]
 gi|228986954|ref|ZP_04147080.1| Ribosome-binding factor A [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|229157387|ref|ZP_04285465.1| Ribosome-binding factor A [Bacillus cereus ATCC 4342]
 gi|229174477|ref|ZP_04302009.1| Ribosome-binding factor A [Bacillus cereus MM3]
 gi|47554250|gb|EAL12612.1| ribosome-binding factor A [Bacillus cereus G9241]
 gi|228609037|gb|EEK66327.1| Ribosome-binding factor A [Bacillus cereus MM3]
 gi|228626114|gb|EEK82863.1| Ribosome-binding factor A [Bacillus cereus ATCC 4342]
 gi|228772732|gb|EEM21172.1| Ribosome-binding factor A [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|324327705|gb|ADY22965.1| ribosome-binding factor A [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 118

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA RVGE+++  L  +I   + +D  +    +++++V +S DL++ATVYIS+  D    +
Sbjct: 4   RANRVGEQMKKELGDIISR-KIKDPRVG--FVTVTDVQVSGDLQIATVYISVLGDEEQKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             +  L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+    I    ++
Sbjct: 61  STLKGLAKAKGFIRSEIGQRIR-LRKTPEISFEFDESIGYGHRIDTLLHQ--INKDGKR 116


>gi|90412486|ref|ZP_01220489.1| putative ribosome-binding factor A [Photobacterium profundum 3TCK]
 gi|90326523|gb|EAS42929.1| putative ribosome-binding factor A [Photobacterium profundum 3TCK]
          Length = 134

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 60/126 (47%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   + +IS V +S D+  A V+++   
Sbjct: 1   MAKEFSRTQRVAQQLQKELAVILQR-ELKDPRVG--MTTISSVEVSRDMCYAKVFVTFFT 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +    ++ L     +IR  +G+ +R LR  PEL F +D SL    +++ L+    +
Sbjct: 58  IGEQTAKGSLAVLREMAPYIRSLLGKQIR-LRVTPELTFIFDESLTEGMRISNLVSN-AV 115

Query: 123 PVALEK 128
               E+
Sbjct: 116 RDDEER 121


>gi|270265060|ref|ZP_06193323.1| ribosome-binding factor A [Serratia odorifera 4Rx13]
 gi|270040994|gb|EFA14095.1| ribosome-binding factor A [Serratia odorifera 4Rx13]
          Length = 136

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 63/131 (48%), Gaps = 12/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  I   + ++S V +S DL  A VY++   
Sbjct: 1   MAKEFSRGQRVAQEMQKEIA-IILQREVKDPRIG--MATVSGVEVSRDLAYAKVYVTFLN 57

Query: 65  DVSPDRVIS-------ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
            ++ +           AL     +IR  +G+++R LR VPEL F YD SL    +++ L+
Sbjct: 58  VLTENADPDLVPKGIKALEDASGYIRTLLGKAMR-LRVVPELTFAYDNSLVEGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               +    E+
Sbjct: 117 -TNVVKNDAER 126


>gi|168237986|ref|ZP_02663044.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194737644|ref|YP_002116234.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|238693707|sp|B4TWD6|RBFA_SALSV RecName: Full=Ribosome-binding factor A
 gi|194713146|gb|ACF92367.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197289067|gb|EDY28436.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 133

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V MS DL  A V+++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIA-IILQREIKDPRL-GMMTTVSGVEMSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLV-TNV 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|295097656|emb|CBK86746.1| ribosome-binding factor A [Enterobacter cloacae subsp. cloacae NCTC
           9394]
          Length = 134

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 38/127 (29%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A V+++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIALILQR-EIKDPRV-GMMTTVSGVEMSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V +   AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DQDEDAVKNGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDDER 123


>gi|16766583|ref|NP_462198.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167990150|ref|ZP_02571250.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168231894|ref|ZP_02656952.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194470716|ref|ZP_03076700.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|198243121|ref|YP_002217258.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200387117|ref|ZP_03213729.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205354189|ref|YP_002227990.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858535|ref|YP_002245186.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|20978604|sp|Q8ZLT1|RBFA_SALTY RecName: Full=Ribosome-binding factor A
 gi|226723608|sp|B5FI12|RBFA_SALDC RecName: Full=Ribosome-binding factor A
 gi|226723609|sp|B5QZV7|RBFA_SALEP RecName: Full=Ribosome-binding factor A
 gi|226723610|sp|B5REN5|RBFA_SALG2 RecName: Full=Ribosome-binding factor A
 gi|16421844|gb|AAL22157.1| ribosome-binding factor [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|194457080|gb|EDX45919.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|197937637|gb|ACH74970.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199604215|gb|EDZ02760.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205273970|emb|CAR38975.1| ribosome-binding factor A (P15B protein) [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205331145|gb|EDZ17909.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205333937|gb|EDZ20701.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|206710338|emb|CAR34696.1| ribosome-binding factor A (P15B protein) [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|261248451|emb|CBG26288.1| ribosome-binding factor A (P15B protein) [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267995482|gb|ACY90367.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159835|emb|CBW19354.1| ribosome-binding factor A (P15B protein) [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312914311|dbj|BAJ38285.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321225969|gb|EFX51023.1| Ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|322615290|gb|EFY12211.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618351|gb|EFY15242.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322622844|gb|EFY19688.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626834|gb|EFY23631.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631403|gb|EFY28163.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635330|gb|EFY32044.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643465|gb|EFY40028.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322647099|gb|EFY43600.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322648902|gb|EFY45347.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322655094|gb|EFY51405.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657697|gb|EFY53965.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664193|gb|EFY60391.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322667476|gb|EFY63638.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322674724|gb|EFY70816.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675643|gb|EFY71716.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322682279|gb|EFY78302.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322684882|gb|EFY80880.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323131645|gb|ADX19075.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323191871|gb|EFZ77119.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323199030|gb|EFZ84127.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323204270|gb|EFZ89279.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207617|gb|EFZ92564.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211330|gb|EFZ96174.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323214728|gb|EFZ99477.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221208|gb|EGA05634.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323224051|gb|EGA08344.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230300|gb|EGA14419.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233276|gb|EGA17370.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323239313|gb|EGA23363.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242436|gb|EGA26462.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323246946|gb|EGA30912.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323254121|gb|EGA37941.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323255238|gb|EGA39015.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262701|gb|EGA46257.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264011|gb|EGA47519.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323269397|gb|EGA52852.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326625036|gb|EGE31381.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326629310|gb|EGE35653.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332990143|gb|AEF09126.1| ribosome-binding factor A [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 133

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V MS DL  A V+++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIA-IILQREIKDPRL-GMMTTVSGVEMSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   D V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLV-TNV 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDEER 123


>gi|313668519|ref|YP_004048803.1| ribosomal-binding factor A [Neisseria lactamica ST-640]
 gi|308389491|gb|ADO31811.1| ribosomal-binding factor A [Neisseria meningitidis alpha710]
 gi|309378865|emb|CBX22570.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313005981|emb|CBN87438.1| ribosomal-binding factor A [Neisseria lactamica 020-06]
          Length = 123

 Score =  106 bits (266), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+++EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITVNEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TVLNQDAREITEEVLEHARGHLRSELAKRIKLFK-IPELHFKYDESLERGMNLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|212639519|ref|YP_002316039.1| ribosome-binding factor A [Anoxybacillus flavithermus WK1]
 gi|212560999|gb|ACJ34054.1| Ribosome-binding factor A [Anoxybacillus flavithermus WK1]
          Length = 127

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 61/121 (50%), Gaps = 5/121 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS- 67
           S RA RVGE+++  L  +I   + +D  I    +++++V ++ DL+ A VYIS+  D   
Sbjct: 10  SLRATRVGEQMKKELSDIIGR-KLKDPRIG--FVTVTDVRVTGDLQQAKVYISVLGDEEQ 66

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
               +  L     FIR  IG+ +R LR  PE+ F  D ++    ++ +L+         +
Sbjct: 67  KKNTLKGLAKATGFIRSEIGQRIR-LRKTPEIYFEIDETIDYGQRIESLIKQISEEKEHK 125

Query: 128 K 128
           +
Sbjct: 126 E 126


>gi|50119660|ref|YP_048827.1| ribosome-binding factor A [Pectobacterium atrosepticum SCRI1043]
 gi|261820129|ref|YP_003258235.1| ribosome-binding factor A [Pectobacterium wasabiae WPP163]
 gi|61214938|sp|Q6D9A4|RBFA_ERWCT RecName: Full=Ribosome-binding factor A
 gi|49610186|emb|CAG73628.1| ribosome-binding factor A [Pectobacterium atrosepticum SCRI1043]
 gi|261604142|gb|ACX86628.1| ribosome-binding factor A [Pectobacterium wasabiae WPP163]
          Length = 132

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 65/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +I+  E +D  I   + ++S V +S DL  A V+++   
Sbjct: 1   MAKEFSRTQRVAQEMQKEIA-IIIQREVKDPRIG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D  P++V     AL     FIR  IG+++R LR VPEL F YD SL    +++ L+    
Sbjct: 58  DNEPEQVKIAVKALQDASGFIRMMIGKAMR-LRVVPELTFSYDNSLVEGMRMSNLVTNV- 115

Query: 122 IPVALEK 128
           +    E+
Sbjct: 116 VRNDTER 122


>gi|325136469|gb|EGC59075.1| ribosome-binding factor A [Neisseria meningitidis M0579]
          Length = 123

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 55/127 (43%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+++EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITVNEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  +  PEL F+YD SL+    L+AL+   
Sbjct: 57  TVLNQDAREITEEVLEHARGHLRSELAKRIKLFK-TPELHFKYDESLERGLNLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAGKPVE 122


>gi|261342613|ref|ZP_05970471.1| ribosome-binding factor A [Enterobacter cancerogenus ATCC 35316]
 gi|296104881|ref|YP_003615027.1| ribosome-binding factor A [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|288315260|gb|EFC54198.1| ribosome-binding factor A [Enterobacter cancerogenus ATCC 35316]
 gi|295059340|gb|ADF64078.1| ribosome-binding factor A [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 134

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A V+++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIALILQR-EIKDPRV-GMMTTVSGVEMSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V +   AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DQDEAAVKNGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDDER 123


>gi|147677605|ref|YP_001211820.1| ribosome-binding factor A [Pelotomaculum thermopropionicum SI]
 gi|189039550|sp|A5D2S1|RBFA_PELTS RecName: Full=Ribosome-binding factor A
 gi|146273702|dbj|BAF59451.1| ribosome-binding factor A [Pelotomaculum thermopropionicum SI]
          Length = 119

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 60/116 (51%), Gaps = 5/116 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVS 67
           S R+ RV E ++  +  ++  NE +D  I    ++I+ V +S DLR A +Y S+      
Sbjct: 2   SFRSERVAEAIKKEVSDML-RNELKDPRIG--FVTITSVEVSKDLRYANIYASVFGSPDD 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
               I AL     FIRG +G+ +R LRY PE+ F+ D S+    ++ ALM   +  
Sbjct: 59  QKETIEALKKAQGFIRGELGKRIR-LRYTPEITFKLDQSIGRGSRVLALMEEVREK 113


>gi|283836287|ref|ZP_06356028.1| ribosome-binding factor A [Citrobacter youngae ATCC 29220]
 gi|291067650|gb|EFE05759.1| ribosome-binding factor A [Citrobacter youngae ATCC 29220]
          Length = 134

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A V+++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIALILQR-EIKDPRV-GMMTTVSGVEMSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V +   AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DQDEAAVKNGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDDER 123


>gi|229086363|ref|ZP_04218540.1| Ribosome-binding factor A [Bacillus cereus Rock3-44]
 gi|228696975|gb|EEL49783.1| Ribosome-binding factor A [Bacillus cereus Rock3-44]
          Length = 118

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA RVGE+++  L  +I   + +D  I    +++++V +S DL++A VYIS+  D    +
Sbjct: 4   RANRVGEQMKKELGDIISR-KIKDPRIG--FVTVTDVQVSGDLQIAKVYISVLGDEEQKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             +  L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+   +I    ++
Sbjct: 61  NTLKGLAKAKGFIRAEIGQRIR-LRKTPEITFEFDESIAYGHRIDTLLH--EINKDGKR 116


>gi|42782899|ref|NP_980146.1| ribosome-binding factor A [Bacillus cereus ATCC 10987]
 gi|222097255|ref|YP_002531312.1| ribosome-binding factor a [Bacillus cereus Q1]
 gi|229019005|ref|ZP_04175847.1| Ribosome-binding factor A [Bacillus cereus AH1273]
 gi|229025250|ref|ZP_04181672.1| Ribosome-binding factor A [Bacillus cereus AH1272]
 gi|229162747|ref|ZP_04290704.1| Ribosome-binding factor A [Bacillus cereus R309803]
 gi|229197921|ref|ZP_04324637.1| Ribosome-binding factor A [Bacillus cereus m1293]
 gi|61215104|sp|Q732R1|RBFA_BACC1 RecName: Full=Ribosome-binding factor A
 gi|254789733|sp|B9IV99|RBFA_BACCQ RecName: Full=Ribosome-binding factor A
 gi|42738826|gb|AAS42754.1| ribosome-binding factor A [Bacillus cereus ATCC 10987]
 gi|221241313|gb|ACM14023.1| ribosome-binding factor A [Bacillus cereus Q1]
 gi|228585639|gb|EEK43741.1| Ribosome-binding factor A [Bacillus cereus m1293]
 gi|228620629|gb|EEK77498.1| Ribosome-binding factor A [Bacillus cereus R309803]
 gi|228736078|gb|EEL86651.1| Ribosome-binding factor A [Bacillus cereus AH1272]
 gi|228742333|gb|EEL92491.1| Ribosome-binding factor A [Bacillus cereus AH1273]
          Length = 118

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA RVGE+++  L  +I   + +D  +    +++++V +S DL++ATVYIS+  D    +
Sbjct: 4   RANRVGEQMKKELGDIISR-KIKDPRVG--FVTVTDVQVSGDLQIATVYISVLGDEEQKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+   
Sbjct: 61  STLKGLAKAKGFIRSEIGQRIR-LRKTPEISFEFDESIGYGHRIDTLLHEI 110


>gi|16078728|ref|NP_389547.1| ribosome-binding factor A [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221309543|ref|ZP_03591390.1| ribosome-binding factor A [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221313867|ref|ZP_03595672.1| ribosome-binding factor A [Bacillus subtilis subsp. subtilis str.
           NCIB 3610]
 gi|221318790|ref|ZP_03600084.1| ribosome-binding factor A [Bacillus subtilis subsp. subtilis str.
           JH642]
 gi|221323062|ref|ZP_03604356.1| ribosome-binding factor A [Bacillus subtilis subsp. subtilis str.
           SMY]
 gi|321315432|ref|YP_004207719.1| ribosome-binding factor A [Bacillus subtilis BSn5]
 gi|418464|sp|P32731|RBFA_BACSU RecName: Full=Ribosome-binding factor A
 gi|580902|emb|CAA79236.1| ORF6 [Bacillus subtilis subsp. subtilis str. 168]
 gi|2634037|emb|CAB13538.1| ribosome-binding factor A [Bacillus subtilis subsp. subtilis str.
           168]
 gi|320021706|gb|ADV96692.1| ribosome-binding factor A [Bacillus subtilis BSn5]
          Length = 117

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 60/113 (53%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S RA RVGE+++  L  +I   + +D  I    +++++V +S DL++A VYIS+  D   
Sbjct: 2   SMRANRVGEQMKKELGDIISR-KLKDPRIG--FLTVTDVRVSGDLQIAKVYISVLGDEKK 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +  +  L     FIR  IG  +R LR  PE+ F +D S+    ++  L+   
Sbjct: 59  REEALKGLAKAKGFIRSEIGSRIR-LRKTPEIEFEFDESIDYGNRIETLIHEL 110


>gi|225390152|ref|ZP_03759876.1| hypothetical protein CLOSTASPAR_03902 [Clostridium asparagiforme
           DSM 15981]
 gi|225043786|gb|EEG54032.1| hypothetical protein CLOSTASPAR_03902 [Clostridium asparagiforme
           DSM 15981]
          Length = 135

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 56/123 (45%), Gaps = 6/123 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I     +D  I   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRINMEVQRELSEII-RGGIKDPRIH-PMTSVIAVEVTPDLKYCKAYISVLG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           +       I  L     ++R  + R + NLR  P+++F  D S++    ++ L+   ++ 
Sbjct: 59  NEDAGKATIEGLKSAEGYVRRELARRV-NLRNTPQIKFILDQSIEYGVNMSHLID--EVT 115

Query: 124 VAL 126
             L
Sbjct: 116 KDL 118


>gi|291541936|emb|CBL15046.1| ribosome-binding factor A [Ruminococcus bromii L2-63]
          Length = 125

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 54/123 (43%), Gaps = 4/123 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS-LPLD 65
             S R  R  E+++  L  +    E +D  + +  ISI  V ++ DL   TV IS +   
Sbjct: 1   MGSHRIERTTEDIKRELTAIFR--ELKDPRVQQAFISIVRVEVTNDLSYCTVQISAIEGL 58

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                 +  L     FIR  +G  L +LR+VPEL F    S++    ++ ++    I   
Sbjct: 59  DRAKEAVKGLKSASGFIRRELGHRL-HLRHVPELIFHATDSIEYSANISRILNSLDIKED 117

Query: 126 LEK 128
            E+
Sbjct: 118 EEE 120


>gi|254411561|ref|ZP_05025337.1| ribosome-binding factor A [Microcoleus chthonoplastes PCC 7420]
 gi|196181283|gb|EDX76271.1| ribosome-binding factor A [Microcoleus chthonoplastes PCC 7420]
          Length = 132

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 58/117 (49%), Gaps = 3/117 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           +RR  RV   ++  +  ++L ++ +D  +   ++S+++V +S DL+ A +Y+S+      
Sbjct: 4   NRRVSRVSSLIQQEVSQMLL-HDIKDDRVGAGMVSVTDVDVSGDLQHAKIYVSIYGTEEA 62

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               ++ L     F+R  +GR +R LR  PE+ F  D  L+   ++  L+       
Sbjct: 63  KSETMAGLQSATGFVRRELGRRVR-LRRTPEVVFIEDRGLERGARMLTLLNQLSQER 118


>gi|157825722|ref|YP_001493442.1| ribosome-binding factor A [Rickettsia akari str. Hartford]
 gi|166219399|sp|A8GNF9|RBFA_RICAH RecName: Full=Ribosome-binding factor A
 gi|157799680|gb|ABV74934.1| ribosome-binding factor A [Rickettsia akari str. Hartford]
          Length = 129

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 62/126 (49%), Gaps = 2/126 (1%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     NS R  ++   +  AL+ ++   +  D  +    ++I++V ++ DL++A  Y 
Sbjct: 1   MKKLTKTNSHRQQKLASIINEALIEILRRGKMLDSRLFNCPLTITKVIVTADLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                  + + V++ALN + K IR  I   + N+++ P++RF YD    +  K+  L+  
Sbjct: 61  LPFNTKLTINEVMNALNNSKKAIRNFITNKI-NVKFSPDIRFHYDHGFDNAIKVEELLKN 119

Query: 120 PKIPVA 125
            ++   
Sbjct: 120 IQVLGD 125


>gi|330958048|gb|EGH58308.1| ribosome-binding factor A [Pseudomonas syringae pv. maculicola str.
           ES4326]
          Length = 138

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITAVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             + + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDNAEDIAQTIKVLNAAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAQD 119


>gi|210622614|ref|ZP_03293274.1| hypothetical protein CLOHIR_01222 [Clostridium hiranonis DSM 13275]
 gi|210154115|gb|EEA85121.1| hypothetical protein CLOHIR_01222 [Clostridium hiranonis DSM 13275]
          Length = 127

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 66/127 (51%), Gaps = 13/127 (10%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  R+ EE++  +  +++N   +D  I   +IS+++V ++ DLR A VY+SL      +
Sbjct: 5   NRTRRISEEIKKIIGQMLING-IKDPRI-TSMISVTDVDVTNDLRYAFVYVSLLGGNEEE 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM---------CLP 120
            + + L     +IR  +G+ ++ LRY+PE+ F+ D S++    +++L+            
Sbjct: 63  SL-AGLKSAAGYIRREVGKKVK-LRYIPEIMFKVDDSIERGMYMDSLIKKVQEHDMENSK 120

Query: 121 KIPVALE 127
           ++    E
Sbjct: 121 EVEEDEE 127


>gi|289423163|ref|ZP_06424978.1| ribosome-binding factor A [Peptostreptococcus anaerobius 653-L]
 gi|289156494|gb|EFD05144.1| ribosome-binding factor A [Peptostreptococcus anaerobius 653-L]
          Length = 115

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 65/121 (53%), Gaps = 6/121 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S R  R+ EEV+ A+  +++N   +D  I   +IS+++V ++ DLR A VYIS+    
Sbjct: 1   MASNRIRRISEEVKKAISVMLING-IKDPRI-TSMISVTDVEVTNDLRYAFVYISILGG- 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             +  +  LN    +IR  +GR ++ LRY PE+ F+ D S++    ++ L+    +    
Sbjct: 58  DKEESLEGLNSARGYIRREVGRQVK-LRYAPEIIFKIDDSIERGMYMDELIKS--VNKDE 114

Query: 127 E 127
           E
Sbjct: 115 E 115


>gi|308272449|emb|CBX29053.1| Ribosome-binding factor A [uncultured Desulfobacterium sp.]
          Length = 119

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 5/120 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL-PLDVS 67
             RA RVG +++  L   +L    +D  +   + +I+ V MS DL++A +Y +      +
Sbjct: 4   FSRAERVGGQIQKVLSGALLKG-IKDPRLE--MTTITAVKMSKDLKIARIYFTTTGGKTN 60

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
            D           F++  +   L  LRY+PEL F YD S     ++  ++   K     +
Sbjct: 61  ADEAAKGFKSAAGFLKRSLSSEL-TLRYMPELIFFYDESYDYGEQIEKVLKSIKTENTED 119


>gi|302389794|ref|YP_003825615.1| ribosome-binding factor A [Thermosediminibacter oceani DSM 16646]
 gi|302200422|gb|ADL07992.1| ribosome-binding factor A [Thermosediminibacter oceani DSM 16646]
          Length = 119

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 61/115 (53%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
               R  RV  E++ A+  +I NN+ +D  I   +IS+++V +S DLR A +++S+  + 
Sbjct: 1   MEFSRTDRVSGEIKKAVSEII-NNDLKDPRIQG-LISVTKVEVSKDLRHAKIFLSIYGEE 58

Query: 67  S-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           S     +  +     FIR  +   +R L+++P+L F+ D S++    ++ L+   
Sbjct: 59  SVKQNALEGIKNAEGFIRRELANRIR-LKFIPQLNFKLDDSIEYGIHISKLLKDI 112


>gi|260589526|ref|ZP_05855439.1| ribosome-binding factor A [Blautia hansenii DSM 20583]
 gi|260540094|gb|EEX20663.1| ribosome-binding factor A [Blautia hansenii DSM 20583]
          Length = 128

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 8/128 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV  EV+  L   ++    +D  I   + S++ V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRVNVEVQHELAN-LIREGIKDPRIH-PMTSVTAVEVAPDLKTCRAYISVMG 58

Query: 65  DVSPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL---- 119
           +       I  L     +IR ++ +++ NLR  PE+RF  D S++    ++ L+      
Sbjct: 59  NEEAKNNTIVGLKSAEGYIRRQLAKNI-NLRNTPEIRFILDESIEYGVAMSKLIDEVTGK 117

Query: 120 PKIPVALE 127
            ++    E
Sbjct: 118 EEVQEDGE 125


>gi|242242553|ref|ZP_04796998.1| ribosome-binding factor A [Staphylococcus epidermidis W23144]
 gi|242233980|gb|EES36292.1| ribosome-binding factor A [Staphylococcus epidermidis W23144]
          Length = 127

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 37/121 (30%), Positives = 67/121 (55%), Gaps = 5/121 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     N+ RA RVGE+++  +M + +NN+ +D  +    ++I++V ++ DL  A VY+
Sbjct: 6   MKRGEMMNNIRAERVGEQMKQEIMDI-VNNKVKDPRVG--FLTITDVELTNDLSQAKVYL 62

Query: 61  SLPLDVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +    D    AL+    FI+  +G  +R LR +PEL F YD S++   K+  ++  
Sbjct: 63  TVLGNDKEVDNTFKALHKATGFIKSELGSRMR-LRIIPELTFEYDESIEYGNKIERMIQD 121

Query: 120 P 120
            
Sbjct: 122 L 122


>gi|229031441|ref|ZP_04187441.1| Ribosome-binding factor A [Bacillus cereus AH1271]
 gi|228729730|gb|EEL80710.1| Ribosome-binding factor A [Bacillus cereus AH1271]
          Length = 118

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 65/119 (54%), Gaps = 7/119 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA RVGE+++  L  +I   + +D  +    +++++V +S DL++ATVYIS+  D    +
Sbjct: 4   RANRVGEQMKKELGDIISR-KIKDPRVG--FVTVTDVQVSGDLQIATVYISVLGDEEQKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             +  L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+    I    ++
Sbjct: 61  STLKGLAKAKGFIRSEIGQRIR-LRKTPEISFEFDESIGYGHRIDTLLHQ--INKDDKR 116


>gi|206978440|ref|ZP_03239307.1| ribosome-binding factor A [Bacillus cereus H3081.97]
 gi|217961231|ref|YP_002339799.1| ribosome-binding factor A [Bacillus cereus AH187]
 gi|229140452|ref|ZP_04269007.1| Ribosome-binding factor A [Bacillus cereus BDRD-ST26]
 gi|226736638|sp|B7HLE4|RBFA_BACC7 RecName: Full=Ribosome-binding factor A
 gi|206743355|gb|EDZ54795.1| ribosome-binding factor A [Bacillus cereus H3081.97]
 gi|217067043|gb|ACJ81293.1| ribosome-binding factor A [Bacillus cereus AH187]
 gi|228643013|gb|EEK99289.1| Ribosome-binding factor A [Bacillus cereus BDRD-ST26]
          Length = 118

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA RVGE+++  L  +I   + +D  +    +++++V +S DL++ATVYIS+  D    D
Sbjct: 4   RANRVGEQMKKELGDIISR-KIKDPRVG--FVTVTDVQVSGDLQIATVYISVLGDEEQKD 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+   
Sbjct: 61  STLKGLAKAKGFIRSEIGQRIR-LRKTPEISFEFDESIGYGHRIDTLLHEI 110


>gi|296330880|ref|ZP_06873355.1| ribosome-binding factor A [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305674398|ref|YP_003866070.1| ribosome-binding factor A [Bacillus subtilis subsp. spizizenii str.
           W23]
 gi|296151885|gb|EFG92759.1| ribosome-binding factor A [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305412642|gb|ADM37761.1| ribosome-binding factor A [Bacillus subtilis subsp. spizizenii str.
           W23]
          Length = 117

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 60/113 (53%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S RA RVGE+++  L  +I   + +D  I    +++++V +S DL++A VYIS+  D   
Sbjct: 2   SMRANRVGEQMKKELGDIISR-KLKDPRIG--FLTVTDVRVSGDLQIAKVYISVLGDEKK 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +  +  L     FIR  IG  +R LR  PE+ F +D S+    ++  L+   
Sbjct: 59  REEALKGLEKAKGFIRSEIGSRIR-LRKTPEIEFEFDESIDYGNRIETLIHEI 110


>gi|169827170|ref|YP_001697328.1| ribosome-binding factor A [Lysinibacillus sphaericus C3-41]
 gi|168991658|gb|ACA39198.1| Ribosome-binding factor A [Lysinibacillus sphaericus C3-41]
          Length = 113

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 61/113 (53%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VS 67
           S R+ RV E+++  L  ++   + +D  +    ++++ V ++ DL+ AT+YI+   +   
Sbjct: 2   SLRSNRVAEQMKKELGDILGR-KIKDPRVG--FVTVTGVEVTGDLQQATIYITSLGNERE 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +  + AL     FIR  IG  +R LR  PEL F +D+S++   +++ L+   
Sbjct: 59  REETLKALVKASGFIRSEIGSRIR-LRRTPELIFEFDSSIEYGNRIDTLLRDL 110


>gi|156741119|ref|YP_001431248.1| ribosome-binding factor A [Roseiflexus castenholzii DSM 13941]
 gi|189039554|sp|A7NID0|RBFA_ROSCS RecName: Full=Ribosome-binding factor A
 gi|156232447|gb|ABU57230.1| ribosome-binding factor A [Roseiflexus castenholzii DSM 13941]
          Length = 130

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 4/117 (3%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R  ++G E++  L  ++   E +D  +     ++  V ++ DL++A V IS+      
Sbjct: 2   SKRTEQLGHEIQRILGEIL-QYELKDPRVG--FATVVGVEVTADLQIARVRISVMGTPEE 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               ++AL     F+R R+   L  LR+VPELR   DTS+     ++ L+       
Sbjct: 59  RKETMAALERAKGFLRRRLAEELNYLRFVPELRLILDTSVDYSLHIDELLRRAAAER 115


>gi|152995059|ref|YP_001339894.1| ribosome-binding factor A [Marinomonas sp. MWYL1]
 gi|189039546|sp|A6VU30|RBFA_MARMS RecName: Full=Ribosome-binding factor A
 gi|150835983|gb|ABR69959.1| ribosome-binding factor A [Marinomonas sp. MWYL1]
          Length = 129

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/128 (24%), Positives = 64/128 (50%), Gaps = 9/128 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
                 R  R+G++++  L   ++  E +D  +   +++++EV ++ DL  A +Y ++  
Sbjct: 1   MAGEFSRTSRIGDQLQKELAS-LIQFEVKDPRLG--LVTVNEVRVAKDLGYADIYYTVLG 57

Query: 65  DVSPDRV----ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 V     +AL+    F+R R+ + ++ LR +P LRF YD S+ +  +++AL+   
Sbjct: 58  KDDQPEVLAENQAALDSAKGFLRRRLAQEVK-LRVMPHLRFHYDQSVVNGSRMSALI-DE 115

Query: 121 KIPVALEK 128
            I     K
Sbjct: 116 AIRDDETK 123


>gi|332975272|gb|EGK12172.1| ribosome-binding factor A [Kingella kingae ATCC 23330]
          Length = 123

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 53/119 (44%), Gaps = 5/119 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK        R  RV E+V   L   ++    +D       I+I++V ++ D   ATVY 
Sbjct: 1   MKKPQRNGYARIDRVKEQVMRELAE-LVRTGLKDPRAG--FITINDVEVTRDYSHATVYY 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++      +  + AL     F+R  + R +   R  PEL F YD SL+   +L+ L+  
Sbjct: 58  TVL-SGDREASLQALEHAKGFLRSELSRRITVFR-TPELHFEYDESLERGVQLSNLIDR 114


>gi|49077912|gb|AAT49730.1| PA4743 [synthetic construct]
          Length = 130

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 66/124 (53%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K+  R  R+G++++  L  +I   E +D  +   +++I+ V +S D+  A V+I++  
Sbjct: 1   MAKDYSRTQRIGDQMQRELAQLIQR-EIKDPRLG--LVTITGVEVSRDVAHAKVFITVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                ++   +  LN    ++R  +G+S++ LR VP+L F YD S++   +L+AL+    
Sbjct: 58  QDDAGKIALNMEILNDAAGYLRMLLGKSMK-LRSVPQLHFHYDESIRRGAELSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|169831090|ref|YP_001717072.1| ribosome-binding factor A [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169637934|gb|ACA59440.1| ribosome-binding factor A [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 119

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 26/111 (23%), Positives = 53/111 (47%), Gaps = 6/111 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+ E ++  +  ++     +D  +    ++++ V +S DLR A V++S+        
Sbjct: 7   RPERLAEVIKKEISDLLRQ--MKDPRLG--FVTVTAVEVSSDLRYAKVFVSVLGSNEDQD 62

Query: 71  VI-SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                L     FIR  +G+ +R LRY PE+ F +D S++   ++  ++   
Sbjct: 63  ASLKVLRGAQGFIRTELGKRIR-LRYTPEVSFVHDPSIEEGTRIIQIIRDI 112


>gi|254361247|ref|ZP_04977390.1| ribosome binding factor A [Mannheimia haemolytica PHL213]
 gi|261492529|ref|ZP_05989082.1| ribosome binding factor A [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261496804|ref|ZP_05993178.1| ribosome binding factor A [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153092743|gb|EDN73786.1| ribosome binding factor A [Mannheimia haemolytica PHL213]
 gi|261307551|gb|EEY08880.1| ribosome binding factor A [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261311688|gb|EEY12838.1| ribosome binding factor A [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 126

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 67/127 (52%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MSREFKRSDRVAQELQKEVAVILQR-EVKDPRIG--MVTVSDVEVSRDLAYAKIFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   + +   +  L     +IR  +G+++R LR VPELRF YD SL    +++ L+    
Sbjct: 58  DNDAEAIKQGMQGLEKASPYIRTLLGKAMR-LRIVPELRFIYDESLVEGMRMSNLVSSV- 115

Query: 122 IPVALEK 128
           I    EK
Sbjct: 116 IKNDEEK 122


>gi|17546009|ref|NP_519411.1| ribosome-binding factor A [Ralstonia solanacearum GMI1000]
 gi|20978580|sp|Q8XZV5|RBFA_RALSO RecName: Full=Ribosome-binding factor A
 gi|17428304|emb|CAD14992.1| probable ribosome-binding factor a protein [Ralstonia solanacearum
           GMI1000]
 gi|299067342|emb|CBJ38539.1| Ribosome-binding factor A [Ralstonia solanacearum CMR15]
          Length = 123

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 60/127 (47%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K+   S R LR+ ++++  L  +I   E ++  +   ++++  V ++ D   A +Y 
Sbjct: 1   MPKKSGSASGRNLRIADQIQRDLAELIQR-EIKNPAMG--LVTLQSVSLTPDYAHAKIYF 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++     PD   + LN    ++   + + L ++  VP L F YD S++   +++ L+   
Sbjct: 58  TVLGA-EPDAAAAILNEKAGYLHSLLFKRL-HIHTVPTLHFHYDGSVERGIEMSRLIDQA 115

Query: 121 KIPVALE 127
               A +
Sbjct: 116 NASRAKD 122


>gi|312143663|ref|YP_003995109.1| ribosome-binding factor A [Halanaerobium sp. 'sapolanicus']
 gi|311904314|gb|ADQ14755.1| ribosome-binding factor A [Halanaerobium sp. 'sapolanicus']
          Length = 127

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 67/120 (55%), Gaps = 5/120 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSP 68
           +RA+RVGE ++  +  +IL  E +D  I    +S+++V +S DLR A V++S+   D   
Sbjct: 4   KRAIRVGELLKEEISQIILR-EMKDPRI--AFVSVTDVKVSGDLRHAKVFVSVFGTDKEK 60

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
           +  +  L+    +IR  +G  ++ + + PE+ FRYD S++    ++ ++   K    +++
Sbjct: 61  EETMEGLDKATGYIRKLVGERVK-IHHTPEIIFRYDDSIEQGVHISKIINNLKESGEIKE 119


>gi|167037620|ref|YP_001665198.1| ribosome-binding factor A [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|289578385|ref|YP_003477012.1| ribosome-binding factor A [Thermoanaerobacter italicus Ab9]
 gi|297544661|ref|YP_003676963.1| ribosome-binding factor A [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|320116035|ref|YP_004186194.1| ribosome-binding factor A [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|166856454|gb|ABY94862.1| ribosome-binding factor A [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|289528098|gb|ADD02450.1| ribosome-binding factor A [Thermoanaerobacter italicus Ab9]
 gi|296842436|gb|ADH60952.1| ribosome-binding factor A [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|319929126|gb|ADV79811.1| ribosome-binding factor A [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
          Length = 119

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 58/115 (50%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SPD 69
           R  R+ EE++  +  +IL  E +D  I   ++SI+++ ++ DLR A VY+S+  +     
Sbjct: 4   RNNRLSEEIKKEISKMIL-EEIKDPRIK-AMVSITDIELTKDLRYAKVYVSIYGNEEDKR 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                L     +IR  IGR ++ +RY PE+ F  D S++    ++ ++       
Sbjct: 62  ETFEGLKSAAGYIRHEIGRRIK-MRYTPEIIFELDHSIEYGAHISEILKELNKQE 115


>gi|225075533|ref|ZP_03718732.1| hypothetical protein NEIFLAOT_00546 [Neisseria flavescens
           NRL30031/H210]
 gi|224953168|gb|EEG34377.1| hypothetical protein NEIFLAOT_00546 [Neisseria flavescens
           NRL30031/H210]
          Length = 123

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+I+EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITINEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TVLNQDTREITEEVLEHARGHLRSELAKRIKLFK-IPELHFKYDESLERGMNLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|330877232|gb|EGH11381.1| ribosome-binding factor A [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
          Length = 138

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITAVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             + + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDNAEDIAQTIKVLNSAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAQD 119


>gi|300865260|ref|ZP_07110074.1| Ribosome-binding factor A [Oscillatoria sp. PCC 6506]
 gi|300336733|emb|CBN55224.1| Ribosome-binding factor A [Oscillatoria sp. PCC 6506]
          Length = 140

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 58/126 (46%), Gaps = 8/126 (6%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           SRR  RV   ++  +  ++LN   +D  +   ++S+++V +S DL+ A +++S+      
Sbjct: 4   SRRVERVSSLIKREVSLLLLNG-IKDDRVGAGIVSVTDVDVSGDLQHAKIFVSIYGTDEA 62

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV--- 124
               ++ L     ++R  +G  +  LR  PE+ F  D SL+   K+  L+          
Sbjct: 63  KAETMAGLKSATGYVRSELGHRV-GLRRTPEVVFLEDHSLERGDKMLLLLNKLSQERKPD 121

Query: 125 --ALEK 128
               E+
Sbjct: 122 ILDEEE 127


>gi|15677238|ref|NP_274391.1| ribosome-binding factor A [Neisseria meningitidis MC58]
 gi|121635079|ref|YP_975324.1| ribosome-binding factor A [Neisseria meningitidis FAM18]
 gi|20978660|sp|Q9JYY2|RBFA_NEIMB RecName: Full=Ribosome-binding factor A
 gi|166219381|sp|A1KUJ5|RBFA_NEIMF RecName: Full=Ribosome-binding factor A
 gi|7226619|gb|AAF41747.1| ribosome-binding factor A [Neisseria meningitidis MC58]
 gi|120866785|emb|CAM10538.1| ribosomal-binding factor A [Neisseria meningitidis FAM18]
 gi|316984188|gb|EFV63166.1| ribosome-binding factor A [Neisseria meningitidis H44/76]
 gi|325132434|gb|EGC55127.1| ribosome-binding factor A [Neisseria meningitidis M6190]
 gi|325134391|gb|EGC57036.1| ribosome-binding factor A [Neisseria meningitidis M13399]
 gi|325138422|gb|EGC60990.1| ribosome-binding factor A [Neisseria meningitidis ES14902]
 gi|325140407|gb|EGC62928.1| ribosome-binding factor A [Neisseria meningitidis CU385]
 gi|325143448|gb|EGC65774.1| ribosome-binding factor A [Neisseria meningitidis M01-240013]
 gi|325200006|gb|ADY95461.1| ribosome-binding factor A [Neisseria meningitidis H44/76]
 gi|325201918|gb|ADY97372.1| ribosome-binding factor A [Neisseria meningitidis M01-240149]
 gi|325205860|gb|ADZ01313.1| ribosome-binding factor A [Neisseria meningitidis M04-240196]
 gi|325208331|gb|ADZ03783.1| ribosome-binding factor A [Neisseria meningitidis NZ-05/33]
          Length = 123

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 55/127 (43%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+++EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITVNEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  +  PEL F+YD SL+    L+AL+   
Sbjct: 57  TILNQDAREITEEVLEHARGHLRSELAKRIKLFK-TPELHFKYDESLERGLNLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|301156204|emb|CBW15675.1| 30s ribosome binding factor [Haemophilus parainfluenzae T3T1]
          Length = 128

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 66/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A V+++   
Sbjct: 1   MAREFKRSDRVAQELQKEIATILQR-EVKDPRIG--MVTVSDVEVSSDLAYAKVFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +   +  L     +IR  +G+++R LR VPE+RF YD SL    +++ L+    
Sbjct: 58  DHDEVAIEQGMKGLEKAAPYIRSLVGKAMR-LRIVPEIRFFYDQSLVEGMRMSNLV-TNV 115

Query: 122 IPVALEK 128
           +    +K
Sbjct: 116 VREDEKK 122


>gi|311277860|ref|YP_003940091.1| ribosome-binding factor A [Enterobacter cloacae SCF1]
 gi|308747055|gb|ADO46807.1| ribosome-binding factor A [Enterobacter cloacae SCF1]
          Length = 134

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V MS DL  A V+++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIA-IILQREIKDPRL-GMMTTVSGVEMSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V   I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DKDEAAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLVTSV- 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDDER 123


>gi|212212199|ref|YP_002303135.1| ribosome-binding factor A [Coxiella burnetii CbuG_Q212]
 gi|226723596|sp|B6IZ62|RBFA_COXB2 RecName: Full=Ribosome-binding factor A
 gi|212010609|gb|ACJ17990.1| ribosome-binding factor A [Coxiella burnetii CbuG_Q212]
          Length = 119

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 63/120 (52%), Gaps = 4/120 (3%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R  RV + +   L   +L  E +D  +S+  IS++ V +S DL+ A V+ SL  + + 
Sbjct: 2   SQRQQRVADLIHQQLAE-LLKKEVRDSRLSK--ISLTAVSISPDLKQAKVFYSLLENQNE 58

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             V  ALN    ++R  + ++   LRYVP+L F YD S++   +++ L+         ++
Sbjct: 59  KEVQKALNKATGYLRHLLAQA-TVLRYVPKLEFVYDESIERAHRISFLIERALKKDDSDE 117


>gi|126652566|ref|ZP_01724731.1| ribosome-binding factor A [Bacillus sp. B14905]
 gi|126590694|gb|EAZ84810.1| ribosome-binding factor A [Bacillus sp. B14905]
          Length = 113

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 61/111 (54%), Gaps = 5/111 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VS 67
           S R+ RV E+++  L  ++   + +D  +    ++++ V ++ DL+ AT+YI+   +   
Sbjct: 2   SLRSNRVAEQMKKELGDILGR-KIKDPRVG--FVTVTGVEVTGDLQQATIYITSLGNERE 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
            +  I AL     FIR  IG  +R LR  PEL F +D+S++   +++ L+ 
Sbjct: 59  REETIKALVKASGFIRSEIGSRIR-LRRTPELIFEFDSSIEYGNRIDTLLR 108


>gi|77165584|ref|YP_344109.1| ribosome-binding factor A [Nitrosococcus oceani ATCC 19707]
 gi|254433845|ref|ZP_05047353.1| ribosome-binding factor A [Nitrosococcus oceani AFC27]
 gi|123593841|sp|Q3J9B7|RBFA_NITOC RecName: Full=Ribosome-binding factor A
 gi|76883898|gb|ABA58579.1| ribosome-binding factor A [Nitrosococcus oceani ATCC 19707]
 gi|207090178|gb|EDZ67449.1| ribosome-binding factor A [Nitrosococcus oceani AFC27]
          Length = 127

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 60/124 (48%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   RA RVGE ++  L  +    E +D  +   ++++S V +S DLR A  Y++   
Sbjct: 1   MSQEFSRARRVGELLQRELARLF-QEELKDPRVK--LVTVSHVRVSPDLRQAKAYVTFLG 57

Query: 65  DVSPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                +   A LN    F++  + + +  LR +P L+F YD S++   +L+AL+    + 
Sbjct: 58  KEEDTQEQLAVLNKAAGFLQHGLSQRV-ELRVIPRLQFVYDDSIERGRRLSALI-DKAVQ 115

Query: 124 VALE 127
              +
Sbjct: 116 KETD 119


>gi|304316861|ref|YP_003852006.1| ribosome-binding factor A [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778363|gb|ADL68922.1| ribosome-binding factor A [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 119

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 62/119 (52%), Gaps = 4/119 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           R+ R+ EE++  +  +I   E +D  IS  + SI+++ ++ DLR A +YIS+  +     
Sbjct: 4   RSGRLSEEIKKEVSKMIF-EEIKDPRISN-MTSITDIEVTKDLRYAKIYISVYGNDDEKK 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             +  L     FIR  +G+ ++ LRY PEL F  D S++    ++ ++       + +K
Sbjct: 62  STLEGLKSATGFIRHELGKRIK-LRYTPELIFEIDNSIEYGAHISKILRELDKQESEDK 119


>gi|330981091|gb|EGH79194.1| ribosome-binding factor A [Pseudomonas syringae pv. aptata str. DSM
           50252]
          Length = 138

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKKYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITAVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             S + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDSAEEIAQTIKVLNAAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|293390257|ref|ZP_06634591.1| ribosome-binding factor A [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290950791|gb|EFE00910.1| ribosome-binding factor A [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 128

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 66/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A V+++   
Sbjct: 1   MAREFKRSDRVAQEIQKEIAVILQR-EVKDPRIG--MVTVSDVDVSSDLAYAKVFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +   +  L     +IR  +G+++R LR VPE+RF YD SL    +++ L+    
Sbjct: 58  DHDEQAIAQGMKGLEKAAPYIRTLLGKAMR-LRIVPEIRFIYDQSLVEGMRMSNLV-TNV 115

Query: 122 IPVALEK 128
           +    +K
Sbjct: 116 VREDQKK 122


>gi|325290359|ref|YP_004266540.1| ribosome-binding factor A [Syntrophobotulus glycolicus DSM 8271]
 gi|324965760|gb|ADY56539.1| ribosome-binding factor A [Syntrophobotulus glycolicus DSM 8271]
          Length = 124

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 65/117 (55%), Gaps = 5/117 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP- 68
            R++R+ E ++  +  +IL  E +D  I    I++++V ++ DLR A +Y+S+       
Sbjct: 4   HRSVRLAETIKEEVARIIL-EEIKDPRIG--FITLTDVEVAEDLRYAKLYVSIMGSEEEV 60

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              + ALN    F+R  +G+++R LRYVPE+ F+YD S++    ++ L+    +   
Sbjct: 61  KNSLEALNRASGFVRSELGKTVR-LRYVPEISFKYDQSIEQGAHISKLLREVGLKGD 116


>gi|68250153|ref|YP_249265.1| ribosome-binding factor A [Haemophilus influenzae 86-028NP]
 gi|145629355|ref|ZP_01785154.1| ribosome-binding factor A [Haemophilus influenzae 22.1-21]
 gi|145630826|ref|ZP_01786604.1| ribosome-binding factor A [Haemophilus influenzae R3021]
 gi|145633238|ref|ZP_01788969.1| ribosome-binding factor A [Haemophilus influenzae 3655]
 gi|145634362|ref|ZP_01790072.1| ribosome-binding factor A [Haemophilus influenzae PittAA]
 gi|145637806|ref|ZP_01793455.1| ribosome-binding factor A [Haemophilus influenzae PittHH]
 gi|145641331|ref|ZP_01796910.1| ribosome-binding factor A [Haemophilus influenzae R3021]
 gi|148825872|ref|YP_001290625.1| ribosome-binding factor A [Haemophilus influenzae PittEE]
 gi|229845103|ref|ZP_04465238.1| ribosome-binding factor A [Haemophilus influenzae 6P18H1]
 gi|229846816|ref|ZP_04466923.1| ribosome-binding factor A [Haemophilus influenzae 7P49H1]
 gi|260582496|ref|ZP_05850287.1| ribosome-binding factor A [Haemophilus influenzae NT127]
 gi|319896989|ref|YP_004135184.1| 30S ribosome binding factor [Haemophilus influenzae F3031]
 gi|81335423|sp|Q4QK42|RBFA_HAEI8 RecName: Full=Ribosome-binding factor A
 gi|166218442|sp|A5UBU1|RBFA_HAEIE RecName: Full=Ribosome-binding factor A
 gi|68058352|gb|AAX88605.1| ribosome-binding factor A [Haemophilus influenzae 86-028NP]
 gi|144978858|gb|EDJ88581.1| ribosome-binding factor A [Haemophilus influenzae 22.1-21]
 gi|144983708|gb|EDJ91168.1| ribosome-binding factor A [Haemophilus influenzae R3021]
 gi|144986084|gb|EDJ92674.1| ribosome-binding factor A [Haemophilus influenzae 3655]
 gi|145268342|gb|EDK08336.1| ribosome-binding factor A [Haemophilus influenzae PittAA]
 gi|145268999|gb|EDK08953.1| ribosome-binding factor A [Haemophilus influenzae PittHH]
 gi|145273874|gb|EDK13741.1| ribosome-binding factor A [Haemophilus influenzae 22.4-21]
 gi|148716032|gb|ABQ98242.1| ribosome-binding factor A [Haemophilus influenzae PittEE]
 gi|229810305|gb|EEP46024.1| ribosome-binding factor A [Haemophilus influenzae 7P49H1]
 gi|229811939|gb|EEP47633.1| ribosome-binding factor A [Haemophilus influenzae 6P18H1]
 gi|260094476|gb|EEW78373.1| ribosome-binding factor A [Haemophilus influenzae NT127]
 gi|301170027|emb|CBW29631.1| 30s ribosome binding factor [Haemophilus influenzae 10810]
 gi|309750835|gb|ADO80819.1| Ribosome binding factor A [Haemophilus influenzae R2866]
 gi|309973016|gb|ADO96217.1| Ribosome binding factor A [Haemophilus influenzae R2846]
 gi|317432493|emb|CBY80850.1| 30s ribosome binding factor [Haemophilus influenzae F3031]
          Length = 128

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 66/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MAREFKRSDRVAQEIQKEIAVILQR-EVKDPRIG--MVTVSDVEVSSDLSYAKIFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +   +  L     +IR  +G+++R LR VPE+RF YD SL    +++ L+    
Sbjct: 58  DHDETAIEQGMKGLEKASPYIRSLLGKAMR-LRIVPEIRFIYDQSLVEGMRMSNLVTNV- 115

Query: 122 IPVALEK 128
           +    +K
Sbjct: 116 VREDEKK 122


>gi|308068701|ref|YP_003870306.1| ribosome-binding factor A [Paenibacillus polymyxa E681]
 gi|305857980|gb|ADM69768.1| Ribosome-binding factor A [Paenibacillus polymyxa E681]
          Length = 116

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 58/113 (51%), Gaps = 5/113 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  RVGE+++  L   ++  E +D  I    I+++ V ++ DL  A +Y+S+  D    
Sbjct: 4   IRTGRVGEQIKKELSQ-LIQTELKDPRIG--FITVTGVDLTNDLSQAKIYLSVLGDEEQK 60

Query: 70  RVI-SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                AL+    ++R  +G+ +R LR++PEL F+ D S+    ++  L+    
Sbjct: 61  NSSLKALDKANGYLRSELGKRIR-LRHIPELIFKIDESIAYGSRIEKLLSDID 112


>gi|152976177|ref|YP_001375694.1| ribosome-binding factor A [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189039526|sp|A7GRE1|RBFA_BACCN RecName: Full=Ribosome-binding factor A
 gi|152024929|gb|ABS22699.1| ribosome-binding factor A [Bacillus cytotoxicus NVH 391-98]
          Length = 118

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA RVGE+++  L  +I   + +D  +    +++++V +S DL++ATVYIS+  D    +
Sbjct: 4   RANRVGEQMKKELGDIISR-KIKDPRVG--FVTVTDVKVSGDLQIATVYISVLGDEEQKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+   
Sbjct: 61  NTLKGLAKAKGFIRSEIGQRIR-LRKTPEISFEFDESIGYGHRIDTLLHEI 110


>gi|254805168|ref|YP_003083389.1| Ribosome-binding factor A [Neisseria meningitidis alpha14]
 gi|261377491|ref|ZP_05982064.1| ribosome-binding factor A [Neisseria cinerea ATCC 14685]
 gi|254668710|emb|CBA06489.1| Ribosome-binding factor A [Neisseria meningitidis alpha14]
 gi|269146221|gb|EEZ72639.1| ribosome-binding factor A [Neisseria cinerea ATCC 14685]
          Length = 123

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+I+EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITINEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TVLNQDAREITEEVLEHARGHLRSELAKRIKLFK-IPELHFKYDESLERGMNLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|238918425|ref|YP_002931939.1| ribosome-binding factor A [Edwardsiella ictaluri 93-146]
 gi|259551976|sp|C5BFB8|RBFA_EDWI9 RecName: Full=Ribosome-binding factor A
 gi|238867993|gb|ACR67704.1| ribosome-binding factor A, putative [Edwardsiella ictaluri 93-146]
          Length = 132

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 63/127 (49%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV +E++  +  +IL  E +D  +   + ++S V +S DL  A V+++   
Sbjct: 1   MAREFSRTQRVAQEMQKEIA-IILQREVKDPRVG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D  P+ V     AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 58  DGEPETVKSGLKALQDASGFIRMLLGKAMR-LRVVPELTFAYDASLVEGMRMSNLVSNV- 115

Query: 122 IPVALEK 128
           +     +
Sbjct: 116 VKDDAAR 122


>gi|291613950|ref|YP_003524107.1| ribosome-binding factor A [Sideroxydans lithotrophicus ES-1]
 gi|291584062|gb|ADE11720.1| ribosome-binding factor A [Sideroxydans lithotrophicus ES-1]
          Length = 118

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K+  R  R+ E+++  L   ++  E +D  + +  ++++ V ++ D   A V+ +   
Sbjct: 1   MAKDFARTDRIAEQIQRELAE-LIRLEVKDPRVRK--VTLTGVTVTNDHAHAKVFYTSLD 57

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             SPD +   L     F+R ++  +++ LR  P+L F YD S++    L+ L+    +  
Sbjct: 58  GDSPDLL-LGLERAAGFLRSQLAHAMK-LRITPQLHFVYDASVERGAHLSQLIDQ-AVAS 114

Query: 125 ALE 127
             +
Sbjct: 115 DKK 117


>gi|254670020|emb|CBA04785.1| Ribosome-binding factor A [Neisseria meningitidis alpha153]
 gi|261392353|emb|CAX49891.1| ribosome-binding factor A [Neisseria meningitidis 8013]
          Length = 123

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+++EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITVNEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TILNQDAREITEEVLEHARGHLRSELAKRIKLFK-IPELHFKYDESLERGMNLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|325981565|ref|YP_004293967.1| ribosome-binding factor A [Nitrosomonas sp. AL212]
 gi|325531084|gb|ADZ25805.1| ribosome-binding factor A [Nitrosomonas sp. AL212]
          Length = 127

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 60/122 (49%), Gaps = 6/122 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            PK+  R+LR+ ++++  L   ++ NE +D  I +  ++I+ V ++ D   A ++ +   
Sbjct: 1   MPKDFSRSLRIADQIQRELAD-LIQNEIKDPRIKQ--LTITAVEVTRDYSHAKIFYTTLT 57

Query: 65  DVSPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
               +  +   L     F+R  +   ++ LR VP+L F YD S++   +L+ L+    I 
Sbjct: 58  HQDENFLIEKGLEHATGFLRSNLSHRMK-LRLVPQLHFIYDESVERGVRLSKLI-DEAIA 115

Query: 124 VA 125
             
Sbjct: 116 QD 117


>gi|146313239|ref|YP_001178313.1| ribosome-binding factor A [Enterobacter sp. 638]
 gi|166918676|sp|A4WEY2|RBFA_ENT38 RecName: Full=Ribosome-binding factor A
 gi|145320115|gb|ABP62262.1| ribosome-binding factor A [Enterobacter sp. 638]
          Length = 133

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 7/127 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A V+++   
Sbjct: 1   MAKEFGRPQRVAQEMQKEIALILQR-EIKDPRV-GMMTTVSGVEMSRDLAYAKVFVTFLN 58

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V +   AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 59  DQDEAAVKNGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMRMSNLV-TTV 116

Query: 122 IPVALEK 128
           +    E+
Sbjct: 117 VKHDDER 123


>gi|167040281|ref|YP_001663266.1| ribosome-binding factor A [Thermoanaerobacter sp. X514]
 gi|256750793|ref|ZP_05491678.1| ribosome-binding factor A [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914365|ref|ZP_07131681.1| ribosome-binding factor A [Thermoanaerobacter sp. X561]
 gi|307724399|ref|YP_003904150.1| ribosome-binding factor A [Thermoanaerobacter sp. X513]
 gi|166854521|gb|ABY92930.1| ribosome-binding factor A [Thermoanaerobacter sp. X514]
 gi|256750376|gb|EEU63395.1| ribosome-binding factor A [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889300|gb|EFK84446.1| ribosome-binding factor A [Thermoanaerobacter sp. X561]
 gi|307581460|gb|ADN54859.1| ribosome-binding factor A [Thermoanaerobacter sp. X513]
          Length = 119

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 58/115 (50%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R  R+ EE++  +  +IL  E +D  I   ++SI+++ ++ DLR A VY+S+   +    
Sbjct: 4   RNSRLSEEMKREISKMIL-EEIKDPRIK-AMVSITDIEVTKDLRYAKVYVSIYGSEEDKQ 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                L     +IR  IGR ++ +RY PE+ F  D S++    ++ ++       
Sbjct: 62  ETFEGLKSAAGYIRHEIGRRIK-MRYTPEIIFELDRSIEYGAHISEILKELNKQE 115


>gi|304320571|ref|YP_003854214.1| ribosome-binding factor A [Parvularcula bermudensis HTCC2503]
 gi|303299473|gb|ADM09072.1| ribosome-binding factor A [Parvularcula bermudensis HTCC2503]
          Length = 106

 Score =  105 bits (264), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/104 (27%), Positives = 51/104 (49%), Gaps = 1/104 (0%)

Query: 18  EVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRVISALNC 77
            +R AL  +    E  +       ++I+EV +S DL+ ATV+ S       D  ++ LN 
Sbjct: 1   MIRHALAEMFQREEIHEEAFPTTPVTITEVRVSPDLKSATVFCSALGKDVFDEEVAQLNA 60

Query: 78  NIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               IR  +GR +  ++Y P L+F  D + +   ++NAL+   +
Sbjct: 61  ISGAIRQVLGRKI-TMKYTPSLKFLPDETFEEAARINALLKETR 103


>gi|226313018|ref|YP_002772912.1| ribosome binding factor A [Brevibacillus brevis NBRC 100599]
 gi|254789735|sp|C0ZF49|RBFA_BREBN RecName: Full=Ribosome-binding factor A
 gi|226095966|dbj|BAH44408.1| ribosome binding factor A [Brevibacillus brevis NBRC 100599]
          Length = 121

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 60/115 (52%), Gaps = 5/115 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            N  R  RVGEE++  L  V+     +D  +    +++++V +S DL++A V++S+    
Sbjct: 1   MNKTRISRVGEEIKKELSLVLQRG-LKDPRVG--FVTVTDVEVSSDLQLAKVFVSIFGSE 57

Query: 67  SPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              +   A L     ++R  IG+ ++ LR++P+  F+ D S+    K+ +++   
Sbjct: 58  EERKASLAGLTKAKGYLRTEIGKRVK-LRHIPDFVFKLDESIDYGSKIESILREI 111


>gi|299823029|ref|ZP_07054915.1| ribosome-binding factor A [Listeria grayi DSM 20601]
 gi|299816558|gb|EFI83796.1| ribosome-binding factor A [Listeria grayi DSM 20601]
          Length = 114

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SPD 69
           RA R+ E+++  L  ++   + +D  +    ++I++V ++ DL+ AT+YIS+  +    +
Sbjct: 4   RANRIAEQMKKELGDILNR-KLKDPRLG--FVTITDVEITGDLQQATIYISVLGEEKERE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             + AL     FIR  IG  +R LR VPEL+F  D S++   +++ L+   
Sbjct: 61  NTLLALEKAHGFIRSEIGSRIR-LRKVPELQFALDGSIEYGNRIDELLRDL 110


>gi|29654722|ref|NP_820414.1| ribosome-binding factor A [Coxiella burnetii RSA 493]
 gi|153207247|ref|ZP_01946011.1| ribosome-binding factor A [Coxiella burnetii 'MSU Goat Q177']
 gi|154707600|ref|YP_001423974.1| ribosome-binding factor A [Coxiella burnetii Dugway 5J108-111]
 gi|161830027|ref|YP_001597275.1| ribosome-binding factor A [Coxiella burnetii RSA 331]
 gi|165918811|ref|ZP_02218897.1| ribosome-binding factor A [Coxiella burnetii RSA 334]
 gi|212218230|ref|YP_002305017.1| ribosome-binding factor A [Coxiella burnetii CbuK_Q154]
 gi|34098454|sp|Q83BS2|RBFA_COXBU RecName: Full=Ribosome-binding factor A
 gi|189039536|sp|A9KBM2|RBFA_COXBN RecName: Full=Ribosome-binding factor A
 gi|189039537|sp|A9N8V5|RBFA_COXBR RecName: Full=Ribosome-binding factor A
 gi|226723595|sp|B6J6B2|RBFA_COXB1 RecName: Full=Ribosome-binding factor A
 gi|29541990|gb|AAO90928.1| ribosome-binding factor A [Coxiella burnetii RSA 493]
 gi|120576735|gb|EAX33359.1| ribosome-binding factor A [Coxiella burnetii 'MSU Goat Q177']
 gi|154356886|gb|ABS78348.1| ribosome-binding factor A [Coxiella burnetii Dugway 5J108-111]
 gi|161761894|gb|ABX77536.1| ribosome-binding factor A [Coxiella burnetii RSA 331]
 gi|165917535|gb|EDR36139.1| ribosome-binding factor A [Coxiella burnetii RSA 334]
 gi|212012492|gb|ACJ19872.1| ribosome-binding factor A [Coxiella burnetii CbuK_Q154]
          Length = 119

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 63/120 (52%), Gaps = 4/120 (3%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R  RV + +   L   +L  E +D  +S+  IS++ V +S DL+ A V+ SL  + + 
Sbjct: 2   SQRQQRVADLIHQQLAE-LLKKEVRDSRLSK--ISLTAVSISPDLKQAKVFYSLLENQNE 58

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             V  ALN    ++R  + ++   LRYVP+L F YD S++   +++ L+         ++
Sbjct: 59  KEVQKALNKATGYLRHLLAQA-TVLRYVPKLEFVYDESIERAHRISLLIERALKKDDSDE 117


>gi|229824771|ref|ZP_04450840.1| hypothetical protein GCWU000182_00120 [Abiotrophia defectiva ATCC
           49176]
 gi|229791100|gb|EEP27214.1| hypothetical protein GCWU000182_00120 [Abiotrophia defectiva ATCC
           49176]
          Length = 128

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 67/124 (54%), Gaps = 4/124 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS + +R+  EV+ AL   ++    +D  +S  + S+++V ++ DL+ A V++S+  
Sbjct: 1   MRKNSIKNVRINSEVQRALSE-LIRMGVKDPRVSS-LTSVTDVEVAPDLKTAKVFVSVLG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D       +  L   + ++R ++ +S+ NLR  PELRF  DTS++    ++AL+   K  
Sbjct: 59  DEKKQKDTLEGLKSAMPYLRSQLAKSI-NLRNTPELRFHLDTSIEYGMHMSALINQVKAK 117

Query: 124 VALE 127
              E
Sbjct: 118 DKAE 121


>gi|104780029|ref|YP_606527.1| ribosome-binding factor A [Pseudomonas entomophila L48]
 gi|166219392|sp|Q1IF42|RBFA_PSEE4 RecName: Full=Ribosome-binding factor A
 gi|95109016|emb|CAK13712.1| ribosome-binding factor A [Pseudomonas entomophila L48]
          Length = 132

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S DL  A V+I++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAE-LIRREVKDPRVG--LVTITAVDVSRDLGHAKVFITVMG 57

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               D V     AL     F+R  +G  +  LR VP+L F +D S+     L+AL+    
Sbjct: 58  QDGTDAVPQTLKALTSAASFLRLHLG-RVMQLRSVPQLHFHFDESVSRGVHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|240128400|ref|ZP_04741061.1| ribosome-binding factor A [Neisseria gonorrhoeae SK-93-1035]
 gi|268686799|ref|ZP_06153661.1| ribosome-binding factor A [Neisseria gonorrhoeae SK-93-1035]
 gi|268627083|gb|EEZ59483.1| ribosome-binding factor A [Neisseria gonorrhoeae SK-93-1035]
          Length = 123

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+I+EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITINEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TVLNQDTCEITEEVLEHARGHLRSELSKRIKLFK-IPELHFKYDESLERGMSLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|227112576|ref|ZP_03826232.1| ribosome-binding factor A [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
 gi|227327828|ref|ZP_03831852.1| ribosome-binding factor A [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 132

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 39/127 (30%), Positives = 64/127 (50%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +I+  E +D  I   + ++S V +S DL  A V+++   
Sbjct: 1   MAKEFSRTQRVAQEMQKEIA-IIIQREVKDPRIG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D  P++V     AL     FIR  +G+++R LR VP L F YD SL    +++ L+    
Sbjct: 58  DNEPEQVQTAIKALQDASGFIRTLVGKAMR-LRVVPALTFSYDNSLVEGMRMSNLVTNV- 115

Query: 122 IPVALEK 128
           I    E+
Sbjct: 116 IKNDTER 122


>gi|261400321|ref|ZP_05986446.1| ribosome-binding factor A [Neisseria lactamica ATCC 23970]
 gi|269209942|gb|EEZ76397.1| ribosome-binding factor A [Neisseria lactamica ATCC 23970]
          Length = 123

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+++EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITVNEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TVLNQDAREITEEVLEHARGHLRSELAKRIKLFK-IPELHFKYDESLERGMSLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|78213858|ref|YP_382637.1| ribosome-binding factor A [Synechococcus sp. CC9605]
 gi|123577495|sp|Q3AH50|RBFA_SYNSC RecName: Full=Ribosome-binding factor A
 gi|78198317|gb|ABB36082.1| ribosome-binding factor A [Synechococcus sp. CC9605]
          Length = 140

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VSP 68
           RR  RV   +R  +  +++N   +D  +   ++SI+EV +S DL+   +++S+  +    
Sbjct: 5   RRVERVAALIRKEVSELMING-IRDERVHHGMVSITEVEVSGDLQHCKIFVSVFGEAQER 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
           D+V+  L     F+RG +GR L  +R  PE+ F+ D  L+    +  L+   +   
Sbjct: 64  DQVLEGLQAASGFLRGELGRRL-QMRRAPEVVFQLDRGLERGTSVLGLLNRLEDER 118


>gi|303240814|ref|ZP_07327327.1| ribosome-binding factor A [Acetivibrio cellulolyticus CD2]
 gi|302591702|gb|EFL61437.1| ribosome-binding factor A [Acetivibrio cellulolyticus CD2]
          Length = 118

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 62/119 (52%), Gaps = 5/119 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R +R+ EE+R  +  +I   E +D  +SR +IS++ V ++ DLR A V++S+   D    
Sbjct: 3   RTVRISEEMRKEISAII-QGELKDPRLSR-LISVTNVNVTKDLRYAKVFVSIMGSDEEKK 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             +  L     FIR  +G  +  LRY PE++F  D S++    ++ L+    +    ++
Sbjct: 61  NALDGLKSAAGFIRREVGHRI-QLRYTPEIQFELDNSIEHGAYISKLIND-AVKHDDKR 117


>gi|309389233|gb|ADO77113.1| ribosome-binding factor A [Halanaerobium praevalens DSM 2228]
          Length = 127

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 70/123 (56%), Gaps = 5/123 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-D 65
            +++RA+RVGE ++  +  ++L  E +D  I    +SI++V +S DLR A V+IS+   +
Sbjct: 1   MSNKRAVRVGELLKEEISQIVLR-EMKDPRIG--FVSITDVEVSGDLRHAKVFISVYGTE 57

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              +  ++ L     F+R  +G  ++ + + PE+ FRYD S+++   ++ ++   K    
Sbjct: 58  KEKEETLAGLQQAQGFVRKLVGERVK-IHHTPEIIFRYDDSIENGVHISNIIKDLKQSGE 116

Query: 126 LEK 128
           +++
Sbjct: 117 IKE 119


>gi|145298045|ref|YP_001140886.1| ribosome-binding factor A [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|166218416|sp|A4SJR6|RBFA_AERS4 RecName: Full=Ribosome-binding factor A
 gi|142850817|gb|ABO89138.1| ribosome-binding factor A [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 144

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 66/128 (51%), Gaps = 9/128 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             +   R  RVG++++  +  ++   E +D  I   ++++S+V +S DL  A VY++   
Sbjct: 1   MAREFSRTNRVGQQIQREIALILQR-EVKDPRIG--MVTVSDVEVSKDLNYAKVYVTFLQ 57

Query: 64  LDVSPDRVISALN---CNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           LD+  +R+   L        +IR  +G ++R LR VPELRF YD +L    +++ L+   
Sbjct: 58  LDIDAERIAEGLKGLTEAAGYIRSLLGSAMR-LRVVPELRFYYDQTLVEGMRISNLVSNT 116

Query: 121 KIPVALEK 128
            +     +
Sbjct: 117 -VRDDKRR 123


>gi|33864228|ref|NP_895788.1| ribosome-binding factor A [Prochlorococcus marinus str. MIT 9313]
 gi|39931781|sp|Q7V4I8|RBFA_PROMM RecName: Full=Ribosome-binding factor A
 gi|33635812|emb|CAE22137.1| Ribosome-binding factor A [Prochlorococcus marinus str. MIT 9313]
          Length = 142

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 55/119 (46%), Gaps = 3/119 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
              RR  RV   +R     ++++   +D  + + ++SI+ V +S DL+   +++S+  + 
Sbjct: 2   APGRRVERVAALIRRETSELLIHG-IRDERVHQGMVSITNVEVSGDLQHCKIFVSIYGEE 60

Query: 67  -SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                V+  L     F+RG +GR L  +R  PE+ F  D  ++    +  L+   +   
Sbjct: 61  IQRSEVLEGLEAASGFLRGELGRRL-QMRRAPEVHFHLDRGIEKGTSVLNLLEQLEQQR 118


>gi|255994866|ref|ZP_05428001.1| MgpA protein [Eubacterium saphenum ATCC 49989]
 gi|255993579|gb|EEU03668.1| MgpA protein [Eubacterium saphenum ATCC 49989]
          Length = 458

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 3/115 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           +R  R+ EE++  +    L  + +D ++    I+I+ V +S D R A VY  +      D
Sbjct: 5   KRKDRLAEEIKKIVSNAFL-LKVRDPILKMA-INITAVDVSPDGRNAKVYYVVFSGSDKD 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
            V +AL      IR  I  ++R +RYVP + F YDTSL+    + +++   K   
Sbjct: 63  EVAAALKKVEPLIRKEIAENMR-VRYVPNICFAYDTSLEYSRHIESILHDIKDKR 116


>gi|251792717|ref|YP_003007443.1| ribosome-binding factor A [Aggregatibacter aphrophilus NJ8700]
 gi|247534110|gb|ACS97356.1| ribosome-binding factor A [Aggregatibacter aphrophilus NJ8700]
          Length = 128

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 66/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A V+++   
Sbjct: 1   MAREFKRSDRVAQEIQKEIAVILQR-EVKDPRIG--MVTVSDVEVSSDLAYAKVFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +   +  L     +IR  +G+++R LR VPE+RF YD SL    +++ L+    
Sbjct: 58  DHDEQAIAQGMKGLEKAAPYIRTLLGKAMR-LRIVPEIRFIYDQSLVEGMRMSNLV-TNV 115

Query: 122 IPVALEK 128
           +    +K
Sbjct: 116 VREDEKK 122


>gi|160940468|ref|ZP_02087813.1| hypothetical protein CLOBOL_05358 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437048|gb|EDP14815.1| hypothetical protein CLOBOL_05358 [Clostridium bolteae ATCC
           BAA-613]
          Length = 133

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 6/125 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I     +D  I   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRINMEVQRELSEII-RGGIKDPRIH-PMTSVVSVEVTPDLKFCKAYISVLG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D       I  L     ++R  + R + NLR  PEL+F  D S++    ++ L+   ++ 
Sbjct: 59  DEEAGKSTIQGLKSAEGYVRRELARRV-NLRNTPELKFILDQSIEYGVNMSRLID--EVT 115

Query: 124 VALEK 128
             L +
Sbjct: 116 KDLHQ 120


>gi|30263814|ref|NP_846191.1| ribosome-binding factor A [Bacillus anthracis str. Ames]
 gi|47529238|ref|YP_020587.1| ribosome-binding factor A [Bacillus anthracis str. 'Ames Ancestor']
 gi|49186661|ref|YP_029913.1| ribosome-binding factor A [Bacillus anthracis str. Sterne]
 gi|65321138|ref|ZP_00394097.1| COG0858: Ribosome-binding factor A [Bacillus anthracis str. A2012]
 gi|165872633|ref|ZP_02217264.1| ribosome-binding factor A [Bacillus anthracis str. A0488]
 gi|167639837|ref|ZP_02398106.1| ribosome-binding factor A [Bacillus anthracis str. A0193]
 gi|170706868|ref|ZP_02897326.1| ribosome-binding factor A [Bacillus anthracis str. A0389]
 gi|177652087|ref|ZP_02934633.1| ribosome-binding factor A [Bacillus anthracis str. A0174]
 gi|190568437|ref|ZP_03021344.1| ribosome-binding factor A [Bacillus anthracis Tsiankovskii-I]
 gi|227813281|ref|YP_002813290.1| ribosome-binding factor A [Bacillus anthracis str. CDC 684]
 gi|229600478|ref|YP_002868049.1| ribosome-binding factor A [Bacillus anthracis str. A0248]
 gi|254735849|ref|ZP_05193555.1| ribosome-binding factor A [Bacillus anthracis str. Western North
           America USA6153]
 gi|254756002|ref|ZP_05208033.1| ribosome-binding factor A [Bacillus anthracis str. Vollum]
 gi|254759337|ref|ZP_05211362.1| ribosome-binding factor A [Bacillus anthracis str. Australia 94]
 gi|33301489|sp|Q81WM5|RBFA_BACAN RecName: Full=Ribosome-binding factor A
 gi|254789730|sp|C3P5L3|RBFA_BACAA RecName: Full=Ribosome-binding factor A
 gi|254789731|sp|C3L7B6|RBFA_BACAC RecName: Full=Ribosome-binding factor A
 gi|30258458|gb|AAP27677.1| ribosome-binding factor A [Bacillus anthracis str. Ames]
 gi|47504386|gb|AAT33062.1| ribosome-binding factor A [Bacillus anthracis str. 'Ames Ancestor']
 gi|49180588|gb|AAT55964.1| ribosome-binding factor A [Bacillus anthracis str. Sterne]
 gi|164711665|gb|EDR17211.1| ribosome-binding factor A [Bacillus anthracis str. A0488]
 gi|167512238|gb|EDR87615.1| ribosome-binding factor A [Bacillus anthracis str. A0193]
 gi|170128286|gb|EDS97155.1| ribosome-binding factor A [Bacillus anthracis str. A0389]
 gi|172082456|gb|EDT67521.1| ribosome-binding factor A [Bacillus anthracis str. A0174]
 gi|190560441|gb|EDV14419.1| ribosome-binding factor A [Bacillus anthracis Tsiankovskii-I]
 gi|227007093|gb|ACP16836.1| ribosome-binding factor A [Bacillus anthracis str. CDC 684]
 gi|229264886|gb|ACQ46523.1| ribosome-binding factor A [Bacillus anthracis str. A0248]
          Length = 118

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 62/111 (55%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA RVGE+++  L  +I   + +D  +    +++++V +S DL++ATVYIS+  D    +
Sbjct: 4   RANRVGEQMKKELGDIISR-KIKDPRVG--FVTVTDVQVSRDLQIATVYISVLGDEEQKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+   
Sbjct: 61  NTLKGLAKAKGFIRSEIGQRIR-LRKTPEISFEFDESIGYGHRIDTLLHEI 110


>gi|260885919|ref|ZP_05736166.2| ribosome-binding factor A [Prevotella tannerae ATCC 51259]
 gi|260851001|gb|EEX70870.1| ribosome-binding factor A [Prevotella tannerae ATCC 51259]
          Length = 134

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 58/117 (49%), Gaps = 4/117 (3%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           +    + R  ++   ++  L  ++     Q       ++S+S V +S DL V   Y+S+ 
Sbjct: 21  ETNMETTRQQKIERLIQKELSDMLQRQTQQAP---GVLVSVSRVRISPDLSVCRGYLSVF 77

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
                + +++ +N N+K +R  +G+ +R+ LR +PEL+F  D SL     ++ L+  
Sbjct: 78  PSERGEEIVANINANVKTVRFELGKRVRHQLRIIPELKFFIDDSLDYIEHIDELLKQ 134


>gi|218768390|ref|YP_002342902.1| ribosome-binding factor A [Neisseria meningitidis Z2491]
 gi|20978659|sp|Q9JTX7|RBFA_NEIMA RecName: Full=Ribosome-binding factor A
 gi|121052398|emb|CAM08730.1| ribosomal-binding factor A [Neisseria meningitidis Z2491]
 gi|319410636|emb|CBY91005.1| ribosome-binding factor A [Neisseria meningitidis WUE 2594]
 gi|325130450|gb|EGC53211.1| ribosome-binding factor A [Neisseria meningitidis OX99.30304]
 gi|325204366|gb|ADY99819.1| ribosome-binding factor A [Neisseria meningitidis M01-240355]
          Length = 123

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+++EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITVNEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TVLNQDAREITEEVLEHARGHLRSELAKRIKLFK-IPELHFKYDESLERGLNLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|302874664|ref|YP_003843297.1| ribosome-binding factor A [Clostridium cellulovorans 743B]
 gi|307690722|ref|ZP_07633168.1| ribosome-binding factor A [Clostridium cellulovorans 743B]
 gi|302577521|gb|ADL51533.1| ribosome-binding factor A [Clostridium cellulovorans 743B]
          Length = 127

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 59/116 (50%), Gaps = 4/116 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R+ ++ EE++  +  VI  N  +D  +   +IS++ V ++ DL+ A VY+S+   D   D
Sbjct: 5   RSEKINEEMKKQISDVI-RNRVRDPRL-APMISVTSVDVTKDLKYAKVYVSIFGSDTEKD 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
             +  L  +  FIR  +   + NLR  PEL F  DTS++    ++ L+   K    
Sbjct: 63  ESLKILKNSSGFIRREVASKI-NLRSTPELLFNLDTSIEYGMHIDRLIHSIKENED 117


>gi|326389434|ref|ZP_08211001.1| ribosome-binding factor A [Thermoanaerobacter ethanolicus JW 200]
 gi|325994439|gb|EGD52864.1| ribosome-binding factor A [Thermoanaerobacter ethanolicus JW 200]
          Length = 119

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSP 68
            R  R+ EE++  +  +IL  E +D  I   ++SI+++ ++ DLR A VY+S+   +   
Sbjct: 3   SRNSRLSEEMKREISKMIL-EEIKDPRIK-AMVSITDIEVTKDLRYAKVYVSIYGSEEDK 60

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                 L     +IR  IGR ++ +RY PE+ F  D S++    ++ ++       
Sbjct: 61  QETFEGLKSAAGYIRHEIGRRIK-MRYTPEIIFELDRSIEYGAHISEILKELNKQE 115


>gi|297250254|ref|ZP_06933917.1| ribosome-binding factor A [Neisseria polysaccharea ATCC 43768]
 gi|296839414|gb|EFH23352.1| ribosome-binding factor A [Neisseria polysaccharea ATCC 43768]
          Length = 141

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+++EV ++ D   ATV+ 
Sbjct: 19  MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITVNEVEVTRDYSHATVFY 74

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 75  TVLNQDTREITEEVLEHARGHLRSELAKRIKLFK-IPELHFKYDESLERGMNLSALIDQV 133

Query: 121 KIPVALE 127
                +E
Sbjct: 134 AAEKPVE 140


>gi|325281252|ref|YP_004253794.1| Ribosome-binding factor A [Odoribacter splanchnicus DSM 20712]
 gi|324313061|gb|ADY33614.1| Ribosome-binding factor A [Odoribacter splanchnicus DSM 20712]
          Length = 111

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 54/113 (47%), Gaps = 3/113 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            +S R  +V   ++  L  +              ++S++ V +S DL  A +Y+S+    
Sbjct: 1   MDSIRQNKVARLIQRDLSEMFQQE--CKEYTEGAMLSVTAVRVSPDLSYAKIYVSIFPSE 58

Query: 67  SPDRVISALNCNIKFIRGRIGRSL-RNLRYVPELRFRYDTSLQSYWKLNALMC 118
             + V+ +L    K IR  +G+ + + +R VPELRF  D SL    K++ L+ 
Sbjct: 59  RVEAVMKSLEEKNKSIRFILGKKVGKQMRIVPELRFFVDDSLDYIDKIDELLK 111


>gi|291484220|dbj|BAI85295.1| ribosome-binding factor A [Bacillus subtilis subsp. natto BEST195]
          Length = 115

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 59/111 (53%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           RA RVGE+++  L  +I   + +D  I    +++++V +S DL++A VYIS+  D    +
Sbjct: 2   RANRVGEQMKKELGDIISR-KLKDPRIG--FLTVTDVRVSGDLQIAKVYISVLGDEKKRE 58

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  L     FIR  IG  +R LR  PE+ F +D S+    ++  L+   
Sbjct: 59  EALKGLAKAKGFIRSEIGSRIR-LRKTPEIEFEFDESIDYGNRIETLIHEL 108


>gi|218438840|ref|YP_002377169.1| ribosome-binding factor A [Cyanothece sp. PCC 7424]
 gi|226736641|sp|B7KDJ9|RBFA_CYAP7 RecName: Full=Ribosome-binding factor A
 gi|218171568|gb|ACK70301.1| ribosome-binding factor A [Cyanothece sp. PCC 7424]
          Length = 131

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 60/119 (50%), Gaps = 3/119 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           RR  RV   ++  +  ++L+   +D  +   ++SI++V +S DL+ A +++S+       
Sbjct: 5   RRVSRVSSLIKREVSQMLLHG-IKDDRVGAGMVSITDVDVSGDLQHAKIFVSIYGTEQAK 63

Query: 70  -RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
              +  L  ++ F+R  +G+ +R LR  PE+ F  DTSL+   +   L+   +     E
Sbjct: 64  AETMEGLKSSVGFVRRELGQRIR-LRRTPEVVFLEDTSLERGDRTLHLLNQLQDARKEE 121


>gi|167035702|ref|YP_001670933.1| ribosome-binding factor A [Pseudomonas putida GB-1]
 gi|189039552|sp|B0KHX7|RBFA_PSEPG RecName: Full=Ribosome-binding factor A
 gi|166862190|gb|ABZ00598.1| ribosome-binding factor A [Pseudomonas putida GB-1]
          Length = 132

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 65/124 (52%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S DL  A V+I++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAE-LIRREVKDPRVG--LVTITAVDVSRDLGHAKVFITVMG 57

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           + +PD V     ALN    F+R  +GRS+  LR VP+L F +D S+     L+AL+    
Sbjct: 58  EETPDAVQQSLKALNSAASFLRLHLGRSM-QLRSVPQLHFHFDESVSRGVHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|15599937|ref|NP_253431.1| ribosome-binding factor A [Pseudomonas aeruginosa PAO1]
 gi|116052890|ref|YP_793207.1| ribosome-binding factor A [Pseudomonas aeruginosa UCBPP-PA14]
 gi|296391570|ref|ZP_06881045.1| ribosome-binding factor A [Pseudomonas aeruginosa PAb1]
 gi|313109724|ref|ZP_07795664.1| ribosome-binding factor A [Pseudomonas aeruginosa 39016]
 gi|20978658|sp|Q9HV56|RBFA_PSEAE RecName: Full=Ribosome-binding factor A
 gi|122257099|sp|Q02FS9|RBFA_PSEAB RecName: Full=Ribosome-binding factor A
 gi|9951005|gb|AAG08129.1|AE004888_4 ribosome-binding factor A [Pseudomonas aeruginosa PAO1]
 gi|115588111|gb|ABJ14126.1| ribosome-binding factor A [Pseudomonas aeruginosa UCBPP-PA14]
 gi|310882166|gb|EFQ40760.1| ribosome-binding factor A [Pseudomonas aeruginosa 39016]
          Length = 129

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 66/124 (53%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K+  R  R+G++++  L  +I   E +D  +   +++I+ V +S D+  A V+I++  
Sbjct: 1   MAKDYSRTQRIGDQMQRELAQLIQR-EIKDPRLG--LVTITGVEVSRDVAHAKVFITVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                ++   +  LN    ++R  +G+S++ LR VP+L F YD S++   +L+AL+    
Sbjct: 58  QDDAGKIALNMEILNDAAGYLRMLLGKSMK-LRSVPQLHFHYDESIRRGAELSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|322831215|ref|YP_004211242.1| ribosome-binding factor A [Rahnella sp. Y9602]
 gi|321166416|gb|ADW72115.1| ribosome-binding factor A [Rahnella sp. Y9602]
          Length = 137

 Score =  105 bits (262), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 63/132 (47%), Gaps = 13/132 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V +S DL  A V+++   
Sbjct: 1   MAKEFSRTQRVSQEMQKEIA-IILQREVKDPRVG--MATVSGVEVSRDLAYAKVFVTFLD 57

Query: 65  DVSPDRVIS--------ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
            ++ D            AL     FIR  IG+++R LR VPEL F YD SL    +++ L
Sbjct: 58  VLTTDNHDPDRVKNGIKALQDASGFIRTLIGKAMR-LRVVPELTFAYDNSLVEGMRMSNL 116

Query: 117 MCLPKIPVALEK 128
           +    +    E+
Sbjct: 117 VTNV-VKNDAER 127


>gi|77457007|ref|YP_346512.1| ribosome-binding factor A [Pseudomonas fluorescens Pf0-1]
 gi|123606004|sp|Q3KI83|RBFA_PSEPF RecName: Full=Ribosome-binding factor A
 gi|77381010|gb|ABA72523.1| ribosome-binding factor A [Pseudomonas fluorescens Pf0-1]
          Length = 133

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A ++I++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREVKDPRVG--LVTITAVEVSRDVGHAKIFITVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             + + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDNAEDIAQSIKVLNAAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|325578300|ref|ZP_08148435.1| ribosome-binding factor A [Haemophilus parainfluenzae ATCC 33392]
 gi|325160036|gb|EGC72165.1| ribosome-binding factor A [Haemophilus parainfluenzae ATCC 33392]
          Length = 128

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 67/127 (52%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  +IL  E +D  I   ++++S+V +S DL  A V+++   
Sbjct: 1   MAREFKRSDRVAQELQKEIA-IILQREVKDPRIG--MVTVSDVEVSSDLAYAKVFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +   +  L     +IR  +G+++R LR VPE+RF YD SL    +++ L+    
Sbjct: 58  DHDEVAIAQGMKGLEKAAPYIRSLVGKAMR-LRIVPEIRFFYDQSLVEGMRMSNLV-TNV 115

Query: 122 IPVALEK 128
           +    +K
Sbjct: 116 VREDEKK 122


>gi|107103842|ref|ZP_01367760.1| hypothetical protein PaerPA_01004913 [Pseudomonas aeruginosa PACS2]
 gi|218893838|ref|YP_002442707.1| ribosome-binding factor A [Pseudomonas aeruginosa LESB58]
 gi|254244355|ref|ZP_04937677.1| ribosome-binding factor A [Pseudomonas aeruginosa 2192]
 gi|226736650|sp|B7V1F5|RBFA_PSEA8 RecName: Full=Ribosome-binding factor A
 gi|126197733|gb|EAZ61796.1| ribosome-binding factor A [Pseudomonas aeruginosa 2192]
 gi|218774066|emb|CAW29882.1| ribosome-binding factor A [Pseudomonas aeruginosa LESB58]
          Length = 130

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 66/124 (53%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K+  R  R+G++++  L  +I   E +D  +   +++I+ V +S D+  A V+I++  
Sbjct: 1   MAKDYSRTQRIGDQMQRELAQLIQR-EIKDPRLG--LVTITGVEVSRDVAHAKVFITVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                ++   +  LN    ++R  +G+S++ LR VP+L F YD S++   +L+AL+    
Sbjct: 58  QDDAGKIALNMEILNDAAGYLRMLLGKSMK-LRSVPQLHFHYDESIRRGAELSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|255534047|ref|YP_003094419.1| ribosome-binding factor A [Pedobacter heparinus DSM 2366]
 gi|255347031|gb|ACU06357.1| ribosome-binding factor A [Pedobacter heparinus DSM 2366]
          Length = 127

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 55/123 (44%), Gaps = 5/123 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R  +    ++  L  +          +   +++I++V +S DL VA VY+S     
Sbjct: 1   MESKRQQKFAGVIQEELAAIFQREG--SAYLPNTLVTITKVRVSPDLAVAKVYLSFLNTS 58

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
           +    ++ +N +   IR ++G  +R+  R VP L F  D +     +++ L    KI   
Sbjct: 59  NTTLSVAEVNSHSGEIRYKLGARIRHQARVVPTLTFFVDDTNTYVEQMDKLFD--KISRD 116

Query: 126 LEK 128
            E+
Sbjct: 117 REE 119


>gi|298242765|ref|ZP_06966572.1| ribosome-binding factor A [Ktedonobacter racemifer DSM 44963]
 gi|297555819|gb|EFH89683.1| ribosome-binding factor A [Ktedonobacter racemifer DSM 44963]
          Length = 128

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 5/111 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  ++GE + + L   ++    +D  +     SI+ V +S DLR A V +S+       
Sbjct: 5   HRQEKLGELIAAELSE-LMRTRVKDPRVG--FASITHVEVSGDLRHAKVMVSVMGTEEEQ 61

Query: 70  R-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
              +  L     F+R  +   +  LRY+P+L F+ D S+    ++ AL+  
Sbjct: 62  AATMQGLKNASGFLRHELAERI-TLRYMPDLVFKLDHSIAEGARILALINK 111


>gi|172039587|ref|YP_001806088.1| ribosome-binding factor A [Cyanothece sp. ATCC 51142]
 gi|226723597|sp|B1WW94|RBFA_CYAA5 RecName: Full=Ribosome-binding factor A
 gi|171701041|gb|ACB54022.1| ribosome-binding factor A [Cyanothece sp. ATCC 51142]
          Length = 129

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 59/116 (50%), Gaps = 3/116 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            NSRR  RV   ++  +  ++L  + +D  +   ++S+++V +S DL+ A +++S+    
Sbjct: 2   ANSRRVSRVSSLIKREVSQMLL-FDIKDDRVGAGMVSVTDVDLSGDLQHAKIFVSIYGTE 60

Query: 67  SPD-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                 +  L  +  ++R  + + +R LR  PE+RF  D  ++   K+  L+   +
Sbjct: 61  EAKVETMEGLKSSEGYVRKELAQRIR-LRRAPEVRFFEDHGIERGDKMLHLLNEIR 115


>gi|330807484|ref|YP_004351946.1| ribosome-binding factor A; RBFA, ribosome-binding factor A
           superfamily [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327375592|gb|AEA66942.1| ribosome-binding factor A; RBFA, Ribosome-binding factor A
           superfamily [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 133

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A ++I++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREVKDPRVG--LVTITAVEVSRDVGHAKIFITVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             S + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDSAEEIAQSIKVLNSAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|194098831|ref|YP_002001894.1| ribosome-binding factor A [Neisseria gonorrhoeae NCCP11945]
 gi|240013974|ref|ZP_04720887.1| ribosome-binding factor A [Neisseria gonorrhoeae DGI18]
 gi|240016416|ref|ZP_04722956.1| ribosome-binding factor A [Neisseria gonorrhoeae FA6140]
 gi|240080535|ref|ZP_04725078.1| ribosome-binding factor A [Neisseria gonorrhoeae FA19]
 gi|240115852|ref|ZP_04729914.1| ribosome-binding factor A [Neisseria gonorrhoeae PID18]
 gi|240118150|ref|ZP_04732212.1| ribosome-binding factor A [Neisseria gonorrhoeae PID1]
 gi|240121541|ref|ZP_04734503.1| ribosome-binding factor A [Neisseria gonorrhoeae PID24-1]
 gi|240123699|ref|ZP_04736655.1| ribosome-binding factor A [Neisseria gonorrhoeae PID332]
 gi|240125889|ref|ZP_04738775.1| ribosome-binding factor A [Neisseria gonorrhoeae SK-92-679]
 gi|260440332|ref|ZP_05794148.1| ribosome-binding factor A [Neisseria gonorrhoeae DGI2]
 gi|268596667|ref|ZP_06130834.1| ribosome-binding factor A [Neisseria gonorrhoeae FA19]
 gi|268601528|ref|ZP_06135695.1| ribosome-binding factor A [Neisseria gonorrhoeae PID18]
 gi|268603867|ref|ZP_06138034.1| ribosome-binding factor A [Neisseria gonorrhoeae PID1]
 gi|268682331|ref|ZP_06149193.1| ribosome-binding factor A [Neisseria gonorrhoeae PID332]
 gi|268684488|ref|ZP_06151350.1| ribosome-binding factor A [Neisseria gonorrhoeae SK-92-679]
 gi|291043625|ref|ZP_06569341.1| ribosome-binding factor A [Neisseria gonorrhoeae DGI2]
 gi|238690204|sp|B4RMA9|RBFA_NEIG2 RecName: Full=Ribosome-binding factor A
 gi|193934121|gb|ACF29945.1| ribosome-binding factor A [Neisseria gonorrhoeae NCCP11945]
 gi|268550455|gb|EEZ45474.1| ribosome-binding factor A [Neisseria gonorrhoeae FA19]
 gi|268585659|gb|EEZ50335.1| ribosome-binding factor A [Neisseria gonorrhoeae PID18]
 gi|268587998|gb|EEZ52674.1| ribosome-binding factor A [Neisseria gonorrhoeae PID1]
 gi|268622615|gb|EEZ55015.1| ribosome-binding factor A [Neisseria gonorrhoeae PID332]
 gi|268624772|gb|EEZ57172.1| ribosome-binding factor A [Neisseria gonorrhoeae SK-92-679]
 gi|291012088|gb|EFE04077.1| ribosome-binding factor A [Neisseria gonorrhoeae DGI2]
          Length = 123

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+I+EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITINEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TVLNQDTREITEEVLEHARGHLRSELSKRIKLFK-IPELHFKYDESLERGMSLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|294634516|ref|ZP_06713051.1| ribosome-binding factor A [Edwardsiella tarda ATCC 23685]
 gi|291092030|gb|EFE24591.1| ribosome-binding factor A [Edwardsiella tarda ATCC 23685]
          Length = 132

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 37/127 (29%), Positives = 64/127 (50%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV +E++  +  +IL  E +D  +   + ++S V +S DL  A V+++   
Sbjct: 1   MAREFSRTQRVAQEMQKEIA-IILQREVKDPRVG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D  P+ V     AL     FIR  +G+++R LR VPEL F YD+SL    +++ L+    
Sbjct: 58  DGEPEAVKAGLKALQDASGFIRMLLGKAMR-LRVVPELTFSYDSSLVEGMRMSNLVSNV- 115

Query: 122 IPVALEK 128
           +     +
Sbjct: 116 VKDDEAR 122


>gi|207723242|ref|YP_002253641.1| ribosome-binding factor a protein [Ralstonia solanacearum MolK2]
 gi|206588438|emb|CAQ35401.1| ribosome-binding factor a protein [Ralstonia solanacearum MolK2]
          Length = 123

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 60/127 (47%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K+   S R +R+ ++++  L  +I   E ++  +   ++++  V ++ D   A +Y 
Sbjct: 1   MPKKSGSASGRNVRIADQIQRDLAELIQR-EIKNPAMG--LVTLQSVSLTPDYAHAKIYF 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++     PD   + LN    ++   + + L ++  VP L F YD S++   +++ L+   
Sbjct: 58  TVLGA-EPDAAAAILNEKAGYLHSLLFKRL-HIHTVPTLHFHYDGSVERGIEMSRLIDEA 115

Query: 121 KIPVALE 127
               A +
Sbjct: 116 NATRAKD 122


>gi|332532412|ref|ZP_08408290.1| ribosome-binding factor A [Pseudoalteromonas haloplanktis ANT/505]
 gi|332038055|gb|EGI74502.1| ribosome-binding factor A [Pseudoalteromonas haloplanktis ANT/505]
          Length = 160

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 58/122 (47%), Gaps = 8/122 (6%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           +   R  RV ++++  +  ++   E +D  +   ++++S V +S DL  A ++I++    
Sbjct: 2   REFSRTDRVAQQIQKEIAVILQR-EIKDPRLG--MVTVSAVEVSRDLSYAKIFITVFNTQ 58

Query: 67  SPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
             D        LN    +IR  +G+ +R  R +PEL+F  D SL    +++ L+    I 
Sbjct: 59  DEDAAKQSAKVLNEATGYIRSLLGKRIRA-RIMPELKFVVDNSLMEGMRISNLVDSI-IR 116

Query: 124 VA 125
             
Sbjct: 117 ED 118


>gi|89900919|ref|YP_523390.1| ribosome-binding factor A [Rhodoferax ferrireducens T118]
 gi|122479182|sp|Q21WJ4|RBFA_RHOFD RecName: Full=Ribosome-binding factor A
 gi|89345656|gb|ABD69859.1| ribosome-binding factor A [Rhodoferax ferrireducens T118]
          Length = 122

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+ K+     RA +V ++++  L  +I   E +D  +   +++I  V ++ D   A VY 
Sbjct: 1   MRKKSKTP-NRAFKVADQIQRDLTELIAR-ELKDPRVG--MVTIQAVEVTPDYAHAKVYF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           SL     P      LN    F+R  + + L ++  VP L F +D + +    +NAL+   
Sbjct: 57  SLL-AGDPKACTEGLNQAAGFLRAGLFKRL-HIHTVPTLHFLFDQTTERAADMNALIARA 114

Query: 121 KIPVALE 127
               A E
Sbjct: 115 VASRAKE 121


>gi|219870868|ref|YP_002475243.1| ribosome-binding factor A [Haemophilus parasuis SH0165]
 gi|254789752|sp|B8F4P3|RBFA_HAEPS RecName: Full=Ribosome-binding factor A
 gi|219691072|gb|ACL32295.1| ribosome-binding factor A [Haemophilus parasuis SH0165]
          Length = 127

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 66/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   RA RV +E++  +  +IL  E +D  I   ++++S+V +S DL  A V+++   
Sbjct: 1   MAREFSRADRVAQELQKEIA-IILQREVKDPRIG--MVTVSDVEISRDLAYAKVFVTFLF 57

Query: 65  DVSPDRVISAL---NCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V   L   N    +IR  +G+++R LR VPELRF YD SL    +++ L+    
Sbjct: 58  DSDESAVERGLEGLNKASGYIRTLVGKAMR-LRIVPELRFVYDQSLVEGMRMSNLV-TNV 115

Query: 122 IPVALEK 128
           I    E+
Sbjct: 116 IRKDQER 122


>gi|124024303|ref|YP_001018610.1| ribosome-binding factor A [Prochlorococcus marinus str. MIT 9303]
 gi|166219388|sp|A2CCY5|RBFA_PROM3 RecName: Full=Ribosome-binding factor A
 gi|123964589|gb|ABM79345.1| Ribosome-binding factor A [Prochlorococcus marinus str. MIT 9303]
          Length = 142

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 55/119 (46%), Gaps = 3/119 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
              RR  RV   +R     ++++   +D  + + ++SI+ V +S DL+   +++S+  + 
Sbjct: 2   APGRRVERVAALIRRETSELLIHG-IRDERVHQGMVSITNVEVSGDLQHCKIFVSIYGEE 60

Query: 67  -SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                V+  L     F+RG +GR L  +R  PE+ F  D  ++    +  L+   +   
Sbjct: 61  IQRSEVLEGLEAASGFLRGELGRRL-QMRRAPEVHFHLDRGIEKGTSVLNLLEQLEQQR 118


>gi|77359944|ref|YP_339519.1| ribosome-binding factor A, role in processing of 16S rRNA
           [Pseudoalteromonas haloplanktis TAC125]
 gi|123588866|sp|Q3IJ52|RBFA_PSEHT RecName: Full=Ribosome-binding factor A
 gi|76874855|emb|CAI86076.1| ribosome-binding factor A, role in processing of 16S rRNA
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 166

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 8/122 (6%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           +   R  RV ++++  +  ++   E +D  +   ++++S V +S DL  A ++I++    
Sbjct: 2   REFSRTDRVAQQIQKEIAVILQR-EIKDPRLG--MVTVSAVEVSRDLSYAKIFITVFNTQ 58

Query: 67  SPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
             +        LN    +IR  +G+ +R  R +PEL+F  D SL    +++ L+    I 
Sbjct: 59  DDNAAKQSANVLNEATGYIRSLLGKRIRA-RIMPELKFLVDNSLMEGMRISNLVDSI-IR 116

Query: 124 VA 125
             
Sbjct: 117 ED 118


>gi|254447065|ref|ZP_05060532.1| ribosome-binding factor A [gamma proteobacterium HTCC5015]
 gi|198263204|gb|EDY87482.1| ribosome-binding factor A [gamma proteobacterium HTCC5015]
          Length = 142

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 34/125 (27%), Positives = 66/125 (52%), Gaps = 5/125 (4%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
           +   K+  R+ RV ++++  L   ++  E +D  +S   +++ EV ++ DL  A +YI+ 
Sbjct: 12  HTMAKDYPRSYRVADQIQKDLAN-LIRTEVKDPRLSD-FVTLEEVRVTRDLSQAKIYITT 69

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             D + D   + LN    F+RG +G+ LR LR +P+L F YD + +   +++ L+    I
Sbjct: 70  LDDKAEDSA-AVLNRASGFLRGVLGKRLR-LRVIPQLHFIYDATQEEAQRIDGLIR-EAI 126

Query: 123 PVALE 127
               +
Sbjct: 127 ASDEQ 131


>gi|331011500|gb|EGH91556.1| ribosome-binding factor A [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 138

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKKYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITPVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             S + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDSAEEIAQTIKVLNSAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAQD 119


>gi|161870244|ref|YP_001599414.1| ribosome-binding factor A [Neisseria meningitidis 053442]
 gi|304387301|ref|ZP_07369494.1| ribosome-binding factor A [Neisseria meningitidis ATCC 13091]
 gi|189039549|sp|A9M021|RBFA_NEIM0 RecName: Full=Ribosome-binding factor A
 gi|161595797|gb|ABX73457.1| ribosomal-binding factor A [Neisseria meningitidis 053442]
 gi|254672176|emb|CBA05023.1| Ribosome-binding factor A [Neisseria meningitidis alpha275]
 gi|304338684|gb|EFM04801.1| ribosome-binding factor A [Neisseria meningitidis ATCC 13091]
 gi|325128437|gb|EGC51318.1| ribosome-binding factor A [Neisseria meningitidis N1568]
          Length = 123

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+++EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITVNEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TILNQDAREITEEVLEHARGHLRSELAKRIKLFK-IPELHFKYDESLERGLNLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|73541715|ref|YP_296235.1| ribosome-binding factor A [Ralstonia eutropha JMP134]
 gi|123624724|sp|Q46ZP2|RBFA_RALEJ RecName: Full=Ribosome-binding factor A
 gi|72119128|gb|AAZ61391.1| ribosome-binding factor A [Ralstonia eutropha JMP134]
          Length = 122

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K    S R LR+ ++++  L  +I   E +D  +   ++++  V ++ D   A VY 
Sbjct: 1   MAKKGNI-SSRNLRISDQIQKELAEMIQR-EIRDPRLG--LVTLQSVALTPDYAHAKVYF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++     P+   + L     ++   + + L ++  VP L F +DTS++   +++ L+   
Sbjct: 57  TVLGA-EPEVAAAILKEKAGYLHSLLFKRL-HIHTVPTLHFHHDTSVEHAIEMSKLINEA 114

Query: 121 KIPV 124
               
Sbjct: 115 NATR 118


>gi|253682529|ref|ZP_04863326.1| ribosome-binding factor A [Clostridium botulinum D str. 1873]
 gi|253562241|gb|EES91693.1| ribosome-binding factor A [Clostridium botulinum D str. 1873]
          Length = 121

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 59/112 (52%), Gaps = 4/112 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           R  R+ EEVR  +  +I  ++  D  +   ++S++ V ++ DLR A V+IS+    +  +
Sbjct: 5   RLGRINEEVRKEISNII-RDDIHDPRL-TAMVSVTRVEVTNDLRYAKVFISIFGSNNSKE 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             + AL  +  FIR  +G  ++ LRY PE+    D S++    +N L+   K
Sbjct: 63  ETLEALKSSAGFIRREVGHRVK-LRYTPEIVLELDESIEHGMHINDLLSNLK 113


>gi|71276361|ref|ZP_00652638.1| Ribosome-binding factor A [Xylella fastidiosa Dixon]
 gi|71898656|ref|ZP_00680826.1| Ribosome-binding factor A [Xylella fastidiosa Ann-1]
 gi|170729434|ref|YP_001774867.1| ribosome-binding factor A [Xylella fastidiosa M12]
 gi|238687909|sp|B0U1Q9|RBFA_XYLFM RecName: Full=Ribosome-binding factor A
 gi|71162823|gb|EAO12548.1| Ribosome-binding factor A [Xylella fastidiosa Dixon]
 gi|71731603|gb|EAO33664.1| Ribosome-binding factor A [Xylella fastidiosa Ann-1]
 gi|167964227|gb|ACA11237.1| ribosomal-binding factor A [Xylella fastidiosa M12]
          Length = 125

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
            K+ +R  R+  ++R  L    +    +D  +    +S+S+V ++ D+  A V++++   
Sbjct: 3   KKSFQRTERISVQIRRDLGA-FVQAAVRDHGLPS--MSVSDVEVTRDMAHAKVFVTVLQA 59

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                 ++ L    + +R ++ +++R LR+VPEL F YD SL    ++N L+     P  
Sbjct: 60  ERSFEAVAGLKALARELRMQLAQTMR-LRFVPELHFHYDDSLDRGERINTLLRDLIPPAD 118

Query: 126 LEK 128
            EK
Sbjct: 119 AEK 121


>gi|71901437|ref|ZP_00683527.1| Ribosome-binding factor A [Xylella fastidiosa Ann-1]
 gi|71728808|gb|EAO30949.1| Ribosome-binding factor A [Xylella fastidiosa Ann-1]
          Length = 125

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
            K+ +R  RV  ++R  L    +    +D  +    +S+S+V ++ D+  A V+++    
Sbjct: 3   KKSFQRTERVSVQIRRDLGA-FVQAAVRDHGLPS--MSVSDVEVTRDMAHAKVFVTALQA 59

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                 ++ L    + +R ++ +++R LR+VPEL F YD SL    ++N L+     P  
Sbjct: 60  ERSFEAVAGLKALARELRMQLAQTMR-LRFVPELHFHYDDSLDRGERINTLLRDLIPPAD 118

Query: 126 LEK 128
            EK
Sbjct: 119 AEK 121


>gi|319401440|gb|EFV89650.1| ribosome-binding factor A [Staphylococcus epidermidis FRI909]
 gi|329724355|gb|EGG60867.1| ribosome-binding factor A [Staphylococcus epidermidis VCU144]
          Length = 116

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 65/115 (56%), Gaps = 5/115 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            N+ RA RVGE+++  +M + +NN+ +D  +    ++I++V ++ DL  A VY+++  + 
Sbjct: 1   MNNIRAERVGEQMKQEIMDI-VNNKVKDPRVG--FLTITDVELTNDLSQAKVYLTVLGND 57

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              D    AL+    FI+  +G  +R LR +PEL F YD S++   K+  ++   
Sbjct: 58  KEVDNTFKALHKATGFIKSELGSRMR-LRIIPELTFEYDESIEYGNKIERMIQDL 111


>gi|325299551|ref|YP_004259468.1| ribosome-binding factor A [Bacteroides salanitronis DSM 18170]
 gi|324319104|gb|ADY36995.1| ribosome-binding factor A [Bacteroides salanitronis DSM 18170]
          Length = 111

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 55/114 (48%), Gaps = 4/114 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  +        R +   ++S+S V +S D+  A  Y+S+    
Sbjct: 1   METTRQNKIARLLQKELSEMFQQQT---RAMHGVLVSVSVVRISPDMSYARGYLSVFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLR-NLRYVPELRFRYDTSLQSYWKLNALMCL 119
             + ++  +N N+K IR  +G+ +R  LR +PEL+F  D SL     ++ L+  
Sbjct: 58  RAEEIVKNINDNVKSIRYELGKRVRFQLRIIPELKFFVDDSLDYAAHIDELLKK 111


>gi|312963082|ref|ZP_07777567.1| Ribosome-binding factor A [Pseudomonas fluorescens WH6]
 gi|311282593|gb|EFQ61189.1| Ribosome-binding factor A [Pseudomonas fluorescens WH6]
          Length = 131

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A ++I++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREVKDPRVG--LVTITAVEVSRDVGHAKIFITVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             + + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDNSEEIAQSIKVLNSAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|323705399|ref|ZP_08116974.1| ribosome-binding factor A [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323535301|gb|EGB25077.1| ribosome-binding factor A [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 119

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 62/119 (52%), Gaps = 4/119 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           R  R+ EE++  +  +I   E +D  IS  + SI+++ +S DLR A +YIS+  +     
Sbjct: 4   RIGRLSEEIKKEVSQMIF-EEIKDPRISN-MTSITDIEVSKDLRYAKIYISVYGNDDEKK 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             I  L     FIR  +G+ ++ LRY+PEL F  D S++    ++ ++       + +K
Sbjct: 62  NTIEGLKSATGFIRRELGKRIK-LRYIPELIFELDNSIEYGAHISKILKDLDSRESEDK 119


>gi|229918670|ref|YP_002887316.1| ribosome-binding factor A [Exiguobacterium sp. AT1b]
 gi|229470099|gb|ACQ71871.1| ribosome-binding factor A [Exiguobacterium sp. AT1b]
          Length = 115

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 56/113 (49%), Gaps = 6/113 (5%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-- 67
            RA RV E++R  +  V+L  E  D        +I+ V ++ DL+ ATVY ++  D    
Sbjct: 3   IRAQRVAEQMRKEITDVLLR-EVSDPRTKNA--TITSVDVTGDLQQATVYYTVLGDEEDV 59

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                + L+    FIR  IG  +R LR  PE+ F YD+S+     +++L+   
Sbjct: 60  KAETQAGLDKAKGFIRREIGNRIR-LRKTPEISFEYDSSVAYGSHIDSLIRDL 111


>gi|307150648|ref|YP_003886032.1| ribosome-binding factor A [Cyanothece sp. PCC 7822]
 gi|306980876|gb|ADN12757.1| ribosome-binding factor A [Cyanothece sp. PCC 7822]
          Length = 133

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           RR  RV   ++  +  ++L  E +D  +   ++S+++V +S DL+ A +++S+       
Sbjct: 5   RRVSRVSSLIKREVSQMLL-YEIKDDRVGAGMVSVTDVDVSGDLQHAKIFVSIYGTEQAK 63

Query: 70  -RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
              +  L  +  F+R  +G+ +R LR  PE+ F  D SL+   +   L+   +   
Sbjct: 64  AETMEGLRSSAGFVRRELGQRIR-LRRTPEIVFFEDRSLERGDRTLHLLNQLRDTR 118


>gi|218246068|ref|YP_002371439.1| ribosome-binding factor A [Cyanothece sp. PCC 8801]
 gi|257059118|ref|YP_003137006.1| ribosome-binding factor A [Cyanothece sp. PCC 8802]
 gi|226736642|sp|B7K2E7|RBFA_CYAP8 RecName: Full=Ribosome-binding factor A
 gi|218166546|gb|ACK65283.1| ribosome-binding factor A [Cyanothece sp. PCC 8801]
 gi|256589284|gb|ACV00171.1| ribosome-binding factor A [Cyanothece sp. PCC 8802]
          Length = 128

 Score =  104 bits (261), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 61/116 (52%), Gaps = 3/116 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            NSRR  RV   ++  +  ++L ++ +D  +   ++S++EV +S DL+ AT+++S+    
Sbjct: 2   ANSRRVSRVSSLIKREVSQMLL-HDIKDDRVGAGMVSVTEVDVSGDLQHATIFVSIYGSE 60

Query: 67  SPD-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                 +  L  +  F+R  +   +R LR  PE+ FR D SL+   ++  L+   K
Sbjct: 61  QAQAETMEGLKSSTSFVRRELSHRMR-LRRSPEVVFRQDHSLERGDRMVHLLNQIK 115


>gi|260771172|ref|ZP_05880099.1| ribosome-binding factor A [Vibrio furnissii CIP 102972]
 gi|260613769|gb|EEX38961.1| ribosome-binding factor A [Vibrio furnissii CIP 102972]
 gi|315179222|gb|ADT86136.1| ribosome-binding factor A [Vibrio furnissii NCTC 11218]
          Length = 131

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 67/126 (53%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
            PK   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MPKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESCLNALREHEVHIRMMLGKRIR-LRLTPEIRFHYDNTLVEGMRMSNLV-TEVV 115

Query: 123 PVALEK 128
               +K
Sbjct: 116 SQDKQK 121


>gi|152989168|ref|YP_001350785.1| ribosome-binding factor A [Pseudomonas aeruginosa PA7]
 gi|166219391|sp|A6VCK0|RBFA_PSEA7 RecName: Full=Ribosome-binding factor A
 gi|150964326|gb|ABR86351.1| ribosome-binding factor A [Pseudomonas aeruginosa PA7]
          Length = 128

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 67/124 (54%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K+  R  R+G++++  L  +I   E +D  +   +++I+ V +S D+  A V+I++  
Sbjct: 1   MAKDYSRTQRIGDQMQRELAQLIQR-EIKDPRLG--LVTITGVEVSRDVAHAKVFITVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               +RV   +  LN    ++R  +G+S++ LR VP+L F YD S++   +L+AL+    
Sbjct: 58  QDDAERVALNMEILNDAAGYLRMLLGKSMK-LRSVPQLHFHYDESIRRGAELSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|108757332|ref|YP_630299.1| ribosome-binding factor A [Myxococcus xanthus DK 1622]
 gi|122389557|sp|Q1DAM4|RBFA_MYXXD RecName: Full=Ribosome-binding factor A
 gi|108461212|gb|ABF86397.1| ribosome-binding factor A [Myxococcus xanthus DK 1622]
          Length = 119

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 57/116 (49%), Gaps = 4/116 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VSP 68
            R  RVG+E+++A+  ++     +D  I    I+I+ V +S DLRVA V+ S+  +    
Sbjct: 5   SRPERVGQEIQAAIGDLLTRGMLRDPRIG--YITITGVKVSPDLRVARVFYSMMGNEQER 62

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                 L     F+R  +  ++ NLR  PE+ F +D S+    K++ L+   +   
Sbjct: 63  ADTQKGLEAAKGFVRREVTSAV-NLRVSPEIFFSFDESVGEGDKIDRLLREVRNKE 117


>gi|229592635|ref|YP_002874754.1| ribosome-binding factor A [Pseudomonas fluorescens SBW25]
 gi|259552059|sp|C3K258|RBFA_PSEFS RecName: Full=Ribosome-binding factor A
 gi|229364501|emb|CAY52349.1| ribosome-binding factor A [Pseudomonas fluorescens SBW25]
          Length = 131

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A ++I++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREVKDPRVG--LVTITAVEVSRDVGHAKIFITVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             S + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    
Sbjct: 58  QDSAEEIAQSIKVLNAAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|325276166|ref|ZP_08141971.1| ribosome-binding factor A [Pseudomonas sp. TJI-51]
 gi|324098703|gb|EGB96744.1| ribosome-binding factor A [Pseudomonas sp. TJI-51]
          Length = 132

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 65/124 (52%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S DL  A V+I++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAE-LIRREVKDPRVG--LVTITAVDVSRDLGHAKVFITVMG 57

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           + +PD V     ALN    F+R  +GRS+  LR VP+L F +D S+     L+AL+    
Sbjct: 58  EETPDAVQQSLKALNSAASFLRLHLGRSM-QLRSVPQLHFHFDESVSRGVHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|167856180|ref|ZP_02478918.1| ribosome-binding factor A [Haemophilus parasuis 29755]
 gi|167852702|gb|EDS23978.1| ribosome-binding factor A [Haemophilus parasuis 29755]
          Length = 127

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 40/127 (31%), Positives = 66/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   RA RV +E++  +  +IL  E +D  I   ++++S+V +S DL  A V+++   
Sbjct: 1   MAREFSRADRVAQELQKEIA-IILQREVKDPRIG--MVTVSDVEISRDLAYAKVFVTFLF 57

Query: 65  DVSPDRVISAL---NCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     V   L   N    +IR  +G+++R LR VPELRF YD SL    +++ L+    
Sbjct: 58  DSDESAVERGLEGLNKASGYIRTLVGKAMR-LRIVPELRFVYDQSLVEGMRMSNLV-TNV 115

Query: 122 IPVALEK 128
           I    E+
Sbjct: 116 IRKDQER 122


>gi|59801071|ref|YP_207783.1| ribosome-binding factor A [Neisseria gonorrhoeae FA 1090]
 gi|75432521|sp|Q5F8W6|RBFA_NEIG1 RecName: Full=Ribosome-binding factor A
 gi|59717966|gb|AAW89371.1| putative ribosomal-binding factor A [Neisseria gonorrhoeae FA 1090]
          Length = 123

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK        R  RV E++   L   ++    +D       I+I+EV ++ D   ATV+ 
Sbjct: 1   MKKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITINEVEITRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TVLNQDTREITEEVLEHARGHLRSELSKRIKLFK-IPELHFKYDESLERGMSLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|255524227|ref|ZP_05391186.1| ribosome-binding factor A [Clostridium carboxidivorans P7]
 gi|296185348|ref|ZP_06853758.1| ribosome-binding factor A [Clostridium carboxidivorans P7]
 gi|255512052|gb|EET88333.1| ribosome-binding factor A [Clostridium carboxidivorans P7]
 gi|296050182|gb|EFG89606.1| ribosome-binding factor A [Clostridium carboxidivorans P7]
          Length = 121

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 61/115 (53%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R+ R+ EE++  +  +I  N+ +D  +   +IS+++V ++ DLR A VY+S+  D     
Sbjct: 5   RSGRINEEMKREISTII-QNDIKDPRL-SAMISVTKVDVTKDLRYAKVYVSIFGDEESKN 62

Query: 71  -VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               AL  +  FIR  IG  + NLRY PE+    D +++    ++AL+   K   
Sbjct: 63  STFEALKGSAGFIRREIGHKI-NLRYTPEILIELDNTIEQGMHIDALLHKIKEKE 116


>gi|20807839|ref|NP_623010.1| ribosome-binding factor A [Thermoanaerobacter tengcongensis MB4]
 gi|22096031|sp|Q8RA38|RBFA_THETN RecName: Full=Ribosome-binding factor A
 gi|20516401|gb|AAM24614.1| Ribosome-binding factor A [Thermoanaerobacter tengcongensis MB4]
          Length = 122

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 61/121 (50%), Gaps = 4/121 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R+ R+ EE++  +  +IL  E +D  I   ++SI+++ ++ DLR A VY+S+  
Sbjct: 1   MRKMQYRSHRLSEELKKEISKMIL-EEIKDPRIK-AMVSITDIEVTKDLRYAKVYVSIYG 58

Query: 65  DVSPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                R     L     +IR  IGR ++ +RY PE+ F  D S++   K++ ++      
Sbjct: 59  SEEEKRETFEGLKSAAGYIRHEIGRRIK-MRYTPEIIFELDHSIEYGAKISEILKELNKQ 117

Query: 124 V 124
            
Sbjct: 118 E 118


>gi|22299172|ref|NP_682419.1| ribosome-binding factor A [Thermosynechococcus elongatus BP-1]
 gi|29427713|sp|Q8DIF9|RBFA_THEEB RecName: Full=Ribosome-binding factor A
 gi|22295354|dbj|BAC09181.1| ribosome binding factor A [Thermosynechococcus elongatus BP-1]
          Length = 126

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 29/112 (25%), Positives = 59/112 (52%), Gaps = 3/112 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-P 68
           RR  RV E ++  +  +++  E +D  +   ++S+++V +S DL+ A +++S+       
Sbjct: 5   RRVARVAELIKREVSQLLM-YEIRDERVGAGMVSVTDVEVSGDLQHAKIFVSIYSTEEVR 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              ++ L     F+R  +G+ +R LR  PE+ F  D SL+   ++ AL+   
Sbjct: 64  RSTMAGLKAASGFVRRELGQRIR-LRRTPEVVFIEDRSLERGSRVLALLNQI 114


>gi|134299803|ref|YP_001113299.1| ribosome-binding factor A [Desulfotomaculum reducens MI-1]
 gi|172044303|sp|A4J5X1|RBFA_DESRM RecName: Full=Ribosome-binding factor A
 gi|134052503|gb|ABO50474.1| ribosome-binding factor A [Desulfotomaculum reducens MI-1]
          Length = 120

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 58/117 (49%), Gaps = 5/117 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-S 67
           S R  RV E ++  +   ++ N+ +D  I    ++I+ V ++ DL  A ++IS+      
Sbjct: 2   SHRPERVAEAIKKEVAD-LIRNDIKDPRIG--FVTITGVEVTRDLSFAKIFISVMGSDAH 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               +S L  +  ++R  IGR ++ LR+ PEL F+ DTSL    ++  ++       
Sbjct: 59  RQETLSILQKSAGYMRSEIGRRIK-LRHAPELIFKLDTSLDHGTRIAEILHEINSQE 114


>gi|94310968|ref|YP_584178.1| ribosome-binding factor A [Cupriavidus metallidurans CH34]
 gi|166219397|sp|Q1LLR7|RBFA_RALME RecName: Full=Ribosome-binding factor A
 gi|93354820|gb|ABF08909.1| 30s ribosome binding factor [Cupriavidus metallidurans CH34]
          Length = 123

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 59/127 (46%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K    S R LR+ ++++  L  +I   E +D  +   ++++  V ++ D   A VY 
Sbjct: 1   MAKKGNITS-RNLRLSDQIQKELAEMIQR-EIRDPRLG--LVTLQSVSLTPDYAHAKVYF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++     P+   + L     ++   + + L ++  VP L F +DTS++   +++ L+   
Sbjct: 57  TVLGA-EPETAAAILKEKAGYLHSLLFKRL-HIHTVPTLHFHHDTSVEHAIEMSKLINEA 114

Query: 121 KIPVALE 127
               A +
Sbjct: 115 NATRAKD 121


>gi|327404009|ref|YP_004344847.1| ribosome-binding factor A [Fluviicola taffensis DSM 16823]
 gi|327319517|gb|AEA44009.1| ribosome-binding factor A [Fluviicola taffensis DSM 16823]
          Length = 111

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 54/113 (47%), Gaps = 2/113 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            +S R  R+   ++  L      N     +    ++S++ V ++ DL +A +Y+S+ +  
Sbjct: 1   MSSIRQNRIEGVIQEELATYFQRNT--QEICLGAMVSVTIVRVTSDLSLARIYLSVFMGP 58

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
               V+  +  N K IRG +G  L+N+  +PEL F  D SL     +N L+  
Sbjct: 59  DKQEVLKNIQVNSKKIRGEVGNRLKNMHKIPELLFYIDDSLDYAETINKLLKD 111


>gi|307264916|ref|ZP_07546478.1| ribosome-binding factor A [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306920174|gb|EFN50386.1| ribosome-binding factor A [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 119

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 58/115 (50%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R  R+ EE++  +  +IL  E +D  I   ++SI+++ ++ DLR A VY+S+   +    
Sbjct: 4   RNSRLSEEMKREISKMIL-EEIKDPRIK-AMVSITDIEVTKDLRYAKVYVSIYGSEEDKQ 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                L     +IR  IGR ++ +RY PE+ F  D S++    ++ ++       
Sbjct: 62  ETFEGLKSAAGYIRHEIGRRIK-MRYTPEIIFELDRSIEYGAYISEILKELNKQE 115


>gi|220906274|ref|YP_002481585.1| ribosome-binding factor A [Cyanothece sp. PCC 7425]
 gi|254789745|sp|B8HWS1|RBFA_CYAP4 RecName: Full=Ribosome-binding factor A
 gi|219862885|gb|ACL43224.1| ribosome-binding factor A [Cyanothece sp. PCC 7425]
          Length = 134

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 62/124 (50%), Gaps = 7/124 (5%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           RR  RV E ++  +  ++++   +D  +   ++S+++V +S DL+ A +++S+    +  
Sbjct: 5   RRVARVAELIKREISQMLMSG-IKDDRVGSGMVSVTDVDLSGDLQHAKIFVSIYGTEAAR 63

Query: 70  -RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV---- 124
              ++ L     ++R  +G  +R LR  PE+ F  D SL+   ++ +L+           
Sbjct: 64  AETMAGLKAATGYVRSELGHRVR-LRRTPEVVFLEDRSLERGTQVLSLLNRLSEERQKNA 122

Query: 125 ALEK 128
            L++
Sbjct: 123 DLDE 126


>gi|16273202|ref|NP_439440.1| ribosome-binding factor A [Haemophilus influenzae Rd KW20]
 gi|260581410|ref|ZP_05849224.1| ribosome-binding factor A [Haemophilus influenzae RdAW]
 gi|1172847|sp|P45141|RBFA_HAEIN RecName: Full=Ribosome-binding factor A
 gi|33357151|pdb|1JOS|A Chain A, Ribosome Binding Factor A(Rbfa)
 gi|1574747|gb|AAC22937.1| ribosome binding factor A (rbfA) [Haemophilus influenzae Rd KW20]
 gi|260091952|gb|EEW75901.1| ribosome-binding factor A [Haemophilus influenzae RdAW]
          Length = 128

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 67/127 (52%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MAREFKRSDRVAQEIQKEIAVILQR-EVKDPRIG--MVTVSDVEVSSDLSYAKIFVTFLF 57

Query: 65  DVSP---DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D      ++ +  L     +IR  +G+++R LR VPE+RF YD SL    +++ L+    
Sbjct: 58  DHDEMAIEQGMKGLEKASPYIRSLLGKAMR-LRIVPEIRFIYDQSLVEGMRMSNLVTNV- 115

Query: 122 IPVALEK 128
           +    +K
Sbjct: 116 VREDEKK 122


>gi|319892288|ref|YP_004149163.1| Ribosome-binding factor A [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317161984|gb|ADV05527.1| Ribosome-binding factor A [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464615|gb|ADX76768.1| ribosome-binding factor A [Staphylococcus pseudintermedius ED99]
          Length = 114

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 63/111 (56%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           RA RVGE+++  LM +I NN+ +D  +    ++I++V  + DL +A VY+++   D   +
Sbjct: 4   RAERVGEQMKKELMDII-NNKLKDPRVG--FLTITDVQPTNDLSLAKVYLTVLGSDKERE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                L     FI+  IG+ +R LR VP+L+F YD S++   ++  L+   
Sbjct: 61  NTFKGLEKAKGFIKSEIGQRMR-LRIVPDLQFEYDESIEYGNRIERLIQDL 110


>gi|24418643|sp|Q8P7U8|RBFA_XANCP RecName: Full=Ribosome-binding factor A
 gi|172046801|sp|Q4UWA1|RBFA_XANC8 RecName: Full=Ribosome-binding factor A
 gi|189039669|sp|B0RRB5|RBFA_XANCB RecName: Full=Ribosome-binding factor A
          Length = 130

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K+  R  RV  +VR  L  ++       R      +S+S+V +S DL  A V+++     
Sbjct: 4   KSFHRTDRVSAQVRRDLGTIVH---AAVRDHGLPSVSVSDVEISRDLAHAKVFVTALQQE 60

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                +  L      +R ++ R+++ LR+VPEL F YD S+    +++ L+    
Sbjct: 61  RSAEAVKGLKEIAGQLRTQLARAMK-LRHVPELHFHYDDSVDRGERIDNLLRDLD 114


>gi|21231943|ref|NP_637860.1| ribosome-binding factor A [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66767930|ref|YP_242692.1| ribosome-binding factor A [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|188991046|ref|YP_001903056.1| ribosome-binding factor A [Xanthomonas campestris pv. campestris
           str. B100]
 gi|21113672|gb|AAM41784.1| ribosomal-binding factor A [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66573262|gb|AAY48672.1| ribosomal-binding factor A [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|167732806|emb|CAP51000.1| ribosomal-binding factor A [Xanthomonas campestris pv. campestris]
          Length = 132

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K+  R  RV  +VR  L  ++       R      +S+S+V +S DL  A V+++     
Sbjct: 6   KSFHRTDRVSAQVRRDLGTIVH---AAVRDHGLPSVSVSDVEISRDLAHAKVFVTALQQE 62

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                +  L      +R ++ R+++ LR+VPEL F YD S+    +++ L+    
Sbjct: 63  RSAEAVKGLKEIAGQLRTQLARAMK-LRHVPELHFHYDDSVDRGERIDNLLRDLD 116


>gi|285017809|ref|YP_003375520.1| ribosome-binding factor a protein [Xanthomonas albilineans GPE
           PC73]
 gi|283473027|emb|CBA15532.1| probable ribosome-binding factor a protein [Xanthomonas
           albilineans]
          Length = 136

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 57/113 (50%), Gaps = 4/113 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K+ RR  RV  ++R  L  ++     +D  +    +S+S+V ++ D+  A V+++  +  
Sbjct: 4   KSFRRTDRVAAQIRRDLGTIVH-AAVRDHGLPS--VSVSDVEVTRDMAHAKVFVTALMPE 60

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                +  L      +R  + R+++ LR+VPEL F YD S+    +++ L+  
Sbjct: 61  RSSEAVKGLKELAPQLRTELARAMK-LRHVPELHFHYDDSVDRGERIDTLLRD 112


>gi|315634098|ref|ZP_07889387.1| ribosome-binding factor A [Aggregatibacter segnis ATCC 33393]
 gi|315477348|gb|EFU68091.1| ribosome-binding factor A [Aggregatibacter segnis ATCC 33393]
          Length = 128

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 67/127 (52%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  IS  ++++S+V +S DL  A V+++   
Sbjct: 1   MAREFKRSDRVAQEIQKEIAVILQR-EVKDPRIS--MVTVSDVEVSSDLAYAKVFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +   +  L     +IR  +G+++R LR VPE+RF YD SL    +++ L+    
Sbjct: 58  DHDEQAIAQGMKGLEKAAPYIRTLLGKAMR-LRIVPEIRFIYDQSLVEGMRMSNLVTNV- 115

Query: 122 IPVALEK 128
           +    +K
Sbjct: 116 VREDEKK 122


>gi|255284462|ref|ZP_05349017.1| ribosome-binding factor A [Bryantella formatexigens DSM 14469]
 gi|255265007|gb|EET58212.1| ribosome-binding factor A [Bryantella formatexigens DSM 14469]
          Length = 130

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 63/125 (50%), Gaps = 4/125 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV  EV+  L  +I  +E +D  I   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRVNSEVQRELAGII-RSEIKDPRIH-PLTSVVLVEVAPDLKTCKAYISVLG 58

Query: 65  DVSPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D    +  +  L   + FIR ++  +L NLR  PE+RF  D S++   +++ L+    + 
Sbjct: 59  DEQAQQSTLEGLRSAVGFIRRQLAHNL-NLRNTPEIRFILDQSIEYGVRMSKLIEENHVE 117

Query: 124 VALEK 128
            + ++
Sbjct: 118 ESEDE 122


>gi|90409002|ref|ZP_01217132.1| ribosome-binding factor A [Psychromonas sp. CNPT3]
 gi|90309887|gb|EAS38042.1| ribosome-binding factor A [Psychromonas sp. CNPT3]
          Length = 134

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 36/126 (28%), Positives = 65/126 (51%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++V+  L  ++   E +D  I   ++++S V ++ DL  A V+++   
Sbjct: 1   MAKEYSRTSRVSQQVQKELARILQQ-EVKDPRIG--MVTVSGVDITRDLAYAKVFVTFLT 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             D + D  +  LN    +IR  +G+++R LR VPE+RF +D +L    +L+ L+    +
Sbjct: 58  IGDQTNDESLEGLNSAAGYIRRLLGKAMR-LRIVPEVRFCFDETLTEGLRLSELV-SGAV 115

Query: 123 PVALEK 128
               EK
Sbjct: 116 KKDKEK 121


>gi|28198123|ref|NP_778437.1| ribosome-binding factor A [Xylella fastidiosa Temecula1]
 gi|182680751|ref|YP_001828911.1| ribosome-binding factor A [Xylella fastidiosa M23]
 gi|32129950|sp|Q87EV3|RBFA_XYLFT RecName: Full=Ribosome-binding factor A
 gi|238691074|sp|B2I727|RBFA_XYLF2 RecName: Full=Ribosome-binding factor A
 gi|28056183|gb|AAO28086.1| ribosomal-binding factor A [Xylella fastidiosa Temecula1]
 gi|182630861|gb|ACB91637.1| ribosome-binding factor A [Xylella fastidiosa M23]
 gi|307579215|gb|ADN63184.1| ribosome-binding factor A [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 125

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
            K+ +R  R+  ++R  L    +    +D  +    +S+S+V ++ D+  A V+++    
Sbjct: 3   KKSFQRTERISVQIRRDLGA-FVQAAVRDHGLPS--MSVSDVEVTRDMAHAKVFVTALQA 59

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                 ++ L    + +R ++ +++R LR+VPEL F YD SL    +++ L+     P  
Sbjct: 60  ERSFEAVAGLKALARELRMQLAQTMR-LRFVPELHFHYDDSLDRGERIDTLLRDLIPPAD 118

Query: 126 LEK 128
            EK
Sbjct: 119 AEK 121


>gi|221067735|ref|ZP_03543840.1| ribosome-binding factor A [Comamonas testosteroni KF-1]
 gi|264677932|ref|YP_003277839.1| ribosome-binding factor A [Comamonas testosteroni CNB-2]
 gi|299530197|ref|ZP_07043623.1| ribosome-binding factor A [Comamonas testosteroni S44]
 gi|220712758|gb|EED68126.1| ribosome-binding factor A [Comamonas testosteroni KF-1]
 gi|262208445|gb|ACY32543.1| ribosome-binding factor A [Comamonas testosteroni CNB-2]
 gi|298721854|gb|EFI62785.1| ribosome-binding factor A [Comamonas testosteroni S44]
          Length = 125

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 61/127 (48%), Gaps = 6/127 (4%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K K+     R+ +V ++++  L  +I   E +D  +   ++++  V ++ D   A V+ S
Sbjct: 4   KRKSAAP-NRSFKVSDQIQRDLSELIAR-ELKDPRVG--MVTLQGVEVTPDYAHAKVFFS 59

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           +     P+  ++ALN    F+R  + + L ++  VP L F YD + +    +NAL+    
Sbjct: 60  VL-VGDPEVTLAALNQAAGFLRNGLFKRL-HIHTVPTLHFVYDRTTERAADMNALIAKAV 117

Query: 122 IPVALEK 128
                E+
Sbjct: 118 ASRGPEQ 124


>gi|21957407|gb|AAM84277.1|AE013671_4 ribosome-binding factor A [Yersinia pestis KIM 10]
 gi|45435299|gb|AAS60858.1| ribosome-binding factor A [Yersinia pestis biovar Microtus str.
           91001]
          Length = 154

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 64/132 (48%), Gaps = 12/132 (9%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
           +  K   R+ RV +E++  +  ++   E +D  +   + ++S + +S DL  A V+++  
Sbjct: 18  QMAKEFSRSQRVSQEMQKEIALILQR-EIKDPRVG--MATVSGIELSRDLAYAKVFVTFL 74

Query: 64  -------LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
                     +    I AL     +IR  +G+++R LR VPEL F YD SL    +++ L
Sbjct: 75  NVLTDNADPDTVKNGIKALQDASGYIRTLLGKAMR-LRIVPELTFAYDNSLIEGMRMSNL 133

Query: 117 MCLPKIPVALEK 128
           +    I   +E+
Sbjct: 134 VSNV-IKNDVER 144


>gi|152978794|ref|YP_001344423.1| ribosome-binding factor A [Actinobacillus succinogenes 130Z]
 gi|171704291|sp|A6VNE1|RBFA_ACTSZ RecName: Full=Ribosome-binding factor A
 gi|150840517|gb|ABR74488.1| ribosome-binding factor A [Actinobacillus succinogenes 130Z]
          Length = 129

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 67/127 (52%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MAREFKRSDRVAQELQKEVAVILQR-EVKDPRIG--MVTVSDVEVSRDLAYAKIFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D  P+ +   +  L     +IR  +G+++R LR VPELRF YD SL    +++ L+    
Sbjct: 58  DNDPEAIKQGMKGLEKAAPYIRSLLGKAMR-LRIVPELRFVYDQSLVEGMRMSNLVSNV- 115

Query: 122 IPVALEK 128
           I     K
Sbjct: 116 IKNDEAK 122


>gi|194289948|ref|YP_002005855.1| ribosome-binding factor a [Cupriavidus taiwanensis LMG 19424]
 gi|238692734|sp|B3R1E3|RBFA_CUPTR RecName: Full=Ribosome-binding factor A
 gi|193223783|emb|CAQ69790.1| Ribosome-binding factor A [Cupriavidus taiwanensis LMG 19424]
          Length = 123

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 59/128 (46%), Gaps = 6/128 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K    S R LR+ ++++  L  +I   E +D  +   ++++  V ++ D   A VY 
Sbjct: 1   MAKKGNI-SSRNLRISDQIQKDLAEMIQR-ELRDPRLG--LVTLQSVTLTPDYAHAKVYF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++          + LN    ++   + + L ++  VP L F +DTS++   +++ L+   
Sbjct: 57  TVLGA-DAAETEAILNEKAGYLHSLLFKRL-HIHTVPTLHFHHDTSVEHAIEMSRLINEA 114

Query: 121 KIPVALEK 128
               + ++
Sbjct: 115 NATRSKDE 122


>gi|26991394|ref|NP_746819.1| ribosome-binding factor A [Pseudomonas putida KT2440]
 gi|148549778|ref|YP_001269880.1| ribosome-binding factor A [Pseudomonas putida F1]
 gi|32171601|sp|Q88DV8|RBFA_PSEPK RecName: Full=Ribosome-binding factor A
 gi|166219394|sp|A5W986|RBFA_PSEP1 RecName: Full=Ribosome-binding factor A
 gi|24986463|gb|AAN70283.1|AE016669_1 ribosome-binding factor A [Pseudomonas putida KT2440]
 gi|148513836|gb|ABQ80696.1| ribosome-binding factor A [Pseudomonas putida F1]
 gi|313500619|gb|ADR61985.1| RbfA [Pseudomonas putida BIRD-1]
          Length = 132

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 65/124 (52%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S DL  A V+I++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAE-LIRREVKDPRVG--LVTITAVDVSRDLGHAKVFITVMG 57

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           + +PD V     ALN    F+R  +GRS+  LR VP+L F +D S+     L+AL+    
Sbjct: 58  EETPDAVQQSLKALNSAASFLRLHLGRSM-QLRSVPQLHFHFDESVSRGVHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|325142573|gb|EGC64969.1| ribosome-binding factor A [Neisseria meningitidis 961-5945]
 gi|325198517|gb|ADY93973.1| ribosome-binding factor A [Neisseria meningitidis G2136]
          Length = 123

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+++EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTRLKDPRAG--FITVNEVEVTRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TILNQDAREITEEVLEHARGHLRSELAKRIKLFK-IPELHFKYDESLERGMNLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|295110272|emb|CBL24225.1| ribosome-binding factor A [Ruminococcus obeum A2-162]
          Length = 127

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I   E +D  I   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRINGEVQKELSSII-RGEIKDPRIH-PMTSVMAVEVAPDLKTCRAYISVLG 58

Query: 65  DVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           +    +  I  LN    +IR ++ R+L NLR  PE+RF  D S++    ++ L+      
Sbjct: 59  NQEAKEATIRGLNSAEGYIRRQLARNL-NLRNTPEIRFILDESIEYGVNMSKLIDDVA-K 116

Query: 124 VA 125
             
Sbjct: 117 RD 118


>gi|27467865|ref|NP_764502.1| ribosome-binding factor A [Staphylococcus epidermidis ATCC 12228]
 gi|57866760|ref|YP_188419.1| ribosome-binding factor A [Staphylococcus epidermidis RP62A]
 gi|282876298|ref|ZP_06285165.1| ribosome-binding factor A [Staphylococcus epidermidis SK135]
 gi|29427695|sp|Q8CPG2|RBFA_STAES RecName: Full=Ribosome-binding factor A
 gi|61214666|sp|Q5HPS1|RBFA_STAEQ RecName: Full=Ribosome-binding factor A
 gi|27315410|gb|AAO04544.1|AE016747_41 ribosome-binding factor A [Staphylococcus epidermidis ATCC 12228]
 gi|57637418|gb|AAW54206.1| ribosome-binding factor A [Staphylococcus epidermidis RP62A]
 gi|281295323|gb|EFA87850.1| ribosome-binding factor A [Staphylococcus epidermidis SK135]
 gi|329736627|gb|EGG72893.1| ribosome-binding factor A [Staphylococcus epidermidis VCU045]
          Length = 116

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 65/115 (56%), Gaps = 5/115 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            N+ RA RVGE+++  +M + +NN+ +D  +    ++I++V ++ DL  A VY+++  + 
Sbjct: 1   MNNIRAERVGEQMKQEIMDI-VNNKVKDPRVG--FLTITDVELTNDLSQAKVYLTVLGND 57

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              D    AL+    FI+  +G  +R LR +PEL F YD S++   K+  ++   
Sbjct: 58  KEVDNTFKALHKATGFIKSELGSRMR-LRIIPELTFEYDESIEYGNKIERMIQEL 111


>gi|152980431|ref|YP_001354184.1| ribosome-binding factor A [Janthinobacterium sp. Marseille]
 gi|172049092|sp|A6T0Y7|RBFA_JANMA RecName: Full=Ribosome-binding factor A
 gi|151280508|gb|ABR88918.1| ribosome-binding factor A [Janthinobacterium sp. Marseille]
          Length = 128

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M   +     R LRV ++++  L  +I   E +D  +   +I+I+EV ++ D   A V+ 
Sbjct: 1   MAKHSKSIPGRGLRVADQIQRDLSEIIA-FELKDPRVG--MITITEVQVTPDYAHAKVFF 57

Query: 61  SLPLD--VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           ++  D        +S L     +IRG++GR L  +  +PEL F +DTS     +++ L+ 
Sbjct: 58  TMLSDKKDDIKNTVSGLTAASGYIRGQLGRRL-TIHTLPELHFVHDTSTARGIEMSKLID 116

Query: 119 LPKIPVALE 127
                 A +
Sbjct: 117 EANASRAKD 125


>gi|260914252|ref|ZP_05920725.1| ribosome-binding factor A [Pasteurella dagmatis ATCC 43325]
 gi|260631885|gb|EEX50063.1| ribosome-binding factor A [Pasteurella dagmatis ATCC 43325]
          Length = 140

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 35/132 (26%), Positives = 69/132 (52%), Gaps = 9/132 (6%)

Query: 1   MK-NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVY 59
           MK  +  +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A V+
Sbjct: 1   MKEKQMAREFKRSDRVAQEIQKEIAVILQR-EVKDPRIG--MVTVSDVEVSSDLAYAKVF 57

Query: 60  ISLPLDVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
           ++   D     +   +  L     +IR  +G+++R LR VPE+RF YD SL    +++ L
Sbjct: 58  VTFLFDNDESAIEAGMKGLEKASPYIRSLLGKAMR-LRIVPEIRFIYDRSLIEGMRMSNL 116

Query: 117 MCLPKIPVALEK 128
           +    +    E+
Sbjct: 117 VTSV-VRQDKER 127


>gi|170719908|ref|YP_001747596.1| ribosome-binding factor A [Pseudomonas putida W619]
 gi|229568642|sp|B1J2B0|RBFA_PSEPW RecName: Full=Ribosome-binding factor A
 gi|169757911|gb|ACA71227.1| ribosome-binding factor A [Pseudomonas putida W619]
          Length = 132

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 65/124 (52%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S DL  A V+I++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAE-LIRREVKDPRVG--LVTITAVDVSRDLGHAKVFITVMG 57

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           + +PD V     ALN    F+R  +GRS+  LR VP+L F +D S+     L+AL+    
Sbjct: 58  EETPDAVQQSLKALNSAASFLRLHLGRSM-QLRSVPQLHFHFDESVSRGVHLSALIER-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAED 119


>gi|163754470|ref|ZP_02161592.1| ribosome-binding factor A [Kordia algicida OT-1]
 gi|161325411|gb|EDP96738.1| ribosome-binding factor A [Kordia algicida OT-1]
          Length = 133

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 57/119 (47%), Gaps = 2/119 (1%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
            +   S R  ++   ++  L+ ++     +   ++  +IS+++V ++VDL VA VY+S+ 
Sbjct: 1   MSETESNRQKKIAGVLQKDLVDIL-QGAARGGGLTNVIISVTKVNVTVDLSVAKVYLSIF 59

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                  ++  +  N   I+  + + +++ LR VP L F  D SL+    +   +   +
Sbjct: 60  PHNKGKELLEGIQSNAPLIKHELAQRVKHQLRKVPSLTFYVDDSLEYIENIEKSLKGEE 118


>gi|126656851|ref|ZP_01728029.1| ribosome-binding factor A [Cyanothece sp. CCY0110]
 gi|126621689|gb|EAZ92398.1| ribosome-binding factor A [Cyanothece sp. CCY0110]
          Length = 130

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 59/116 (50%), Gaps = 3/116 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            NSRR  RV   ++  +  ++L  + +D  +   ++S+++V +S DL+ A +++S+    
Sbjct: 2   ANSRRVSRVSSLIKREVSQMLL-FDIKDDRVGAGMVSVTDVDLSGDLQHAKIFVSIYGTE 60

Query: 67  SPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                 +  L  +  ++R  + + +R LR  PE+RF  D  ++   K+  L+   +
Sbjct: 61  EAKMETMEGLKSSEGYVRKELAQRIR-LRRAPEVRFFEDHGIERGDKMLHLLNKIR 115


>gi|329123371|ref|ZP_08251935.1| ribosome-binding factor A [Haemophilus aegyptius ATCC 11116]
 gi|327470953|gb|EGF16408.1| ribosome-binding factor A [Haemophilus aegyptius ATCC 11116]
          Length = 128

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 67/127 (52%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ R+ +E++  +  ++   E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MAREFKRSDRIAQEIQKEIAVILQR-EVKDPRIG--MVTVSDVEVSSDLSYAKIFVTFLF 57

Query: 65  DVSP---DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D      ++ +  L     +IR  +G+++R LR VPE+RF YD SL    +++ L+    
Sbjct: 58  DHDETAIEQSMKGLEKASPYIRSLLGKAMR-LRIVPEIRFIYDQSLVEGMRMSNLV-TNV 115

Query: 122 IPVALEK 128
           +    +K
Sbjct: 116 VREDEKK 122


>gi|300087634|ref|YP_003758156.1| ribosome-binding factor A [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299527367|gb|ADJ25835.1| ribosome-binding factor A [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 120

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 59/113 (52%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S R  ++ + +R  L  V+   E +D  +   ++SI+ V  + DL++A V++S       
Sbjct: 2   SHRIEKINQLIREELSQVMQR-EIRDPRLE--LLSINAVETTADLKLAKVFVSHLSSSEN 58

Query: 69  DR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              ++ AL     + RG +G+ +  LRYVPEL F +D S++   +++ L+   
Sbjct: 59  RPEIMKALGGATGYFRGELGK-VLTLRYVPELAFYWDDSIERGARMDRLIDRA 110


>gi|260435606|ref|ZP_05789576.1| ribosome-binding factor A [Synechococcus sp. WH 8109]
 gi|260413480|gb|EEX06776.1| ribosome-binding factor A [Synechococcus sp. WH 8109]
          Length = 140

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 60/116 (51%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VSP 68
           RR  RV   +R  +  +++N   +D  + + ++SI+EV +S DL+   +++S+  +    
Sbjct: 5   RRVERVAALIRKEVSQLMING-IRDERVHQGMVSITEVEVSGDLQHCKIFVSVFGEAQER 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
           D+V+  L     F+RG +GR L  +R  PE+ F+ D  L+    +  L+   +   
Sbjct: 64  DQVLEGLEAASGFLRGELGRRL-QMRRAPEVVFQLDRGLERGTSVLGLLNRLEDER 118


>gi|172057845|ref|YP_001814305.1| ribosome-binding factor A [Exiguobacterium sibiricum 255-15]
 gi|171990366|gb|ACB61288.1| ribosome-binding factor A [Exiguobacterium sibiricum 255-15]
          Length = 113

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 60/113 (53%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS- 67
           S R+ RV E+VR  +  +++  +  D  +    ++++ V ++ DL+ AT++ S+  D + 
Sbjct: 2   SVRSNRVAEQVRKEITQMLIK-DVNDPRVKA--VTVTGVEVTGDLQQATIFYSVLGDETV 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +     L  +  F+R  IG  +R LR  PEL F  DTS++   +++ L+   
Sbjct: 59  REEARVGLEKSKGFMRKEIGSRIR-LRKTPELLFEIDTSVEYGSRIDELLRNL 110


>gi|119486756|ref|ZP_01620731.1| ribosome-binding factor A [Lyngbya sp. PCC 8106]
 gi|119456049|gb|EAW37182.1| ribosome-binding factor A [Lyngbya sp. PCC 8106]
          Length = 142

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 56/110 (50%), Gaps = 3/110 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP- 68
           RR  RV   ++  +  ++L  E +D  +   ++SI++V ++ DL+   +++S+       
Sbjct: 5   RRVSRVAALIKREVSQILLQ-EVKDDRVGSGMVSITDVNVAGDLQHVKIFVSIYGTEEAR 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
              +  L     +IR  +G+ +R LR  PE+ F  D SL+   K+ +L+ 
Sbjct: 64  KETMEGLRAATGYIRSSLGQRVR-LRRTPEVLFLEDRSLERGDKMLSLLN 112


>gi|15836841|ref|NP_297529.1| ribosome-binding factor A [Xylella fastidiosa 9a5c]
 gi|20978662|sp|Q9PGR2|RBFA_XYLFA RecName: Full=Ribosome-binding factor A
 gi|9105047|gb|AAF83049.1|AE003877_4 ribosomal-binding factor A [Xylella fastidiosa 9a5c]
          Length = 125

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
            K+ +RA R+  ++   L   ++    +D  +    +S+S+V ++ D+  A V+++    
Sbjct: 3   KKSFQRAERISVQIHRDLGA-LVQAAVRDHGLPS--MSVSDVEVTRDMAHAKVFVTALQA 59

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                 ++ L    + +R ++  ++R LR+VPEL F YD SL    ++N L+     P  
Sbjct: 60  ERSFEAVAGLKALARELRMQLAHTMR-LRFVPELHFHYDDSLDRGERINTLLRDLIPPAD 118

Query: 126 LEK 128
            EK
Sbjct: 119 AEK 121


>gi|332290221|ref|YP_004421073.1| ribosome-binding factor A [Gallibacterium anatis UMN179]
 gi|330433117|gb|AEC18176.1| ribosome-binding factor A [Gallibacterium anatis UMN179]
          Length = 128

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 63/115 (54%), Gaps = 7/115 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   RA RV +E++  +  ++   E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MAREFSRAQRVAQEIKKEIAVILQR-EVKDPRIG--MVTVSDVEVSRDLAYAKIFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
           D    ++   +  L+    +IR  +G+++R LR VPELRF YD SL    +++ L
Sbjct: 58  DEDEQQIEQGMLGLHKASPYIRSLLGKAMR-LRIVPELRFVYDNSLVEGMRMSNL 111


>gi|37199640|dbj|BAC95471.1| ribosome-binding factor A [Vibrio vulnificus YJ016]
          Length = 148

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 66/126 (52%), Gaps = 7/126 (5%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +    K+  R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++
Sbjct: 15  RKDMSKDFSRTQRVSQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVT 71

Query: 62  LP--LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+  
Sbjct: 72  FLCVGEQTPESCLAALREHEVHIRMMLGKRIR-LRLTPEVRFYYDNTLVEGMRMSNLV-T 129

Query: 120 PKIPVA 125
             +   
Sbjct: 130 EVVNKD 135


>gi|266622968|ref|ZP_06115903.1| ribosome-binding factor A [Clostridium hathewayi DSM 13479]
 gi|288865261|gb|EFC97559.1| ribosome-binding factor A [Clostridium hathewayi DSM 13479]
          Length = 120

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I   E +D  I   + ++  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRINMEVQRELSEII-RLEIKDPRIH-PMTTVVAVSVTPDLKFCKAYISILG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D       I  L     +IR  + R + NLR  PE++F  D S++    ++ L+   ++ 
Sbjct: 59  DEEAGKATIEGLKSAEGYIRRELARRV-NLRNTPEIKFILDQSIEYGVNMSKLID--EVT 115

Query: 124 VALEK 128
             +++
Sbjct: 116 KDIKE 120


>gi|227538622|ref|ZP_03968671.1| ribosome binding factor A [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227241541|gb|EEI91556.1| ribosome binding factor A [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 123

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 49/117 (41%), Gaps = 3/117 (2%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
               S+R  R    ++  L  +   +   +       I+++ V ++ DL +A VY+S   
Sbjct: 1   MATESKRQQRFAGVIQQDLAELFQRDG--NNWAPGAFITVTRVRVTPDLAIARVYLSFLN 58

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +    I A+      IR ++G  ++N  R VP+L F  D + +    ++ +    
Sbjct: 59  TKTAPEDIKAIRTKTSEIRYKLGSRIKNQARIVPQLEFFLDDTNEYVEHMDKIFDEI 115


>gi|319776233|ref|YP_004138721.1| 30s ribosome binding factor [Haemophilus influenzae F3047]
 gi|317450824|emb|CBY87047.1| 30s ribosome binding factor [Haemophilus influenzae F3047]
          Length = 128

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 67/127 (52%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ R+ +E++  +  ++   E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MAREFKRSDRIAQEIQKEIAVILQR-EVKDPRIG--MVTVSDVEVSSDLSYAKIFVTFLF 57

Query: 65  DVSP---DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D      ++ +  L     +IR  +G+++R LR VPE+RF YD SL    +++ L+    
Sbjct: 58  DHDETVIEQSMKGLEKASPYIRSLLGKAMR-LRIVPEIRFIYDQSLVEGMRMSNLVTNV- 115

Query: 122 IPVALEK 128
           +    +K
Sbjct: 116 VREDEKK 122


>gi|300770163|ref|ZP_07080042.1| ribosome-binding factor A [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300762639|gb|EFK59456.1| ribosome-binding factor A [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 123

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 24/117 (20%), Positives = 49/117 (41%), Gaps = 3/117 (2%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
               S+R  R    ++  L  +   +   +       I+++ V ++ DL +A VY+S   
Sbjct: 1   MATESKRQQRFAGVIQQDLAELFQRDG--NNWAPGAFITVTRVRVTPDLAIARVYLSFLN 58

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +    I A+      IR ++G  ++N  R VP+L F  D + +    ++ +    
Sbjct: 59  TKTAPEDIKAIRAKTSEIRYKLGSRIKNQARIVPQLEFFLDDTNEYVEHMDKIFDEI 115


>gi|58582840|ref|YP_201856.1| ribosome-binding factor A [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84624707|ref|YP_452079.1| ribosome-binding factor A [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|62510970|sp|Q5GXV0|RBFA_XANOR RecName: Full=Ribosome-binding factor A
 gi|123521403|sp|Q2P0X2|RBFA_XANOM RecName: Full=Ribosome-binding factor A
 gi|58427434|gb|AAW76471.1| ribosomal-binding factor A [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|84368647|dbj|BAE69805.1| ribosomal-binding factor A [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 130

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K+  R  RV  +VR  L  ++       R      +S+S+V +S DL  A V+++     
Sbjct: 4   KSFHRTDRVSAQVRRDLGTIVH---AAVRDHGLPSVSVSDVEISRDLAHAKVFVTALQQE 60

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                +  L      +R ++ R+++ LR+VPEL F YD S+    +++ L+    
Sbjct: 61  RSAEAVKGLKDIAGQLRTQLARAMK-LRHVPELHFHYDDSVDRGERIDNLLRDLD 114


>gi|149280521|ref|ZP_01886638.1| ribosome-binding factor A [Pedobacter sp. BAL39]
 gi|149228703|gb|EDM34105.1| ribosome-binding factor A [Pedobacter sp. BAL39]
          Length = 129

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 54/123 (43%), Gaps = 4/123 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R  +    ++  L  +          +   +++I++V +S DL VA VY+S     
Sbjct: 4   MESKRQQKFAGVLQEELAAIFQREGA--SYLPNTLVTITKVRVSPDLAVAKVYLSFLNTN 61

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLP-KIPV 124
           +    ++ +N +   IR ++G  +R+  R VP L F  D + Q    ++ L     +   
Sbjct: 62  NTTLSVAEVNAHAGEIRYKLGARIRHQARVVPTLTFFVDDTNQYVEHMDKLFDKISRERK 121

Query: 125 ALE 127
            +E
Sbjct: 122 DIE 124


>gi|305665853|ref|YP_003862140.1| putative ribosome-binding factor A [Maribacter sp. HTCC2170]
 gi|88710624|gb|EAR02856.1| putative ribosome-binding factor A [Maribacter sp. HTCC2170]
          Length = 130

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 57/116 (49%), Gaps = 2/116 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             ++R  ++G  ++  ++ ++      D  ++  +IS+S+V ++ DL +A VYIS+  + 
Sbjct: 1   METQRQKKIGGVIQKDIVDILQRAAI-DGGLTGILISVSKVTVTTDLSIAKVYISIFPNK 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               ++  +  N   I+  + +  ++ LR VPEL F  D SL     +   +   +
Sbjct: 60  DSKELLEGIQSNQPLIKHELAQRTKHQLRRVPELLFFLDDSLDYIENIENSLKGEE 115


>gi|258620314|ref|ZP_05715352.1| ribosome-binding factor A [Vibrio mimicus VM573]
 gi|262172280|ref|ZP_06039958.1| ribosome-binding factor A [Vibrio mimicus MB-451]
 gi|258587193|gb|EEW11904.1| ribosome-binding factor A [Vibrio mimicus VM573]
 gi|261893356|gb|EEY39342.1| ribosome-binding factor A [Vibrio mimicus MB-451]
          Length = 132

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 65/126 (51%), Gaps = 10/126 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
            PK   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MPKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL----MC 118
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L    + 
Sbjct: 58  VGEQTPESCLAALREHEVHIRMMLGKQIR-LRLTPEIRFYYDNTLVEGMRMSNLVTEVIN 116

Query: 119 LPKIPV 124
             K   
Sbjct: 117 SDKRRK 122


>gi|325286200|ref|YP_004261990.1| Ribosome-binding factor A [Cellulophaga lytica DSM 7489]
 gi|324321654|gb|ADY29119.1| Ribosome-binding factor A [Cellulophaga lytica DSM 7489]
          Length = 130

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 56/116 (48%), Gaps = 2/116 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             ++R  ++G  ++  +  ++      D  +   +IS+S+V ++ DL +A VYIS+    
Sbjct: 1   METQRQKKIGGVIQKDIADILQRAVI-DGGLRGTLISVSKVVVTTDLSIAKVYISIFPHK 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           + D ++  +  N   I+  + +  +N LR VPEL F  D SL+    +   +    
Sbjct: 60  NADELLEGIKSNQPLIKHELAQRTKNQLRRVPELLFFIDDSLEYIDGIEKSLKGED 115


>gi|332706081|ref|ZP_08426153.1| ribosome-binding factor A [Lyngbya majuscula 3L]
 gi|332355173|gb|EGJ34641.1| ribosome-binding factor A [Lyngbya majuscula 3L]
          Length = 132

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 60/121 (49%), Gaps = 3/121 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           +RR  RV   ++  +  ++L N+ +D  +   ++SI+ V +S DL+ A +Y+S+      
Sbjct: 4   NRRVFRVSSLIQQEVSQMLL-NDIKDDRVGSGMVSITNVDVSGDLQHAKIYVSIYGTDEA 62

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
             + ++ L     ++R  +GR +R LR  PE+ F  D  L+   ++  L+         +
Sbjct: 63  RSKTMAGLKSATGYVRRELGRRIR-LRRTPEVMFIEDRGLEGGDQMLNLLNQLSQERQSK 121

Query: 128 K 128
           +
Sbjct: 122 Q 122


>gi|323701867|ref|ZP_08113537.1| ribosome-binding factor A [Desulfotomaculum nigrificans DSM 574]
 gi|323533171|gb|EGB23040.1| ribosome-binding factor A [Desulfotomaculum nigrificans DSM 574]
          Length = 120

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 27/117 (23%), Positives = 57/117 (48%), Gaps = 5/117 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S R  R+ E ++  +   ++  E +D  +    ++I+ V ++ DL  A +++S+      
Sbjct: 2   SHRPERLAEAIKKEIAD-LIRTEIKDPRVG--FVTITGVEVTRDLSYAKIFVSVMGSDDQ 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               ++ L     ++R  +GR ++ +R+VPEL F+ DTSL    ++  L+       
Sbjct: 59  RKETMAVLQKAAGYMRSEVGRRIK-VRHVPELMFKLDTSLDHGTRIMELLQEVNKRE 114


>gi|113476475|ref|YP_722536.1| ribosome-binding factor A [Trichodesmium erythraeum IMS101]
 gi|123056530|sp|Q110L1|RBFA_TRIEI RecName: Full=Ribosome-binding factor A
 gi|110167523|gb|ABG52063.1| ribosome-binding factor A [Trichodesmium erythraeum IMS101]
          Length = 137

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 59/116 (50%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-P 68
           RR  R+   ++  +  ++L+   +D  +   ++S+++V +S DL+ A V++S+       
Sbjct: 5   RRISRIASLIKQEISQMLLHG-IKDNRVGIGMVSVTDVDVSGDLQHAKVFVSIYGSDEVR 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
            + ++ L     ++R  +G+ +R +R  PE+ F  D SL+   ++ +L+       
Sbjct: 64  SQTMAGLRSATGYVRSELGKRIR-MRRTPEVIFVEDRSLERGTEILSLLNKLSQER 118


>gi|168187907|ref|ZP_02622542.1| ribosome-binding factor A [Clostridium botulinum C str. Eklund]
 gi|169294249|gb|EDS76382.1| ribosome-binding factor A [Clostridium botulinum C str. Eklund]
          Length = 121

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 57/115 (49%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD- 69
           R  R+ EEV+  +  +I  ++  D  +   ++S++ V ++ DLR A V+IS+        
Sbjct: 5   RLGRINEEVKKEISNII-RDDIHDPRL-TGMVSVTRVEVTNDLRYAKVFISIFGSDESKA 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             + AL  +  FIR  +G  ++ LRY PE+    D S++    +N L+   K   
Sbjct: 63  ETLEALKSSAGFIRREVGHRVK-LRYTPEIILELDESIEHGMHINDLLSNLKEKK 116


>gi|325921394|ref|ZP_08183251.1| ribosome-binding factor A [Xanthomonas gardneri ATCC 19865]
 gi|325548152|gb|EGD19149.1| ribosome-binding factor A [Xanthomonas gardneri ATCC 19865]
          Length = 130

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K+  R  RV  +VR  L  ++       R      +S+S+V ++ DL  A V+++     
Sbjct: 4   KSFHRTDRVSAQVRRDLGTIVH---AAVRDHGLPSVSVSDVEVTRDLAHAKVFVTALQQE 60

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                +  L      +R ++ R+++ LR+VPEL F YD S+    +++ L+    
Sbjct: 61  RSVEAVKGLKEIAGQLRTQLARAMK-LRHVPELHFHYDDSVDRGERIDNLLRDLD 114


>gi|255080072|ref|XP_002503616.1| predicted protein [Micromonas sp. RCC299]
 gi|226518883|gb|ACO64874.1| predicted protein [Micromonas sp. RCC299]
          Length = 252

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 65/131 (49%), Gaps = 13/131 (9%)

Query: 10  RRALRVGEEVRSALMWVILNNE-----------FQDRLISRDVISISEVCMSVDLRVATV 58
           RR  +V +++R  +  ++  ++                +   ++++++V +S DL+V  V
Sbjct: 54  RRVAKVQQQMRREISNMMQTDKKLRDMVYPEERMGVDNVMSCMVTVADVEVSGDLQVVKV 113

Query: 59  YISLPLDVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
           ++S+  D       I+ L     ++R  IG+ + +LR  P++RF YD S +   ++++L+
Sbjct: 114 FVSILGDERGKKNAINGLKKMEGYVRRNIGKRV-SLRLTPDIRFVYDDSFERGQRVSSLL 172

Query: 118 CLPKIPVALEK 128
              ++   + +
Sbjct: 173 DELRVEREVRE 183


>gi|153812991|ref|ZP_01965659.1| hypothetical protein RUMOBE_03398 [Ruminococcus obeum ATCC 29174]
 gi|149830938|gb|EDM86028.1| hypothetical protein RUMOBE_03398 [Ruminococcus obeum ATCC 29174]
          Length = 127

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I  NE +D  I   + S+  V ++ DL+    +IS+  
Sbjct: 1   MRKNSIKNTRINGEVQKELSTII-RNEVKDPRIH-PMTSVMAVEVAPDLKTCKAFISVLG 58

Query: 65  DVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           +    D  I  LN    +IR ++ ++L NLR  PE+RF  D S++    ++ L+      
Sbjct: 59  NKEAKDATIQGLNKAEGYIRRQLAKNL-NLRNTPEIRFILDESIEYGVNMSKLIDDVA-R 116

Query: 124 VA 125
             
Sbjct: 117 RD 118


>gi|21243415|ref|NP_642997.1| ribosome-binding factor A [Xanthomonas axonopodis pv. citri str.
           306]
 gi|24418644|sp|Q8PJ56|RBFA_XANAC RecName: Full=Ribosome-binding factor A
 gi|21108966|gb|AAM37533.1| ribosomal-binding factor A [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 130

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 56/115 (48%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K+  R  RV  +VR  L  ++     +D  +    +S+S+V +S DL  A V+++     
Sbjct: 4   KSFHRTDRVSAQVRRDLGTIVH-AAVRDNGLPS--VSVSDVEISRDLAHAKVFVTALQQE 60

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                +  L      +R ++ R+++ LR+VPEL F YD S+    +++ L+    
Sbjct: 61  RSAEAVKGLKEIAGQLRTQLARAMK-LRHVPELHFHYDDSVDRGERIDNLLRDLD 114


>gi|329896242|ref|ZP_08271420.1| Ribosome-binding factor A [gamma proteobacterium IMCC3088]
 gi|328921913|gb|EGG29280.1| Ribosome-binding factor A [gamma proteobacterium IMCC3088]
          Length = 132

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 54/120 (45%), Gaps = 7/120 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RVG+ ++  L   ++  E +D  +   +++I+   +S DL  A V+ ++  
Sbjct: 1   MAKEYSRTERVGDMLQRELAS-LIQTEMRDPRV--AMVNITGAQVSRDLSHARVFFTVLD 57

Query: 65  DVSPD---RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             + +        LN    F+R +I +    +R VP LRF +D S+     L  L+   K
Sbjct: 58  ADTAESAKPTTEVLNKASGFLRAQIAKD-STMRTVPSLRFVFDESVGRGRHLEGLIRRAK 116


>gi|325915556|ref|ZP_08177867.1| ribosome-binding factor A [Xanthomonas vesicatoria ATCC 35937]
 gi|325538272|gb|EGD09957.1| ribosome-binding factor A [Xanthomonas vesicatoria ATCC 35937]
          Length = 130

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K+  R  RV  +VR  L  ++       R      +S+S+V +S DL  A V+++     
Sbjct: 4   KSFHRTDRVSAQVRRDLGTIVH---AAVRDHGLPSVSVSDVEISRDLAHAKVFVTALQQE 60

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                +  L      +R ++ R+++ LR+VPEL F YD S+    +++ L+    
Sbjct: 61  RSAEAVKGLKEIAGQLRTQLARAMK-LRHVPELHFHYDDSVDRGERIDNLLRDLD 114


>gi|239999118|ref|ZP_04719042.1| ribosome-binding factor A [Neisseria gonorrhoeae 35/02]
 gi|240113096|ref|ZP_04727586.1| ribosome-binding factor A [Neisseria gonorrhoeae MS11]
 gi|254493895|ref|ZP_05107066.1| ribosome-binding factor A [Neisseria gonorrhoeae 1291]
 gi|268594954|ref|ZP_06129121.1| ribosome-binding factor A [Neisseria gonorrhoeae 35/02]
 gi|268599182|ref|ZP_06133349.1| ribosome-binding factor A [Neisseria gonorrhoeae MS11]
 gi|226512935|gb|EEH62280.1| ribosome-binding factor A [Neisseria gonorrhoeae 1291]
 gi|268548343|gb|EEZ43761.1| ribosome-binding factor A [Neisseria gonorrhoeae 35/02]
 gi|268583313|gb|EEZ47989.1| ribosome-binding factor A [Neisseria gonorrhoeae MS11]
 gi|317164410|gb|ADV07951.1| ribosome-binding factor A [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 123

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D       I+I+EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRAG--FITINEVEITRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +     L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TVLNQDTREITEEVLEHARGHLRSELSKRIKLFK-IPELHFKYDESLERGMSLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|317121858|ref|YP_004101861.1| ribosome-binding factor A [Thermaerobacter marianensis DSM 12885]
 gi|315591838|gb|ADU51134.1| ribosome-binding factor A [Thermaerobacter marianensis DSM 12885]
          Length = 177

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 6/116 (5%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-P 68
           +R  RV E +R AL  ++     +D  +   +  ++ V +S D+R A V IS+  D    
Sbjct: 4   KRRERVAEAIREALAEILRR--VKDPRVG--MAGVTSVELSPDMRHARVRISVIGDDETR 59

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
            R +  L     FIR  +GR++R LR+VPEL FR D S     ++  L+   +   
Sbjct: 60  RRTMEGLERARGFIRSELGRAIR-LRHVPELDFRLDESAAYSVRIAQLLREIRARE 114


>gi|78048392|ref|YP_364567.1| ribosome-binding factor A [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|294624707|ref|ZP_06703374.1| ribosome-binding factor A [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294665174|ref|ZP_06730474.1| ribosome-binding factor A [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325924692|ref|ZP_08186130.1| ribosome-binding factor A [Xanthomonas perforans 91-118]
 gi|123584681|sp|Q3BRP6|RBFA_XANC5 RecName: Full=Ribosome-binding factor A
 gi|78036822|emb|CAJ24515.1| ribosomal-binding factor A [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|292600980|gb|EFF45050.1| ribosome-binding factor A [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292605038|gb|EFF48389.1| ribosome-binding factor A [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|325544898|gb|EGD16243.1| ribosome-binding factor A [Xanthomonas perforans 91-118]
          Length = 130

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K+  R  RV  +VR  L  ++       R      +S+S+V +S DL  A V+++     
Sbjct: 4   KSFHRTDRVSAQVRRDLGTIVH---AAVRDHGLPSVSVSDVEISRDLAHAKVFVTALQQE 60

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                +  L      +R ++ R+++ LR+VPEL F YD S+    +++ L+    
Sbjct: 61  RSAEAVKGLKEIAGQLRTQLARAMK-LRHVPELHFHYDDSVDRGERIDNLLRDLD 114


>gi|291523278|emb|CBK81571.1| ribosome-binding factor A [Coprococcus catus GD/7]
          Length = 130

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 36/125 (28%), Positives = 57/125 (45%), Gaps = 5/125 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I   E +D  I   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRINGEVQKELSRIISR-EIKDPRI-SPMTSVVAVEVAPDLKQCKAYISVLG 58

Query: 65  DVSPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D        A L   I FIR  + R++ NLR  PE+ F  D S++    ++ L+    + 
Sbjct: 59  DKDAQDATLAGLKSAIGFIRRELARTV-NLRNTPEIHFVLDQSIEYGVNMSKLIDDV-VR 116

Query: 124 VALEK 128
               K
Sbjct: 117 SDEGK 121


>gi|83644102|ref|YP_432537.1| ribosome-binding factor A [Hahella chejuensis KCTC 2396]
 gi|123534477|sp|Q2SML2|RBFA_HAHCH RecName: Full=Ribosome-binding factor A
 gi|83632145|gb|ABC28112.1| ribosome-binding factor A [Hahella chejuensis KCTC 2396]
          Length = 135

 Score =  103 bits (257), Expect = 9e-21,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV E+++  L  +I   E +D  +   +++++ V +S DL  A VY+++  
Sbjct: 1   MAREFSRLDRVAEQIQKELAQLIQR-ELKDPRLG--MVTVNSVKVSKDLSYADVYVTVLN 57

Query: 65  DVSPDRVISA-------LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
               +    A       L     F+R  +GR+++ LR +P+LRF YD S+ +  +L AL+
Sbjct: 58  LKDVEDDGDASKASLKVLESAAGFLRSELGRAIK-LRVMPQLRFHYDASVSNAQRLGALI 116

Query: 118 CLPKIP 123
              +  
Sbjct: 117 QKARAK 122


>gi|269137764|ref|YP_003294464.1| ribosome-binding factor A [Edwardsiella tarda EIB202]
 gi|267983424|gb|ACY83253.1| ribosome-binding factor A [Edwardsiella tarda EIB202]
 gi|304557821|gb|ADM40485.1| Ribosome-binding factor A [Edwardsiella tarda FL6-60]
          Length = 132

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 62/127 (48%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV +E++  +  +IL  E +D  +   + ++S V +S DL    V+++   
Sbjct: 1   MAREFSRTQRVAQEMQKEIA-IILQREVKDPRVG--MATVSGVEVSRDLAYTKVFVTFLN 57

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D  P+ V     AL     FIR  +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 58  DGEPETVKAGLKALQDASGFIRMLLGKAMR-LRVVPELTFAYDASLVEGMRMSNLVSNV- 115

Query: 122 IPVALEK 128
           +     +
Sbjct: 116 VKDDEAR 122


>gi|164688517|ref|ZP_02212545.1| hypothetical protein CLOBAR_02162 [Clostridium bartlettii DSM
           16795]
 gi|164602930|gb|EDQ96395.1| hypothetical protein CLOBAR_02162 [Clostridium bartlettii DSM
           16795]
          Length = 127

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 27/113 (23%), Positives = 61/113 (53%), Gaps = 4/113 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ R  R+ EE+R  +  +++N   +D  I   ++S+++V ++ DL  A +Y+S+    
Sbjct: 2   ASNNRTRRIAEEIRKIVSTMLING-IKDPRI-NSLVSVTDVEVTSDLSYAYIYVSILGG- 58

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
             +  +  L     +IR  +G++++ +R+ PE+ F+ D SL     ++ L+  
Sbjct: 59  DEESTLDGLKSACGYIRREVGKNIK-IRHTPEIIFKIDDSLLKGMYMDELIKK 110


>gi|153835029|ref|ZP_01987696.1| ribosome-binding factor A [Vibrio harveyi HY01]
 gi|269961981|ref|ZP_06176336.1| ribosome-binding factor A [Vibrio harveyi 1DA3]
 gi|172044101|sp|A7MZI4|RBFA_VIBHB RecName: Full=Ribosome-binding factor A
 gi|148868506|gb|EDL67605.1| ribosome-binding factor A [Vibrio harveyi HY01]
 gi|269833304|gb|EEZ87408.1| ribosome-binding factor A [Vibrio harveyi 1DA3]
          Length = 135

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 65/126 (51%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVSQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESCLAALREHEVHIRMMLGKRIR-LRLTPEIRFYYDNTLVEGMRMSNLV-SEVV 115

Query: 123 PVALEK 128
                K
Sbjct: 116 NEDKRK 121


>gi|227499042|ref|ZP_03929179.1| ribosome-binding factor A [Acidaminococcus sp. D21]
 gi|226904491|gb|EEH90409.1| ribosome-binding factor A [Acidaminococcus sp. D21]
          Length = 119

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 54/116 (46%), Gaps = 5/116 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           RA ++   ++  L  ++L  E +D  +    ++I+ V ++ +L  A +Y+SL   +   +
Sbjct: 5   RAEKLQALIKQELSNMLLR-EVKDPRVK--FVTITGVEVTNELSYAKIYVSLYGSEKQQE 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                L   + + R  I + ++ LR  P L F  DTS++    + +++   K    
Sbjct: 62  EAWKGLQSCLGYFRTEIAKRIK-LRMAPHLSFHKDTSMEYSAHIESILKEIKEKED 116


>gi|315126159|ref|YP_004068162.1| ribosome-binding factor A, role in processing of 16S rRNA
           [Pseudoalteromonas sp. SM9913]
 gi|315014673|gb|ADT68011.1| ribosome-binding factor A, role in processing of 16S rRNA
           [Pseudoalteromonas sp. SM9913]
          Length = 135

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 58/122 (47%), Gaps = 8/122 (6%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           +   R  RV ++++  +  ++   E +D  +   ++++S V +S DL  A V+I++    
Sbjct: 2   REFSRTDRVAQQIQKEIAVILQR-EIKDPRLG--MVTVSAVEVSRDLSYAKVFITVFNTE 58

Query: 67  SPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
             +        LN    +IR  +G+ +R  R +PEL+F  D SL    +++ L+    I 
Sbjct: 59  DENAAKQSAKVLNEATGYIRSLLGKRIRA-RIMPELKFVVDNSLMEGMRISNLVDSI-IR 116

Query: 124 VA 125
             
Sbjct: 117 ED 118


>gi|70726645|ref|YP_253559.1| ribosome-binding factor A [Staphylococcus haemolyticus JCSC1435]
 gi|123660054|sp|Q4L5X2|RBFA_STAHJ RecName: Full=Ribosome-binding factor A
 gi|68447369|dbj|BAE04953.1| ribosome-binding factor A [Staphylococcus haemolyticus JCSC1435]
          Length = 116

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/118 (30%), Positives = 64/118 (54%), Gaps = 5/118 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            N+ RA RVGE+++  +M + +NN+ +D  +    I+I++V ++ DL  A VY+++    
Sbjct: 1   MNNMRAERVGEQMKKEIMDI-VNNKVKDPRVG--FITITDVDLTNDLSQAKVYLTVLGSE 57

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
              +    AL+    FI+  +G  +R LR VPEL F YD S++   K+  ++      
Sbjct: 58  KEVNDTFKALDKAKGFIKSELGSRMR-LRIVPELFFEYDESIEYGNKIEKMIQDLHKQ 114


>gi|326791496|ref|YP_004309317.1| ribosome-binding factor A [Clostridium lentocellum DSM 5427]
 gi|326542260|gb|ADZ84119.1| ribosome-binding factor A [Clostridium lentocellum DSM 5427]
          Length = 118

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 63/122 (51%), Gaps = 4/122 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R  R+ EE+R  +  + + ++ +D  +   +IS+  V  + DL+ A V+IS+  D 
Sbjct: 1   MASQRLTRINEEMRREIAEI-VRSDIKDPGVQDAMISVIAVETTNDLKTAKVFISVLQDN 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             +  ++AL     +IR  I R + NLR  PEL FR D S++   +++ ++    +    
Sbjct: 60  KKEAALAALTKAQGYIRKEIARRI-NLRNTPELLFRLDESIERGMQMSKMIAD--VMKDN 116

Query: 127 EK 128
            K
Sbjct: 117 NK 118


>gi|293398933|ref|ZP_06643098.1| ribosome-binding factor A [Neisseria gonorrhoeae F62]
 gi|291610347|gb|EFF39457.1| ribosome-binding factor A [Neisseria gonorrhoeae F62]
          Length = 123

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+        R  RV E++   L   ++    +D  +    I+I+EV ++ D   ATV+ 
Sbjct: 1   MRKPQRG-YARQDRVKEQIMRELAE-LVRTGLKDPRVG--FITINEVEITRDYSHATVFY 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    +       L      +R  + + ++  + +PEL F+YD SL+    L+AL+   
Sbjct: 57  TVLNQDTRKITEEVLEHARGHLRSELSKRIKLFK-IPELHFKYDESLERGMSLSALIDQV 115

Query: 121 KIPVALE 127
                +E
Sbjct: 116 AAEKPVE 122


>gi|289665192|ref|ZP_06486773.1| ribosome-binding factor A [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289667362|ref|ZP_06488437.1| ribosome-binding factor A [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 130

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K+  R  RV  +VR  L  ++       R      +S+S+V +S DL  A V+++     
Sbjct: 4   KSFHRTDRVSAQVRRDLGTIVH---AAVRDHGLPSVSVSDVEISRDLAHAKVFVTALQQE 60

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                +  L      +R ++ R+++ LR+VPEL F YD S+    +++ L+    
Sbjct: 61  RSAEAVKGLKEIAGQLRTQLARAMK-LRHVPELHFHYDDSVDRGERIDNLLRDLD 114


>gi|253995585|ref|YP_003047649.1| ribosome-binding factor A [Methylotenera mobilis JLW8]
 gi|253982264|gb|ACT47122.1| ribosome-binding factor A [Methylotenera mobilis JLW8]
          Length = 118

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 60/124 (48%), Gaps = 7/124 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K+  R+ RV E+++  +  +++  E +D  +   +I+++ V ++ D+  A ++ S   
Sbjct: 1   MAKDFSRSHRVAEQMQREIADLLM-FEIKDPRVG--MITVTAVEVTGDMAHAKIFYSA-- 55

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               D     L  +  F+R ++ + +  LR VP+L F YD S+ +   ++ L+    I  
Sbjct: 56  AKQSDSTQQGLEKSAGFLRTQLAKRML-LRTVPQLHFVYDASIDNGMMMSKLI-DEAIAS 113

Query: 125 ALEK 128
              K
Sbjct: 114 DKTK 117


>gi|240146072|ref|ZP_04744673.1| ribosome-binding factor A [Roseburia intestinalis L1-82]
 gi|257201817|gb|EEV00102.1| ribosome-binding factor A [Roseburia intestinalis L1-82]
 gi|291536071|emb|CBL09183.1| ribosome-binding factor A [Roseburia intestinalis M50/1]
 gi|291538568|emb|CBL11679.1| ribosome-binding factor A [Roseburia intestinalis XB6B4]
          Length = 126

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 63/124 (50%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I   E +D  I   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRINGEVQRELSNII-RGEIKDPRI-NPLTSVVAVEVAPDLKTCKAYISVLG 58

Query: 65  DVSPD-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D     + ++ L     FIR ++ +++ NLR  PE+RF  D S++   K++ ++   ++ 
Sbjct: 59  DEESQAKTLAGLKSAEGFIRSKLAKTV-NLRNTPEIRFVLDQSIEYGVKMSKMID--EVT 115

Query: 124 VALE 127
             ++
Sbjct: 116 KDIK 119


>gi|189459725|ref|ZP_03008510.1| hypothetical protein BACCOP_00353 [Bacteroides coprocola DSM 17136]
 gi|189433572|gb|EDV02557.1| hypothetical protein BACCOP_00353 [Bacteroides coprocola DSM 17136]
          Length = 111

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   ++S+S V +S D+  A VY+S+    
Sbjct: 1   METTRQNKIARLIQKELSDIFL---LQTKAMHGVLVSVSVVRISPDMSYARVYLSVFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
             + ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL     ++ L+  
Sbjct: 58  RSEEIVKNINDNMKSIRFELGNRVRHQLRIIPELKFFVDDSLDYAAHIDELLKK 111


>gi|134095609|ref|YP_001100684.1| ribosome-binding factor A [Herminiimonas arsenicoxydans]
 gi|172044150|sp|A4G7S6|RBFA_HERAR RecName: Full=Ribosome-binding factor A
 gi|133739512|emb|CAL62563.1| ribosome-binding factor A [Herminiimonas arsenicoxydans]
          Length = 128

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 63/129 (48%), Gaps = 6/129 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M   +     R LRV ++++  L  ++   E +D  +   +I+I+EV ++ D   A V+ 
Sbjct: 1   MAKHSKSIPGRGLRVADQIQRDLSEIVA-FELKDPRVG--MITITEVQVTPDYAHAKVFF 57

Query: 61  SLP--LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           ++           +S L+    +IRG++GR L ++  +PEL F +DTS     +++ L+ 
Sbjct: 58  TMLSDNKDEIKNTVSGLSAASGYIRGQLGRRL-SIHTLPELHFVHDTSTARGIEMSKLID 116

Query: 119 LPKIPVALE 127
                 A +
Sbjct: 117 EANATRAKD 125


>gi|326794271|ref|YP_004312091.1| ribosome-binding factor A [Marinomonas mediterranea MMB-1]
 gi|326545035|gb|ADZ90255.1| Ribosome-binding factor A [Marinomonas mediterranea MMB-1]
          Length = 128

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 60/125 (48%), Gaps = 9/125 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
                 R  R+G++++  L   ++  E +D  +    ++I+EV ++ DL  A VY ++  
Sbjct: 1   MAGEFSRTSRIGDQLQKELAS-LIQFEVKDPRLG--FVTINEVRVAKDLGYADVYYTVLG 57

Query: 65  DVSP----DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                        AL+    F+R R+ + ++ LR +P LRF YD S+ +  +++AL+   
Sbjct: 58  IDEDPKKLADNQVALDSAKSFLRHRLSKEVK-LRVMPHLRFHYDQSVVNGARMSALIDD- 115

Query: 121 KIPVA 125
            I   
Sbjct: 116 AIRKD 120


>gi|254507466|ref|ZP_05119600.1| ribosome-binding factor A [Vibrio parahaemolyticus 16]
 gi|219549536|gb|EED26527.1| ribosome-binding factor A [Vibrio parahaemolyticus 16]
          Length = 135

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 64/126 (50%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  + AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESCLEALREHEVHIRMMLGKRIR-LRLTPEVRFHYDNTLVEGMRMSNLV-SEVV 115

Query: 123 PVALEK 128
                K
Sbjct: 116 NEDKRK 121


>gi|156975662|ref|YP_001446569.1| ribosome-binding factor A [Vibrio harveyi ATCC BAA-1116]
 gi|156527256|gb|ABU72342.1| hypothetical protein VIBHAR_03395 [Vibrio harveyi ATCC BAA-1116]
          Length = 137

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 65/126 (51%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 3   MSKEFSRTQRVSQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 59

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 60  VGEQTPESCLAALREHEVHIRMMLGKRIR-LRLTPEIRFYYDNTLVEGMRMSNLV-SEVV 117

Query: 123 PVALEK 128
                K
Sbjct: 118 NEDKRK 123


>gi|318042498|ref|ZP_07974454.1| ribosome-binding factor A [Synechococcus sp. CB0101]
          Length = 136

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 58/116 (50%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-P 68
           RR  RV   +R  +  +++N   +D  +S  ++S++ V ++ DL+   +Y+S+  +    
Sbjct: 5   RRVERVAALIRREVSELLVNG-IKDDRVSLGMVSVTNVEVAGDLQHCKIYVSVYGNPEVQ 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
            + ++ L     +++G +GR L N+R  PE+ F  D  ++    +  L+   +   
Sbjct: 64  QQALAGLRSAASYVKGELGRRL-NMRRTPEVIFHLDRGIEKGTSVLGLLNQLEQNR 118


>gi|166363717|ref|YP_001655990.1| ribosome binding factor A [Microcystis aeruginosa NIES-843]
 gi|189039547|sp|B0JRP8|RBFA_MICAN RecName: Full=Ribosome-binding factor A
 gi|166086090|dbj|BAG00798.1| ribosome binding factor A [Microcystis aeruginosa NIES-843]
          Length = 128

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 61/116 (52%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           RR  RV   ++  +  ++L  E +D  +   ++S+++V +S DL+ A +++S+  +    
Sbjct: 5   RRVSRVSSLIKREVSQMLL-MEIKDDRVGAGMVSVTDVDLSHDLQHAKIFVSIYGNEDAK 63

Query: 70  -RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
              ++ L  +  F+R  +G+ +R LR  PE+ F  D+SL+   ++  L+   K   
Sbjct: 64  AETMAGLKASAGFVRRELGQRIR-LRRTPEVVFLEDSSLERGDRMLHLLDHIKTDR 118


>gi|262163942|ref|ZP_06031681.1| ribosome-binding factor A [Vibrio mimicus VM223]
 gi|262027470|gb|EEY46136.1| ribosome-binding factor A [Vibrio mimicus VM223]
          Length = 132

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 65/126 (51%), Gaps = 10/126 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
            PK   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MPKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL----MC 118
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L    + 
Sbjct: 58  IGEQTPESCLAALREHEVHIRMMLGKQIR-LRLTPEIRFYYDNTLVEGMRMSNLVTEVIN 116

Query: 119 LPKIPV 124
             K   
Sbjct: 117 SDKRRK 122


>gi|118444128|ref|YP_878208.1| ribosome-binding factor A [Clostridium novyi NT]
 gi|166218434|sp|A0Q0Q6|RBFA_CLONN RecName: Full=Ribosome-binding factor A
 gi|118134584|gb|ABK61628.1| ribosome-binding factor A [Clostridium novyi NT]
          Length = 121

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 57/115 (49%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD- 69
           R  R+ EEV+  +  +I  ++  D  +   ++S++ V ++ DLR A V+IS+        
Sbjct: 5   RLGRINEEVKKEISNII-RDDIHDPRL-TGMVSVTRVEVTNDLRYAKVFISIFGSDESKT 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             + AL  +  FIR  +G  ++ LRY PE+    D S++    +N L+   K   
Sbjct: 63  ETLEALKSSAGFIRREVGHRVK-LRYTPEILLELDESIEHGMHINDLLSNLKEKK 116


>gi|28899229|ref|NP_798834.1| ribosome-binding factor A [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838296|ref|ZP_01990963.1| ribosome-binding factor A [Vibrio parahaemolyticus AQ3810]
 gi|260362208|ref|ZP_05775192.1| ribosome-binding factor A [Vibrio parahaemolyticus K5030]
 gi|260879076|ref|ZP_05891431.1| ribosome-binding factor A [Vibrio parahaemolyticus AN-5034]
 gi|260897747|ref|ZP_05906243.1| ribosome-binding factor A [Vibrio parahaemolyticus Peru-466]
 gi|260900803|ref|ZP_05909198.1| ribosome-binding factor A [Vibrio parahaemolyticus AQ4037]
 gi|31076895|sp|Q87M03|RBFA_VIBPA RecName: Full=Ribosome-binding factor A
 gi|28807453|dbj|BAC60718.1| ribosome-binding factor A [Vibrio parahaemolyticus RIMD 2210633]
 gi|149748285|gb|EDM59144.1| ribosome-binding factor A [Vibrio parahaemolyticus AQ3810]
 gi|308088966|gb|EFO38661.1| ribosome-binding factor A [Vibrio parahaemolyticus Peru-466]
 gi|308089597|gb|EFO39292.1| ribosome-binding factor A [Vibrio parahaemolyticus AN-5034]
 gi|308108183|gb|EFO45723.1| ribosome-binding factor A [Vibrio parahaemolyticus AQ4037]
 gi|308111465|gb|EFO49005.1| ribosome-binding factor A [Vibrio parahaemolyticus K5030]
 gi|328474235|gb|EGF45040.1| ribosome-binding factor A [Vibrio parahaemolyticus 10329]
          Length = 131

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 66/126 (52%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESCLAALREHEVHIRMMLGKRIR-LRLTPEIRFYYDNTLVEGMRMSNLV-TEVV 115

Query: 123 PVALEK 128
               +K
Sbjct: 116 NSDKQK 121


>gi|332799225|ref|YP_004460724.1| Ribosome-binding factor A [Tepidanaerobacter sp. Re1]
 gi|332696960|gb|AEE91417.1| Ribosome-binding factor A [Tepidanaerobacter sp. Re1]
          Length = 123

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            +  R  R+ EE++  +  +I N++ +D  I   +IS+++V ++ DL  ATV+IS   D 
Sbjct: 1   MDFSRNERIAEEIKKGISEII-NSDLKDPRIEG-LISVTKVKVTKDLGHATVFISFYGDK 58

Query: 67  -SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              D     +     FIR  +   +R ++Y+PEL FR D S++    +N L+   K    
Sbjct: 59  TKRDTTFDVIQNAKNFIRHELASKIR-IKYMPELSFRIDESIEYGIHINKLLEEIKKQKQ 117

Query: 126 LEK 128
            EK
Sbjct: 118 EEK 120


>gi|261212245|ref|ZP_05926531.1| ribosome-binding factor A [Vibrio sp. RC341]
 gi|262401658|ref|ZP_06078224.1| ribosome-binding factor A [Vibrio sp. RC586]
 gi|260838853|gb|EEX65504.1| ribosome-binding factor A [Vibrio sp. RC341]
 gi|262352075|gb|EEZ01205.1| ribosome-binding factor A [Vibrio sp. RC586]
          Length = 132

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 67/135 (49%), Gaps = 15/135 (11%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
            PK   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MPKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL----MC 118
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L    + 
Sbjct: 58  IGEQTPESCLAALREHEVQIRMMLGKQIR-LRLTPEIRFYYDNTLVEGMRMSNLVTEVIN 116

Query: 119 LPKIP-----VALEK 128
             K          ++
Sbjct: 117 SDKRRMHEAGRDEDE 131


>gi|119944580|ref|YP_942260.1| ribosome-binding factor A [Psychromonas ingrahamii 37]
 gi|166219396|sp|A1ST46|RBFA_PSYIN RecName: Full=Ribosome-binding factor A
 gi|119863184|gb|ABM02661.1| ribosome-binding factor A [Psychromonas ingrahamii 37]
          Length = 133

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 65/126 (51%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++V+  L  ++   E +D  I   +++IS V ++ DL  A V+++   
Sbjct: 1   MAKEYSRTSRVSQQVQKELARILQQ-EVKDPRIG--MVTISGVDVTRDLAYAKVFVTFLT 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             D + D  +  LN    +IR  +G+++R LR VPE+RF +D++L    +++ L+    +
Sbjct: 58  VGDQTNDESLEGLNAAAGYIRRLLGKAMR-LRIVPEVRFCFDSTLTEGLRISELV-SGAV 115

Query: 123 PVALEK 128
                K
Sbjct: 116 KADKTK 121


>gi|83749676|ref|ZP_00946657.1| Ribosome-binding factor A [Ralstonia solanacearum UW551]
 gi|207743361|ref|YP_002259753.1| ribosome-binding factor a protein [Ralstonia solanacearum IPO1609]
 gi|300704335|ref|YP_003745938.1| ribosome-binding factor a [Ralstonia solanacearum CFBP2957]
 gi|83723678|gb|EAP70875.1| Ribosome-binding factor A [Ralstonia solanacearum UW551]
 gi|206594758|emb|CAQ61685.1| ribosome-binding factor a protein [Ralstonia solanacearum IPO1609]
 gi|299071999|emb|CBJ43329.1| Ribosome-binding factor A [Ralstonia solanacearum CFBP2957]
          Length = 123

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 60/127 (47%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K+   S R +R+ ++++  L  +I   E ++  +   ++++  V ++ D   A +Y 
Sbjct: 1   MPKKSGSASGRNVRIADQIQRDLAELIQR-EIKNPAMG--LVTLQSVSLTPDYAHAKIYF 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++     PD   + LN    ++   + + L ++  VP L F YD S++   +++ L+   
Sbjct: 58  TVLGA-EPDAAAAILNEKAGYLHSLLFKRL-HIHTVPMLHFHYDGSVERGIEMSRLIDEA 115

Query: 121 KIPVALE 127
               A +
Sbjct: 116 NATRAKD 122


>gi|52425497|ref|YP_088634.1| ribosome-binding factor A [Mannheimia succiniciproducens MBEL55E]
 gi|61214861|sp|Q65SL1|RBFA_MANSM RecName: Full=Ribosome-binding factor A
 gi|52307549|gb|AAU38049.1| RbfA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 131

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 68/127 (53%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MSREFKRSDRVAQELQKEIAVILQR-EVKDPRIG--MVTVSDVEVSRDLAYAKIFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           +   + +   + AL     +IR  +G+++R LR VPELRF YD SL    +++ L+    
Sbjct: 58  NNDDEAIKQGMKALEKAAPYIRSLVGKAMR-LRIVPELRFEYDRSLVEGMRMSNLV-TNV 115

Query: 122 IPVALEK 128
           +    E+
Sbjct: 116 VRSDKER 122


>gi|329736237|gb|EGG72509.1| ribosome-binding factor A [Staphylococcus epidermidis VCU028]
          Length = 116

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 35/115 (30%), Positives = 65/115 (56%), Gaps = 5/115 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            N+ RA RVGE+++  +M + +NN+ +D  +    ++I++V ++ DL  A VY+++  + 
Sbjct: 1   MNNIRAERVGEQMKQEIMDI-VNNKVKDPRVG--FLTITDVELTNDLSQAKVYLTVLGND 57

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              D    AL+    FI+  +G  +R LR +PEL F YD S++   K+  ++   
Sbjct: 58  KEVDNTFKALHKATGFIKSGLGSRMR-LRIIPELTFEYDESIEYGNKIERMIQEL 111


>gi|166712597|ref|ZP_02243804.1| ribosome-binding factor A [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 130

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K+  R  RV  +VR  L  ++       R      +S+S+V +S DL  A V+++     
Sbjct: 4   KSFHRTDRVSAQVRRDLGTIVH---AAVRDHGLPSVSVSDVEISRDLAHAKVFVTALQQE 60

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                +  L      +R ++ R+++ LR+VPEL F YD S+    +++ L+    
Sbjct: 61  RSAEAVKGLKDIAGQLRTQLARAMK-LRHVPELHFHYDDSVDRGERIDNLLRDLD 114


>gi|322514413|ref|ZP_08067456.1| ribosome-binding factor A [Actinobacillus ureae ATCC 25976]
 gi|322119661|gb|EFX91719.1| ribosome-binding factor A [Actinobacillus ureae ATCC 25976]
          Length = 137

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 65/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 11  MSREFKRSDRVAQELQKEIAVILQR-EVKDPRIG--MVTVSDVEVSRDLAYAKIFVTFLF 67

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +   +  L     +IR  +G+++R LR VPELRF YD SL    +++ L+    
Sbjct: 68  DNDQSAIEQGMKGLEKASPYIRSLVGKAMR-LRIVPELRFIYDQSLVEGMRMSNLVSNV- 125

Query: 122 IPVALEK 128
           I     K
Sbjct: 126 IKNDEAK 132


>gi|37528347|ref|NP_931692.1| ribosome-binding factor A [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|39931723|sp|Q7MYY8|RBFA_PHOLL RecName: Full=Ribosome-binding factor A
 gi|36787785|emb|CAE16900.1| ribosome-binding factor A (fragment) [Photorhabdus luminescens
           subsp. laumondii TTO1]
          Length = 136

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 65/131 (49%), Gaps = 12/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV +E++  +  +IL  E +D  I   + ++S V +S DL  A V+++   
Sbjct: 1   MAREFSRTQRVAQEMQKEIA-IILQREVKDPRIG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRV-------ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
            ++ +         I ALN    FIR  +G+++R LR VPEL F YD SL    +++ L+
Sbjct: 58  VLTEEHDSDVVKNGIKALNEASGFIRSLLGKAMR-LRVVPELTFSYDNSLVEGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               +    ++
Sbjct: 117 TNV-VKNDEQR 126


>gi|161582021|ref|NP_230293.2| ribosome-binding factor A [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|255744139|ref|ZP_05418092.1| ribosome-binding factor A [Vibrio cholera CIRS 101]
 gi|258624685|ref|ZP_05719619.1| ribosome-binding factor A [Vibrio mimicus VM603]
 gi|262156115|ref|ZP_06029234.1| ribosome-binding factor A [Vibrio cholerae INDRE 91/1]
 gi|262169943|ref|ZP_06037633.1| ribosome-binding factor A [Vibrio cholerae RC27]
 gi|262189598|ref|ZP_06047996.1| ribosome-binding factor A [Vibrio cholerae CT 5369-93]
 gi|20978661|sp|Q9KU79|RBFA_VIBCH RecName: Full=Ribosome-binding factor A
 gi|172047750|sp|A5F927|RBFA_VIBC3 RecName: Full=Ribosome-binding factor A
 gi|255738079|gb|EET93471.1| ribosome-binding factor A [Vibrio cholera CIRS 101]
 gi|258582972|gb|EEW07787.1| ribosome-binding factor A [Vibrio mimicus VM603]
 gi|262021677|gb|EEY40388.1| ribosome-binding factor A [Vibrio cholerae RC27]
 gi|262030151|gb|EEY48796.1| ribosome-binding factor A [Vibrio cholerae INDRE 91/1]
 gi|262034521|gb|EEY52863.1| ribosome-binding factor A [Vibrio cholerae CT 5369-93]
 gi|327483445|gb|AEA77852.1| Ribosome-binding factor A [Vibrio cholerae LMA3894-4]
          Length = 132

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 65/126 (51%), Gaps = 10/126 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
            PK   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MPKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL----MC 118
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L    + 
Sbjct: 58  IGEQTPESCLAALREHEVQIRMMLGKQIR-LRLTPEIRFYYDNTLVEGMRMSNLVTEVIN 116

Query: 119 LPKIPV 124
             K   
Sbjct: 117 SDKRRK 122


>gi|223042080|ref|ZP_03612256.1| ribosome-binding factor A [Actinobacillus minor 202]
 gi|223017155|gb|EEF15591.1| ribosome-binding factor A [Actinobacillus minor 202]
          Length = 126

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 67/127 (52%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  +IL  E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MSREFKRSDRVAQELQKEVA-IILQREVKDPRIG--MVTVSDVEVSRDLAYAKIFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   + +   +  L     +IR  +G+++R LR VPELRF YD SL    +++ L+    
Sbjct: 58  DNDQEAIKQGMKGLEKASPYIRSLVGKAMR-LRIVPELRFIYDESLVEGMRMSNLVSNV- 115

Query: 122 IPVALEK 128
           I     K
Sbjct: 116 IREDEAK 122


>gi|330830887|ref|YP_004393839.1| ribosome-binding factor A [Aeromonas veronii B565]
 gi|328806023|gb|AEB51222.1| Ribosome-binding factor A [Aeromonas veronii B565]
          Length = 145

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 61/128 (47%), Gaps = 9/128 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             +   R  RVG++++  +  ++   E +D  I   ++++S+V +S DL  A +Y++   
Sbjct: 1   MAREFSRTRRVGQQIQREIALILQR-EVKDPRIG--MVTVSDVEVSRDLNYAKIYVTFLQ 57

Query: 64  ---LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                      +  L     +IR  +G ++R LR VPELRF YD +L    +L+ L+   
Sbjct: 58  LENDAERIKEGLQGLTEAAGYIRSLLGSAMR-LRVVPELRFYYDQTLVEGMRLSNLVTNT 116

Query: 121 KIPVALEK 128
            +     +
Sbjct: 117 -VREDKRR 123


>gi|240949212|ref|ZP_04753556.1| ribosome-binding factor A [Actinobacillus minor NM305]
 gi|240296328|gb|EER46972.1| ribosome-binding factor A [Actinobacillus minor NM305]
          Length = 126

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 67/127 (52%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  +IL  E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MSREFKRSDRVAQELQKEVA-IILQREVKDPRIG--MVTVSDVEVSRDLAYAKIFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   + +   +  L     +IR  +G+++R LR VPELRF YD SL    +++ L+    
Sbjct: 58  DNDQEAIKQGMKGLEKASPYIRSLVGKAMR-LRIVPELRFIYDESLVEGMRMSNLVSNV- 115

Query: 122 IPVALEK 128
           I     K
Sbjct: 116 IREDEAK 122


>gi|16800432|ref|NP_470700.1| ribosome-binding factor A [Listeria innocua Clip11262]
 gi|20978611|sp|Q92C27|RBFA_LISIN RecName: Full=Ribosome-binding factor A
 gi|16413837|emb|CAC96595.1| rbfA [Listeria innocua Clip11262]
          Length = 114

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           RA RV E+++  L  ++   + +D  +    ++++ V ++ DL+ A V+IS+   D   +
Sbjct: 4   RANRVSEQMKKELGDILNR-KIKDPRLG--FVTVTGVDVTGDLQEAKVFISILGTDKEKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             + AL     FIR  IGR +R LR VPE+ F  D S+    +++ L+   
Sbjct: 61  NTLLALEKAHGFIRSEIGRRIR-LRKVPEMSFEIDNSIAYGNRIDELLRDL 110


>gi|16803367|ref|NP_464852.1| ribosome-binding factor A [Listeria monocytogenes EGD-e]
 gi|46907553|ref|YP_013942.1| ribosome-binding factor A [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47094120|ref|ZP_00231843.1| ribosome-binding factor A [Listeria monocytogenes str. 4b H7858]
 gi|47095912|ref|ZP_00233515.1| ribosome-binding factor A [Listeria monocytogenes str. 1/2a F6854]
 gi|217964526|ref|YP_002350204.1| ribosome-binding factor A [Listeria monocytogenes HCC23]
 gi|224499908|ref|ZP_03668257.1| ribosome-binding factor A [Listeria monocytogenes Finland 1988]
 gi|224501730|ref|ZP_03670037.1| ribosome-binding factor A [Listeria monocytogenes FSL R2-561]
 gi|226223928|ref|YP_002758035.1| ribosome-binding factor A [Listeria monocytogenes Clip81459]
 gi|254824614|ref|ZP_05229615.1| ribosome-binding factor A [Listeria monocytogenes FSL J1-194]
 gi|254828687|ref|ZP_05233374.1| ribosome-binding factor A [Listeria monocytogenes FSL N3-165]
 gi|254829916|ref|ZP_05234571.1| ribosome-binding factor A [Listeria monocytogenes 10403S]
 gi|254852623|ref|ZP_05241971.1| ribosome-binding factor A [Listeria monocytogenes FSL R2-503]
 gi|254898508|ref|ZP_05258432.1| ribosome-binding factor A [Listeria monocytogenes J0161]
 gi|254912001|ref|ZP_05262013.1| ribosome-binding factor A [Listeria monocytogenes J2818]
 gi|254932358|ref|ZP_05265717.1| ribosome-binding factor A [Listeria monocytogenes HPB2262]
 gi|254936328|ref|ZP_05268025.1| ribosome-binding factor A [Listeria monocytogenes F6900]
 gi|254992775|ref|ZP_05274965.1| ribosome-binding factor A [Listeria monocytogenes FSL J2-064]
 gi|255026684|ref|ZP_05298670.1| ribosome-binding factor A [Listeria monocytogenes FSL J2-003]
 gi|255030035|ref|ZP_05301986.1| ribosome-binding factor A [Listeria monocytogenes LO28]
 gi|255520239|ref|ZP_05387476.1| ribosome-binding factor A [Listeria monocytogenes FSL J1-175]
 gi|284801712|ref|YP_003413577.1| ribosome-binding factor A [Listeria monocytogenes 08-5578]
 gi|284994854|ref|YP_003416622.1| ribosome-binding factor A [Listeria monocytogenes 08-5923]
 gi|289434608|ref|YP_003464480.1| hypothetical protein lse_1243 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|290893562|ref|ZP_06556545.1| ribosome-binding factor A [Listeria monocytogenes FSL J2-071]
 gi|300765433|ref|ZP_07075415.1| ribosome-binding factor A [Listeria monocytogenes FSL N1-017]
 gi|315282183|ref|ZP_07870646.1| ribosome-binding factor A [Listeria marthii FSL S4-120]
 gi|315302983|ref|ZP_07873702.1| ribosome-binding factor A [Listeria ivanovii FSL F6-596]
 gi|20978582|sp|Q8Y7F4|RBFA_LISMO RecName: Full=Ribosome-binding factor A
 gi|61215089|sp|Q71ZZ5|RBFA_LISMF RecName: Full=Ribosome-binding factor A
 gi|254789754|sp|B8DG00|RBFA_LISMH RecName: Full=Ribosome-binding factor A
 gi|259552014|sp|C1L2N3|RBFA_LISMC RecName: Full=Ribosome-binding factor A
 gi|16410743|emb|CAC99405.1| rbfA [Listeria monocytogenes EGD-e]
 gi|46880821|gb|AAT04119.1| ribosome-binding factor A [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47015658|gb|EAL06588.1| ribosome-binding factor A [Listeria monocytogenes str. 1/2a F6854]
 gi|47017505|gb|EAL08315.1| ribosome-binding factor A [Listeria monocytogenes str. 4b H7858]
 gi|217333796|gb|ACK39590.1| ribosome-binding factor A [Listeria monocytogenes HCC23]
 gi|225876390|emb|CAS05099.1| Putative ribosome-binding factor A [Listeria monocytogenes serotype
           4b str. CLIP 80459]
 gi|258601091|gb|EEW14416.1| ribosome-binding factor A [Listeria monocytogenes FSL N3-165]
 gi|258605938|gb|EEW18546.1| ribosome-binding factor A [Listeria monocytogenes FSL R2-503]
 gi|258608918|gb|EEW21526.1| ribosome-binding factor A [Listeria monocytogenes F6900]
 gi|284057274|gb|ADB68215.1| ribosome-binding factor A [Listeria monocytogenes 08-5578]
 gi|284060321|gb|ADB71260.1| ribosome-binding factor A [Listeria monocytogenes 08-5923]
 gi|289170852|emb|CBH27394.1| rbfA [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|290556907|gb|EFD90438.1| ribosome-binding factor A [Listeria monocytogenes FSL J2-071]
 gi|293583914|gb|EFF95946.1| ribosome-binding factor A [Listeria monocytogenes HPB2262]
 gi|293589965|gb|EFF98299.1| ribosome-binding factor A [Listeria monocytogenes J2818]
 gi|293593852|gb|EFG01613.1| ribosome-binding factor A [Listeria monocytogenes FSL J1-194]
 gi|300513870|gb|EFK40935.1| ribosome-binding factor A [Listeria monocytogenes FSL N1-017]
 gi|307570908|emb|CAR84087.1| rbfA [Listeria monocytogenes L99]
 gi|313608974|gb|EFR84720.1| ribosome-binding factor A [Listeria monocytogenes FSL F2-208]
 gi|313614169|gb|EFR87850.1| ribosome-binding factor A [Listeria marthii FSL S4-120]
 gi|313619123|gb|EFR90915.1| ribosome-binding factor A [Listeria innocua FSL S4-378]
 gi|313623913|gb|EFR94023.1| ribosome-binding factor A [Listeria innocua FSL J1-023]
 gi|313628651|gb|EFR97065.1| ribosome-binding factor A [Listeria ivanovii FSL F6-596]
 gi|313633410|gb|EFS00246.1| ribosome-binding factor A [Listeria seeligeri FSL N1-067]
 gi|313638090|gb|EFS03358.1| ribosome-binding factor A [Listeria seeligeri FSL S4-171]
 gi|328468610|gb|EGF39610.1| ribosome-binding factor A [Listeria monocytogenes 1816]
 gi|328475048|gb|EGF45836.1| ribosome-binding factor A [Listeria monocytogenes 220]
 gi|332311770|gb|EGJ24865.1| Ribosome-binding factor A [Listeria monocytogenes str. Scott A]
          Length = 114

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           RA RV E+++  L  ++   + +D  +    ++++ V ++ DL+ A V+IS+   D   +
Sbjct: 4   RANRVSEQMKKELGDILNR-KIKDPRLG--FVTVTGVDVTGDLQEAKVFISILGTDKEKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             + AL     FIR  IGR +R LR VPE+ F  D S+    +++ L+   
Sbjct: 61  NTLLALAKAHGFIRSEIGRRIR-LRKVPEMSFEIDNSIAYGNRIDELLRDL 110


>gi|113953283|ref|YP_731751.1| ribosome-binding factor A [Synechococcus sp. CC9311]
 gi|123132376|sp|Q0I721|RBFA_SYNS3 RecName: Full=Ribosome-binding factor A
 gi|113880634|gb|ABI45592.1| ribosome-binding factor A [Synechococcus sp. CC9311]
          Length = 134

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 58/118 (49%), Gaps = 3/118 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SP 68
           RR  RV   +R     ++++   +D  + + ++SI+EV +S DL+   +++S+  +    
Sbjct: 5   RRVERVAALIRKETSELLIHG-IRDERVHQGMVSITEVEVSGDLQHCRIFVSVFGEQAQK 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
           D V+  L     F+RG +GR L  +R  PE+ F+ D  ++    +  L+   +     
Sbjct: 64  DEVMDGLEAARGFLRGELGRRL-QMRRAPEIVFKLDLGIEKGTTVLHLLGELERERDE 120


>gi|262393383|ref|YP_003285237.1| ribosome-binding factor A [Vibrio sp. Ex25]
 gi|262336977|gb|ACY50772.1| ribosome-binding factor A [Vibrio sp. Ex25]
          Length = 131

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 66/126 (52%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESCLAALREHEVHIRMMLGKRIR-LRLTPEIRFHYDNTLVEGMRMSNLV-SEVV 115

Query: 123 PVALEK 128
               +K
Sbjct: 116 SSDKKK 121


>gi|323495470|ref|ZP_08100545.1| ribosome-binding factor A [Vibrio sinaloensis DSM 21326]
 gi|323319467|gb|EGA72403.1| ribosome-binding factor A [Vibrio sinaloensis DSM 21326]
          Length = 135

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 64/126 (50%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  + AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESCLEALREHEVHIRMMLGKRIR-LRLTPEVRFHYDNTLVEGMRMSNLV-SEVV 115

Query: 123 PVALEK 128
                K
Sbjct: 116 SEDKRK 121


>gi|91228268|ref|ZP_01262204.1| ribosome-binding factor A [Vibrio alginolyticus 12G01]
 gi|269966861|ref|ZP_06180934.1| ribosome-binding factor A [Vibrio alginolyticus 40B]
 gi|91188145|gb|EAS74447.1| ribosome-binding factor A [Vibrio alginolyticus 12G01]
 gi|269828528|gb|EEZ82789.1| ribosome-binding factor A [Vibrio alginolyticus 40B]
          Length = 131

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 66/126 (52%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESCLAALREHEVHIRMMLGKRIR-LRLTPEIRFHYDNTLVEGMRMSNLV-SEVV 115

Query: 123 PVALEK 128
               +K
Sbjct: 116 SSDKQK 121


>gi|149189793|ref|ZP_01868074.1| ribosome-binding factor A [Vibrio shilonii AK1]
 gi|148836442|gb|EDL53398.1| ribosome-binding factor A [Vibrio shilonii AK1]
          Length = 138

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 65/126 (51%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVAQQLQKELALILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESSLAALREHEAHIRMMLGKRIR-LRLTPEVRFHYDNTLVEGMRMSNLV-SEVV 115

Query: 123 PVALEK 128
                K
Sbjct: 116 NEDKRK 121


>gi|116872758|ref|YP_849539.1| ribosome-binding factor A [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123460995|sp|A0AIC8|RBFA_LISW6 RecName: Full=Ribosome-binding factor A
 gi|116741636|emb|CAK20760.1| ribosome-binding factor A [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 114

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 59/111 (53%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           RA RV E+++  L  ++   + +D  +    ++++ V ++ DL+ A V+IS+   D   +
Sbjct: 4   RANRVSEQMKKELGDILNR-KIKDPRLG--FVTVTGVDVTGDLQEAKVFISILGTDKEKE 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             + AL     FIR  IGR +R LR VPE+ F  D S+    +++ L+   
Sbjct: 61  NTLLALAKAHGFIRSEIGRRIR-LRKVPEMSFEIDNSIAYGNRIDELLRDL 110


>gi|300113658|ref|YP_003760233.1| ribosome-binding factor A [Nitrosococcus watsonii C-113]
 gi|299539595|gb|ADJ27912.1| ribosome-binding factor A [Nitrosococcus watsonii C-113]
          Length = 127

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 63/124 (50%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   RA RVGE ++  L   +L  E +D  +   ++++S V +S D R A VY++   
Sbjct: 1   MSQEISRARRVGELLQRELAR-LLQAELKDPRVK--LVTVSHVRVSPDFRQAKVYVTFLG 57

Query: 65  DV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                 R ++ LN    F++  + + +  LR VP L+F YD S++   +L+AL+    + 
Sbjct: 58  KEEDTQRQLTILNKATGFLQHGLSQRV-ELRVVPRLQFVYDDSIKRGRRLSALI-DKAVQ 115

Query: 124 VALE 127
             ++
Sbjct: 116 KDID 119


>gi|254519183|ref|ZP_05131239.1| ribosome-binding factor A [Clostridium sp. 7_2_43FAA]
 gi|226912932|gb|EEH98133.1| ribosome-binding factor A [Clostridium sp. 7_2_43FAA]
          Length = 116

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 61/119 (51%), Gaps = 5/119 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  R+ EEVR  +  VI+ +E +D  +   ++SI+ V ++ DLR A V++S+    
Sbjct: 1   MANYRGGRINEEVRREIS-VIIRDEIKDPRM-TAMVSITAVKVTKDLRYAKVFVSIFGKN 58

Query: 67  SPDR--VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
             ++    +AL     +IR  IG+ + NLR  P++ F  D S+    K+  L+   K  
Sbjct: 59  EDEKNETFAALKSASGYIRKEIGQRI-NLRNTPQILFELDDSISYSMKIEELIEKAKEK 116


>gi|254430062|ref|ZP_05043769.1| ribosome-binding factor A [Alcanivorax sp. DG881]
 gi|196196231|gb|EDX91190.1| ribosome-binding factor A [Alcanivorax sp. DG881]
          Length = 137

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 61/128 (47%), Gaps = 7/128 (5%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +++ P+   R  R+ ++++  L   +L  E +D  ++  + +I +V +S DL  A VY +
Sbjct: 3   RHRRPQGFNRTDRIADQIQRELSR-LLQFEMKDPRVN--LATIQDVTVSRDLSYAEVYFT 59

Query: 62  LPLDVSPDRVISA--LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           L        V +   L     F+R  + +SL N R  P+LRF YD + +    L+ L+  
Sbjct: 60  LLGQGEEAGVEAEEALVKASGFLRSSLAKSL-NTRTTPKLRFHYDMTPERAAHLSQLIDD 118

Query: 120 PKIPVALE 127
            +     E
Sbjct: 119 AR-AEDRE 125


>gi|224025278|ref|ZP_03643644.1| hypothetical protein BACCOPRO_02017 [Bacteroides coprophilus DSM
           18228]
 gi|224018514|gb|EEF76512.1| hypothetical protein BACCOPRO_02017 [Bacteroides coprophilus DSM
           18228]
          Length = 111

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   ++S+S V +S D+  A VY+S+    
Sbjct: 1   METTRQNKIARLIQKELGDIFL---LQTKAMPGVLVSVSIVRISPDMSYARVYLSVFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
             + ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL     ++ L+  
Sbjct: 58  RSEEIVKNINANMKAIRFELGNRVRHQLRIIPELKFFVDDSLDYAAHIDELLKK 111


>gi|224476398|ref|YP_002634004.1| ribosome-binding factor A [Staphylococcus carnosus subsp. carnosus
           TM300]
 gi|254789763|sp|B9DPD6|RBFA_STACT RecName: Full=Ribosome-binding factor A
 gi|222421005|emb|CAL27819.1| putative ribosome-binding factor A [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 115

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 64/111 (57%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           RA RVGE+++  LM +I NN+ +D  I    I+I++V ++ DL +A VY+++  +    D
Sbjct: 5   RAERVGEQMKKELMDII-NNKVKDPRIG--FITITDVQVTNDLSLAKVYLTVLGNEKEVD 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
               AL     FI+  +G  +R LR VPEL+F YD S++   K+  ++   
Sbjct: 62  DTFKALEKAKGFIKSELGSRMR-LRIVPELQFEYDHSIEYGNKIEKMIQDL 111


>gi|116748670|ref|YP_845357.1| ribosome-binding factor A [Syntrophobacter fumaroxidans MPOB]
 gi|171460794|sp|A0LHM0|RBFA_SYNFM RecName: Full=Ribosome-binding factor A
 gi|116697734|gb|ABK16922.1| ribosome-binding factor A [Syntrophobacter fumaroxidans MPOB]
          Length = 117

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/117 (26%), Positives = 59/117 (50%), Gaps = 7/117 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-- 64
              +RA RV + +R  +  ++L    +D  +S+  ++I+ + ++ DL+ A V+  L    
Sbjct: 1   MEYKRADRVADLLRREMADLLLRR-IKDPRVSK--VTITAIEVTDDLQNAKVFFCLMGAA 57

Query: 65  -DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +         LN    F+R  +G+ L +LRY+P+L F YD+S +   K+  L+   
Sbjct: 58  TEEEKRSAALGLNRGKGFMRLELGKRL-HLRYLPQLSFHYDSSFEYGDKIERLLKEL 113


>gi|198277392|ref|ZP_03209923.1| hypothetical protein BACPLE_03604 [Bacteroides plebeius DSM 17135]
 gi|198269890|gb|EDY94160.1| hypothetical protein BACPLE_03604 [Bacteroides plebeius DSM 17135]
          Length = 111

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 59/114 (51%), Gaps = 4/114 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   ++S+S V +S D+  A VY+S+    
Sbjct: 1   METTRQNKIARLIQKELSEIFL---LQTKSMPGVLVSVSIVRISPDMSYARVYLSVFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
             + ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL    K++ L+  
Sbjct: 58  RSEEIVKNINTNMKSIRFELGNRVRHQLRIIPELKFFVDDSLDYAEKIDELLKK 111


>gi|88705686|ref|ZP_01103396.1| Ribosome-binding factor A [Congregibacter litoralis KT71]
 gi|88700199|gb|EAQ97308.1| Ribosome-binding factor A [Congregibacter litoralis KT71]
          Length = 145

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 7/124 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RVG+ +R  L  +I   E +D  +   ++SI+ V +S D+  A V+ +L  
Sbjct: 1   MAKEFSRTERVGDYLRRELALIIQR-EVRDPRLG--MVSITAVDVSRDISHARVHFTLLG 57

Query: 65  DV---SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                        LN    F+R  + R   ++R VP+LRF +D+S+     L AL+   +
Sbjct: 58  SDTAEEAKPCTDVLNNAAGFLRSALARD-ASMRSVPKLRFVFDSSVGRGRDLEALIHRAR 116

Query: 122 IPVA 125
               
Sbjct: 117 TADD 120


>gi|262370079|ref|ZP_06063406.1| ribosome-binding factor A [Acinetobacter johnsonii SH046]
 gi|262315118|gb|EEY96158.1| ribosome-binding factor A [Acinetobacter johnsonii SH046]
          Length = 134

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 54/120 (45%), Gaps = 11/120 (9%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-- 66
           S+R  R+ + V+  L   ++  E +D  +   +++IS V +S DL  A VY+++      
Sbjct: 4   SQRLKRMADTVQRELSE-LIRQELKDPRLGG-LVTISAVKVSPDLGYAEVYVTVMGRELG 61

Query: 67  ------SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 +    +  LN    F+R  +GR ++  R  P LRF YD +      +  L+   
Sbjct: 62  DEQSEAANKETLDVLNKASGFLRHELGRRIKT-RITPRLRFHYDKTNAYGNYMFGLIAEA 120


>gi|297537317|ref|YP_003673086.1| ribosome-binding factor A [Methylotenera sp. 301]
 gi|297256664|gb|ADI28509.1| ribosome-binding factor A [Methylotenera sp. 301]
          Length = 124

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 59/116 (50%), Gaps = 6/116 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K+  R+ RV E+++  L   +L  E +D  +   +++I+ V ++ D+  A ++ S   
Sbjct: 1   MAKDFSRSHRVAEQMQRELAD-LLQFEVKDPRVK--MVTITAVEVTGDMAHAKIFYSA-- 55

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             + D +   L  +  F+R ++ + +  LR VP+L F YD S+ +   ++ L+   
Sbjct: 56  SKASDSLQQGLEKSAGFLRTQVAKRML-LRTVPQLHFVYDASIDNGMMMSKLIDEA 110


>gi|149926270|ref|ZP_01914532.1| ribosome-binding factor A [Limnobacter sp. MED105]
 gi|149825088|gb|EDM84300.1| ribosome-binding factor A [Limnobacter sp. MED105]
          Length = 134

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/120 (26%), Positives = 64/120 (53%), Gaps = 6/120 (5%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M++K    + R +RV E+++  L  +I   E +D  +    ++I++V ++ D   ATVY 
Sbjct: 1   MRHKKKAPA-RGIRVAEQIQKDLAELIPR-ELRDPRLG--FVTITDVELTPDYAYATVYF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           S+    S +    ALN +  ++R  I + L ++  VP LRF++D S++   ++  ++   
Sbjct: 57  SVL-TGSAETTEEALNDSSGYLRNLIFKKL-HIHTVPTLRFKHDQSVERGAEMAQIIDRA 114


>gi|124007683|ref|ZP_01692386.1| ribosome-binding factor A [Microscilla marina ATCC 23134]
 gi|123986805|gb|EAY26577.1| ribosome-binding factor A [Microscilla marina ATCC 23134]
          Length = 128

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 55/118 (46%), Gaps = 3/118 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R  +    ++  L  +    E +D +     ++I+ V ++ DL +A VY+S+    
Sbjct: 1   MESKRQQKFARLIQKDLADIFQR-EVKD-IFKTHFVTITNVKVTPDLGIAYVYLSILAAS 58

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
               V+     N K IR  + R ++N +R +PELRF  D +     K++ L     IP
Sbjct: 59  DKQAVVDIAEDNNKMIRQVLARKIKNQVRAIPELRFFLDDTSDYVQKMDELFDNLDIP 116


>gi|85860519|ref|YP_462721.1| ribosome-binding factor A [Syntrophus aciditrophicus SB]
 gi|123517498|sp|Q2LWT9|RBFA_SYNAS RecName: Full=Ribosome-binding factor A
 gi|85723610|gb|ABC78553.1| ribosome-binding factor A [Syntrophus aciditrophicus SB]
          Length = 123

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/122 (25%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
              +RA RV + V+  +  ++L    +D  +SR  ++++ V +S DLR A ++     + 
Sbjct: 2   TQFKRADRVADLVKMEIADILLRR-IRDPRVSR--LTVTGVKVSDDLRTARIFFVEMGED 58

Query: 67  -SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                 +  L     FIR  +G+ L+ LRYVP+L F+ D+S     +++ L+        
Sbjct: 59  SCHPETLEGLQKAGGFIRKELGKRLK-LRYVPDLIFKPDSSFAYGSRIDQLINEIHREEE 117

Query: 126 LE 127
            +
Sbjct: 118 ND 119


>gi|239626261|ref|ZP_04669292.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239520491|gb|EEQ60357.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 133

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 56/124 (45%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV   L  +I     +D  I   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRINAEVLRELSEII-RTGIKDPRIH-PMTSVVSVEVTPDLKYCRAYISVLG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           +       I  L     ++R  + R + NLR  PEL+F  D S++    ++ L+   ++ 
Sbjct: 59  NEDAAKATIEGLKSAEGYVRRELARRI-NLRNTPELKFILDQSIEYGVNMSKLID--EVT 115

Query: 124 VALE 127
             L+
Sbjct: 116 KDLK 119


>gi|85058356|ref|YP_454058.1| ribosome-binding factor A [Sodalis glossinidius str. 'morsitans']
 gi|123520130|sp|Q2NW22|RBFA_SODGM RecName: Full=Ribosome-binding factor A
 gi|84778876|dbj|BAE73653.1| ribosome-binding factor A [Sodalis glossinidius str. 'morsitans']
          Length = 138

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 62/124 (50%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV +E++  +  +IL  E +D  +   + ++S V +S DL  A V+++   
Sbjct: 1   MAKEYSRTQRVAQEMQKEIA-IILQREIKDPRVG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRVI---SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D + ++V     AL     FI   +G+++R LR VPEL F YD SL    +++ L+    
Sbjct: 58  DNTLEQVKTGVRALQDAAGFIHSLLGKAMR-LRVVPELTFAYDNSLVEGMRMSNLVSQV- 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VQND 119


>gi|330721902|gb|EGG99855.1| Ribosome-binding factor A [gamma proteobacterium IMCC2047]
          Length = 130

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/120 (29%), Positives = 66/120 (55%), Gaps = 7/120 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            +S R  RV ++++  L  +I   E +D  +   ++++S V +S DL  A V+I++    
Sbjct: 2   ADSSRRQRVADQIQKELAGLIQR-EMKDPRLG--MVTVSAVDVSRDLAYADVFITMLGKD 58

Query: 67  SPD---RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
             +   + +  L     F+RG++ R++R LR VP LRFRYD S++   +L++L+   +  
Sbjct: 59  DAEARQQTLDILGRGAGFLRGKLARAMR-LRIVPALRFRYDESIERGARLSSLIEDARKK 117


>gi|56751167|ref|YP_171868.1| ribosome-binding factor A [Synechococcus elongatus PCC 6301]
 gi|81299166|ref|YP_399374.1| ribosome-binding factor A [Synechococcus elongatus PCC 7942]
 gi|61214698|sp|Q5N2X2|RBFA_SYNP6 RecName: Full=Ribosome-binding factor A
 gi|123557478|sp|Q31RD2|RBFA_SYNE7 RecName: Full=Ribosome-binding factor A
 gi|56686126|dbj|BAD79348.1| ribosome binding factor A [Synechococcus elongatus PCC 6301]
 gi|81168047|gb|ABB56387.1| ribosome-binding factor A [Synechococcus elongatus PCC 7942]
          Length = 137

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 23/113 (20%), Positives = 56/113 (49%), Gaps = 3/113 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           +RR  RV   ++  +  ++++   +D  +   ++S+++V +S DL+   +++S+      
Sbjct: 4   NRRVERVASLIKREVSQMLMSG-IKDDRVGAGMVSVTDVVVSGDLQHTKIFVSIYGTPEA 62

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
               +  L     ++R  +G+ +R LR  PE+ F  D  L+   ++ +L+   
Sbjct: 63  KAETMEGLKSAASYVRSELGQRVR-LRRTPEVIFVEDKGLERGTQVISLLEQL 114


>gi|223044222|ref|ZP_03614259.1| ribosome-binding factor A [Staphylococcus capitis SK14]
 gi|222442372|gb|EEE48480.1| ribosome-binding factor A [Staphylococcus capitis SK14]
          Length = 116

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 63/115 (54%), Gaps = 5/115 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA RVGE+++  +M + +NN+ +D  +    ++I++V ++ DL  A VY+++    
Sbjct: 1   MSNMRAERVGEQMKQEIMDI-VNNKVKDPRVG--FLTITDVELTNDLSHAKVYLTVLGSK 57

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              D    AL     FI+  +G  +R LR +P+L F YD S++   K+  ++   
Sbjct: 58  KEVDNTFKALEKAKGFIKSELGSRMR-LRIIPDLTFEYDESIEYGNKIERMIQDL 111


>gi|160898432|ref|YP_001564014.1| ribosome-binding factor A [Delftia acidovorans SPH-1]
 gi|238687223|sp|A9C1Z3|RBFA_DELAS RecName: Full=Ribosome-binding factor A
 gi|160364016|gb|ABX35629.1| ribosome-binding factor A [Delftia acidovorans SPH-1]
          Length = 123

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/128 (24%), Positives = 57/128 (44%), Gaps = 5/128 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  +      R+ +V ++++  L  +I   E +D  +   ++++  V ++ D   A VY 
Sbjct: 1   MATRKSAAPNRSFKVSDQIQRDLAELIAR-ELKDPRVG--MVTLQSVEVTPDYAHAKVYF 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           SL     P     ALN    F+R  + + L ++  VP L F YD + +    +NAL+   
Sbjct: 58  SLL-VGDPQATQEALNQAAGFLRNGLFKRL-HIHTVPTLHFIYDRTSERAADMNALIAKA 115

Query: 121 KIPVALEK 128
                 E+
Sbjct: 116 VSSRGKEE 123


>gi|225012557|ref|ZP_03702993.1| ribosome-binding factor A [Flavobacteria bacterium MS024-2A]
 gi|225003534|gb|EEG41508.1| ribosome-binding factor A [Flavobacteria bacterium MS024-2A]
          Length = 133

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
            + + R  ++ + ++  +   +L    +   +S  +IS+++V ++ DL  A +Y+S+   
Sbjct: 3   KQETPRQKKINKVLQQEVA-TLLQGAIRQENVSNLMISVTKVHVTSDLTSAKIYLSIFPT 61

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               R    L  N   +R  + + ++N LR VP+L+F  D SL     ++  +   K
Sbjct: 62  QDAQRHFEVLKENKFQLRHDLSQRMKNQLRRVPDLQFFLDDSLDYIESIDNELKKGK 118


>gi|78183922|ref|YP_376357.1| ribosome-binding factor A [Synechococcus sp. CC9902]
 gi|123582140|sp|Q3B014|RBFA_SYNS9 RecName: Full=Ribosome-binding factor A
 gi|78168216|gb|ABB25313.1| ribosome-binding factor A [Synechococcus sp. CC9902]
          Length = 134

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSP 68
           RR  RV   +R     +++N   +D  + + ++SI+ V ++ DL+   +++S+       
Sbjct: 5   RRVERVAALIRKETSELLING-IRDERVHKGMVSITSVEVAGDLQHCKIFVSIFGEPNDQ 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
           + V+  L     F+RG +GR L  +R  PE++F+ D  L+    +  L+   +   
Sbjct: 64  NEVMEGLEAASGFLRGELGRRL-QMRRAPEVKFQLDRGLEKGTSVLGLLNQLEDQR 118


>gi|313901528|ref|ZP_07834974.1| ribosome-binding factor A [Thermaerobacter subterraneus DSM 13965]
 gi|313468206|gb|EFR63674.1| ribosome-binding factor A [Thermaerobacter subterraneus DSM 13965]
          Length = 139

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 35/127 (27%), Positives = 62/127 (48%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M      +++R  RV + ++ AL  ++     +D  +   + +++ V +S DLR A V I
Sbjct: 1   MGQVMGVSAKRHQRVADAIQEALAEILRR--VKDPRVG--MAAVTGVELSPDLRHARVRI 56

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           S+  D     R +  L     FIR  +GR++R LR+VPEL FR D S     ++  ++  
Sbjct: 57  SVIGDEAERQRTMEGLEHARGFIRSELGRAVR-LRHVPELDFRLDDSAAYSVRIAQILRE 115

Query: 120 PKIPVAL 126
            +    +
Sbjct: 116 IRPSDDV 122


>gi|282899763|ref|ZP_06307726.1| Ribosome-binding factor A [Cylindrospermopsis raciborskii CS-505]
 gi|281195378|gb|EFA70312.1| Ribosome-binding factor A [Cylindrospermopsis raciborskii CS-505]
          Length = 126

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/106 (24%), Positives = 56/106 (52%), Gaps = 3/106 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           +RR  RV E ++  +  ++++   +D  +   ++S+++V +S DL+ A +++S+      
Sbjct: 4   NRRVSRVAELIKREVSQMLIHG-IKDDRVGVGMVSVTDVDVSGDLQHAKIFVSIYGTEEA 62

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKL 113
               ++ L     ++R  +G  +R LR  PE+ F  D SL+   K+
Sbjct: 63  KAETMAGLKSATGYVRSELGARVR-LRRTPEVIFVEDHSLERGTKV 107


>gi|15604300|ref|NP_220816.1| ribosome-binding factor A [Rickettsia prowazekii str. Madrid E]
 gi|3914549|sp|O05964|RBFA_RICPR RecName: Full=Ribosome-binding factor A
 gi|2073498|emb|CAA72443.1| ribosomal binding factor A [Rickettsia prowazekii]
 gi|3860992|emb|CAA14892.1| RIBOSOME-BINDING FACTOR A (rbfA) [Rickettsia prowazekii]
 gi|292572049|gb|ADE29964.1| Ribosome-binding factor A [Rickettsia prowazekii Rp22]
          Length = 128

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 58/120 (48%), Gaps = 2/120 (1%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     NS R  ++   +   L+ ++   +  D+ +    ++I+++ ++ DL++A  Y 
Sbjct: 1   MKKLTKTNSHRQQKLASIINEVLIEILKRGKMLDKRLFDCPLTITKIIVTADLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                  + D ++ ALN +   IR  I   + N+++ PE+RF YD    +  K+  L+  
Sbjct: 61  FPFNTKLTFDEIMDALNNSKHAIRNFITNRI-NMKFSPEIRFYYDYGFDNAIKIEELLKN 119


>gi|261867881|ref|YP_003255803.1| ribosome-binding factor A [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261413213|gb|ACX82584.1| ribosome-binding factor A [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 128

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 65/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A V+++   
Sbjct: 1   MAREFKRSDRVAQEIQKEIAVILQR-EVKDPRIG--MVTVSDVDVSSDLAYAKVFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +   +  L     +IR  +G+++R L  VPE+RF YD SL    +++ L+    
Sbjct: 58  DHDEQAIAQGMKGLEKAAPYIRTLLGKAMR-LWIVPEIRFIYDQSLVEGMRMSNLV-TNV 115

Query: 122 IPVALEK 128
           +    +K
Sbjct: 116 VREDQKK 122


>gi|309791822|ref|ZP_07686309.1| ribosome-binding factor A [Oscillochloris trichoides DG6]
 gi|308226144|gb|EFO79885.1| ribosome-binding factor A [Oscillochloris trichoides DG6]
          Length = 143

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/120 (27%), Positives = 60/120 (50%), Gaps = 4/120 (3%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
           P + +R  ++G+ ++  L  VI  +E +D  +     +++ V +S DL+ ATV IS+  D
Sbjct: 17  PMSKQRLQQIGDRIQQVLGAVI-QSEIKDPRVG--FATVTGVEVSADLQHATVRISIMGD 73

Query: 66  VSPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                  ++ L     F+R R+   LR++R+VPEL    DTSL     +  ++   +   
Sbjct: 74  AEEQAATMAGLQRARSFLRRRVADELRHMRFVPELHLVQDTSLDYTIHIEQVLRQVEEER 133


>gi|326798580|ref|YP_004316399.1| ribosome-binding factor A [Sphingobacterium sp. 21]
 gi|326549344|gb|ADZ77729.1| Ribosome-binding factor A [Sphingobacterium sp. 21]
          Length = 124

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 22/116 (18%), Positives = 50/116 (43%), Gaps = 3/116 (2%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
              S+R  R    ++  L  +              +++++ V ++ DL +A +Y+S    
Sbjct: 3   STESKRQQRFASVIQQDLADIFQREGIV--WAPDTLVTVTRVRVTPDLAIARIYLSFLNA 60

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +    I+ +  +   IR ++G  ++N  R VP+L F  D + +   +++ L    
Sbjct: 61  KNVQEAIANIKSHAGEIRYKLGSRIKNQARIVPQLEFFVDDTNEYVERMDKLFEKI 116


>gi|260771813|ref|ZP_05880731.1| ribosome-binding factor A [Vibrio metschnikovii CIP 69.14]
 gi|260613105|gb|EEX38306.1| ribosome-binding factor A [Vibrio metschnikovii CIP 69.14]
          Length = 131

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 34/126 (26%), Positives = 65/126 (51%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
            PK   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MPKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  I AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  IGEQTPESCIKALREHEVHIRMMLGKRIR-LRLTPEIRFHYDNTLVEGMRMSNLV-TEVV 115

Query: 123 PVALEK 128
                +
Sbjct: 116 NQDKRR 121


>gi|188587938|ref|YP_001920619.1| ribosome-binding factor A [Clostridium botulinum E3 str. Alaska
           E43]
 gi|251781062|ref|ZP_04823982.1| ribosome-binding factor A [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|238689677|sp|B2V4H0|RBFA_CLOBA RecName: Full=Ribosome-binding factor A
 gi|188498219|gb|ACD51355.1| ribosome-binding factor A [Clostridium botulinum E3 str. Alaska
           E43]
 gi|243085377|gb|EES51267.1| ribosome-binding factor A [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 116

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 60/117 (51%), Gaps = 5/117 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  R+ EE +  +  +I  NE +D  +   +IS+++V ++ DLR A VY+S+    
Sbjct: 1   MPNYRGGRINEEFKREISNII-QNEIKDPRL-TAMISVTDVKVTKDLRYAKVYVSIFSTK 58

Query: 67  SPD--RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             +     +AL     FIR  +G+ + N+R+ PE+ F  D S+     ++ L+   K
Sbjct: 59  EEEKKDNFTALKSASGFIRKILGQRI-NVRHNPEILFELDDSINYAMHIDELIQKVK 114


>gi|319952940|ref|YP_004164207.1| ribosome-binding factor a [Cellulophaga algicola DSM 14237]
 gi|319421600|gb|ADV48709.1| ribosome-binding factor A [Cellulophaga algicola DSM 14237]
          Length = 130

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 54/113 (47%), Gaps = 2/113 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             ++R  ++G  ++  +  V+      D  +   +IS+S+V ++ DL +A VY+S+    
Sbjct: 1   METQRQKKIGGVIQKDIADVLQR-AATDGGLRGTLISVSKVIVTTDLSIAKVYVSIFPTK 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
               ++  +  N   I+  + +  +N LR +PEL F  D SL+    +   + 
Sbjct: 60  DAQELLKGMKSNQPLIKHELAQRTKNQLRRMPELMFFLDDSLEYIDGIEKSLK 112


>gi|187933507|ref|YP_001885472.1| ribosome-binding factor A [Clostridium botulinum B str. Eklund 17B]
 gi|238691621|sp|B2TJ56|RBFA_CLOBB RecName: Full=Ribosome-binding factor A
 gi|187721660|gb|ACD22881.1| ribosome-binding factor A [Clostridium botulinum B str. Eklund 17B]
          Length = 116

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/117 (27%), Positives = 60/117 (51%), Gaps = 5/117 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  R+ EE +  +  +I  NE +D  +   +IS+++V ++ DL+ A VY+S+    
Sbjct: 1   MPNYRGGRINEEFKREISNII-QNEIKDPRL-TAMISVTDVKVTKDLKYAKVYVSIFSTK 58

Query: 67  SPD--RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             +     +AL     FIR  +G+ + N+R+ PE+ F  D S+     ++ L+   K
Sbjct: 59  EEEKKDNFTALKSASGFIRKILGQRI-NVRHNPEILFELDDSINYAMHIDELIQKVK 114


>gi|251810701|ref|ZP_04825174.1| ribosome-binding factor A [Staphylococcus epidermidis BCM-HMP0060]
 gi|293366766|ref|ZP_06613442.1| ribosome-binding factor A [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|251805861|gb|EES58518.1| ribosome-binding factor A [Staphylococcus epidermidis BCM-HMP0060]
 gi|291319067|gb|EFE59437.1| ribosome-binding factor A [Staphylococcus epidermidis
           M23864:W2(grey)]
          Length = 127

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/121 (29%), Positives = 67/121 (55%), Gaps = 5/121 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           +K     N+ RA RVGE+++  +M + +NN+ +D  +    ++I++V ++ DL  A VY+
Sbjct: 6   IKRGEMMNNIRAERVGEQMKQEIMDI-VNNKVKDPRVG--FLTITDVELTNDLSQAKVYL 62

Query: 61  SLPLDVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +    D    AL+    FI+  +G  +R LR +PEL F YD S++   K+  ++  
Sbjct: 63  TVLGNDKEVDNTFKALHKATGFIKSELGSRMR-LRIIPELTFEYDESIEYGNKIERMIQE 121

Query: 120 P 120
            
Sbjct: 122 L 122


>gi|148263959|ref|YP_001230665.1| ribosome-binding factor A [Geobacter uraniireducens Rf4]
 gi|189039543|sp|A5GF87|RBFA_GEOUR RecName: Full=Ribosome-binding factor A
 gi|146397459|gb|ABQ26092.1| ribosome-binding factor A [Geobacter uraniireducens Rf4]
          Length = 122

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 60/113 (53%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-S 67
            +R+ +V E V   +  +++    +D  I    ++I+ V ++ D+ +ATVY ++      
Sbjct: 2   FKRSEKVAEAVHELISELLVKG-LKDPRIG--FVTITGVKVTDDMHLATVYFTVIGSDAE 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                  LN    FIR  +G+SLR +RYVP++ F+YD S+   +++ +++   
Sbjct: 59  KKATEQGLNSARGFIRKEMGKSLR-MRYVPDIVFKYDVSVDYGYRIESILKEI 110


>gi|253991501|ref|YP_003042857.1| ribosome-binding factor A [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211638379|emb|CAR67001.1| ribosome-binding factor a [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253782951|emb|CAQ86116.1| ribosome-binding factor a [Photorhabdus asymbiotica]
          Length = 136

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 64/131 (48%), Gaps = 12/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV +E++  +  +IL  E +D  I   + ++S V +S DL  A V+++   
Sbjct: 1   MAREFSRTQRVAQEMQKEIA-IILQREVKDPRIG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 65  DVSPDRV-------ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
            ++ +         I AL     FIR  +G+++R LR VPEL F YD SL    +++ L+
Sbjct: 58  VLTEEHDSDVVKNGIKALGEASGFIRSLLGKAMR-LRVVPELTFSYDNSLVEGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               +    ++
Sbjct: 117 TNV-VKDDEQR 126


>gi|119470823|ref|ZP_01613434.1| ribosome-binding factor A, role in processing of 16S rRNA
           [Alteromonadales bacterium TW-7]
 gi|119446050|gb|EAW27329.1| ribosome-binding factor A, role in processing of 16S rRNA
           [Alteromonadales bacterium TW-7]
          Length = 148

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 59/122 (48%), Gaps = 8/122 (6%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           +   R  RVG++++  +  ++   E +D  +   ++++S V +S DL  A ++I++    
Sbjct: 2   REFSRTDRVGQQIQKEIAVILQR-EIKDPRLG--MVTVSAVEVSRDLSYAKIFITVFNTK 58

Query: 67  SPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
             D        LN    +IR  +G+ +R  R +PEL+F  D SL    +++ L+    I 
Sbjct: 59  DEDAAKQSAKVLNEATGYIRSLLGKRIRA-RIMPELKFVVDNSLMEGMRISNLVDTI-IR 116

Query: 124 VA 125
             
Sbjct: 117 ED 118


>gi|254490537|ref|ZP_05103723.1| ribosome-binding factor A [Methylophaga thiooxidans DMS010]
 gi|224464281|gb|EEF80544.1| ribosome-binding factor A [Methylophaga thiooxydans DMS010]
          Length = 124

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 60/124 (48%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  R GE V   L  ++   E  D  I   ++++S V ++ DL+ A VY++   
Sbjct: 1   MAREYSRTNRFGEVVMRELALMLQR-EISDPRIG--MVTVSHVDVTADLKYAKVYVTRFN 57

Query: 65  DVSPDR----VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
               ++     +  LN    ++R  +   ++ LR +PEL+F YD SL++ ++++ L+   
Sbjct: 58  GFESEQDVQECLQGLNSASGYLRRGLAGRVK-LRSIPELQFVYDKSLENGFRMDELIAKA 116

Query: 121 KIPV 124
             P 
Sbjct: 117 NKPR 120


>gi|222055782|ref|YP_002538144.1| ribosome-binding factor A [Geobacter sp. FRC-32]
 gi|254789751|sp|B9M1G1|RBFA_GEOSF RecName: Full=Ribosome-binding factor A
 gi|221565071|gb|ACM21043.1| ribosome-binding factor A [Geobacter sp. FRC-32]
          Length = 123

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 60/113 (53%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVS 67
            +R+ +V E V   +  +++    +D  I    ++I+ V ++ D+ +AT+Y ++   D  
Sbjct: 2   FKRSEKVAEAVHELVSELLVKG-LKDPRIG--FVTITGVKVTDDMHLATIYFTVIGSDEE 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                  LN    FIR  +G+S R +RYVP++ F+YD S++   ++ +++   
Sbjct: 59  KKATEQGLNSARGFIRKEMGKSFR-MRYVPDIVFKYDASVEYGSRIESILKEI 110


>gi|242373562|ref|ZP_04819136.1| ribosome-binding factor A [Staphylococcus epidermidis M23864:W1]
 gi|242348925|gb|EES40527.1| ribosome-binding factor A [Staphylococcus epidermidis M23864:W1]
          Length = 118

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 32/117 (27%), Positives = 63/117 (53%), Gaps = 5/117 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
              ++ RA RVGE+++  +M + +N + +D  +    ++I++V ++ DL  A VY+++  
Sbjct: 1   MKMSNMRAERVGEQMKQEIMDI-VNTKVKDPRVG--FLTITDVELTNDLSQAKVYLTVLG 57

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +    D    AL     FI+  +G  +R LR +P+L F YD S++   K+  ++   
Sbjct: 58  NEKEVDNTFKALEKAKGFIKSELGSRMR-LRIIPDLTFEYDESIEYGNKIERMIQDL 113


>gi|159030294|emb|CAO91189.1| rbfA [Microcystis aeruginosa PCC 7806]
          Length = 130

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 60/116 (51%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           RR  RV   ++  +  ++L  E +D  +   ++S+++V +S DL+ A +++S+  +    
Sbjct: 5   RRVSRVSSLIKREVSQMLL-MEIKDDRVGAGMVSVTDVDLSHDLQHARIFVSIYGNKDAK 63

Query: 70  -RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
              ++ L     F+R  +G+ +R LR  PE+ F  D+SL+   ++  L+   K   
Sbjct: 64  AETMAGLKAAAGFVRRELGQRIR-LRRTPEVVFLEDSSLERGDRMLHLLDHIKSDR 118


>gi|189424729|ref|YP_001951906.1| ribosome-binding factor A [Geobacter lovleyi SZ]
 gi|259552000|sp|B3EAE8|RBFA_GEOLS RecName: Full=Ribosome-binding factor A
 gi|189420988|gb|ACD95386.1| ribosome-binding factor A [Geobacter lovleyi SZ]
          Length = 123

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 63/126 (50%), Gaps = 11/126 (8%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK+K      R+ +V E + + +  ++      D  I    ++I+ V ++ DL +A ++ 
Sbjct: 1   MKHK------RSDKVAETIHTTISTILSRG-LNDPRIG--FVTITGVEVTDDLHLARIFF 51

Query: 61  SLPLDVSPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  D +  +   A LN   +FIR  +G+ L+ +RY P++ F+YD S +   +++ L+  
Sbjct: 52  TVIGDEAAKKSSEAGLNSAARFIRHELGKVLK-MRYTPDILFKYDHSQEYGQRIDDLLRE 110

Query: 120 PKIPVA 125
                 
Sbjct: 111 VGTGND 116


>gi|23099055|ref|NP_692521.1| ribosome-binding factor A [Oceanobacillus iheyensis HTE831]
 gi|29427761|sp|Q8EQT9|RBFA_OCEIH RecName: Full=Ribosome-binding factor A
 gi|22777283|dbj|BAC13556.1| ribosome-binding factor A [Oceanobacillus iheyensis HTE831]
          Length = 113

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 59/111 (53%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           RA R+ E+++  L  ++   + +D  +    +++++V ++ DL+ A VYIS+  D    +
Sbjct: 5   RAHRIAEQMKKELGEILSR-KIKDPRVG--FVTVTDVEVTGDLQQAKVYISVLGDEKKKQ 61

Query: 71  -VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  L+    FIR  IG  +R LR  PE+ F +D +L+   ++  ++   
Sbjct: 62  DTLLGLSKAKGFIRSEIGNRIR-LRKTPEITFEFDEALEQGNRIETILRDL 111


>gi|261253849|ref|ZP_05946422.1| ribosome-binding factor A [Vibrio orientalis CIP 102891]
 gi|260937240|gb|EEX93229.1| ribosome-binding factor A [Vibrio orientalis CIP 102891]
          Length = 135

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 64/126 (50%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVAQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  + AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  IGEQTPESCLEALREHEVHIRMMLGKRIR-LRLTPEVRFYYDNTLVEGMRMSNLV-SEVV 115

Query: 123 PVALEK 128
                K
Sbjct: 116 SEDKRK 121


>gi|319787426|ref|YP_004146901.1| ribosome-binding factor A [Pseudoxanthomonas suwonensis 11-1]
 gi|317465938|gb|ADV27670.1| ribosome-binding factor A [Pseudoxanthomonas suwonensis 11-1]
          Length = 120

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 27/112 (24%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K+  R  RV  ++R  L   +++   ++  +    +S+S+V ++ DL  A V+++  +  
Sbjct: 4   KSFHRTDRVSAQLRRELG-TLVHEAVREHGLPS--VSVSDVEVTRDLAHAKVFVTALMPE 60

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
                + AL      +R  + R ++ +R+VPEL F YD S+    ++  L+ 
Sbjct: 61  RSTEAVKALKELAYQLRMELARRVK-MRHVPELHFHYDDSVDRGERIETLLK 111


>gi|333029565|ref|ZP_08457626.1| ribosome-binding factor A [Bacteroides coprosuis DSM 18011]
 gi|332740162|gb|EGJ70644.1| ribosome-binding factor A [Bacteroides coprosuis DSM 18011]
          Length = 110

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 57/113 (50%), Gaps = 4/113 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L      +  +  +IS+SEV ++ DL +A  Y+S+  + 
Sbjct: 1   METTRQQKISRLIQKELSEIFLQQT---KATNGILISVSEVRVTSDLSIARAYLSIFPND 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
               +I  +N N K IR  +G  +R+ LR +PEL F  D SL    +++ L+ 
Sbjct: 58  KKQELIENINANAKAIRYDLGTRVRHQLRIIPELIFHIDDSLDYAERIDELLK 110


>gi|187928211|ref|YP_001898698.1| ribosome-binding factor A [Ralstonia pickettii 12J]
 gi|241662815|ref|YP_002981175.1| ribosome-binding factor A [Ralstonia pickettii 12D]
 gi|309782262|ref|ZP_07676990.1| ribosome-binding factor A [Ralstonia sp. 5_7_47FAA]
 gi|238691808|sp|B2UAA4|RBFA_RALPJ RecName: Full=Ribosome-binding factor A
 gi|187725101|gb|ACD26266.1| ribosome-binding factor A [Ralstonia pickettii 12J]
 gi|240864842|gb|ACS62503.1| ribosome-binding factor A [Ralstonia pickettii 12D]
 gi|308918955|gb|EFP64624.1| ribosome-binding factor A [Ralstonia sp. 5_7_47FAA]
          Length = 123

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 23/127 (18%), Positives = 60/127 (47%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K+   + R +R+ ++++  L  +I   E ++  +   ++++  V ++ D   A +Y 
Sbjct: 1   MPKKSGSAAGRNVRIADQIQRDLAELIQR-EIKNPAMG--LVTLQSVTLTPDYAHAKIYF 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++     P+   + LN    ++   + + L ++  VP L F +D S++   +++ L+   
Sbjct: 58  TVLGA-EPEVAGAILNEKAGYLHSLLFKRL-HIHTVPTLHFHFDGSVERGIEMSRLIDEA 115

Query: 121 KIPVALE 127
               A +
Sbjct: 116 NATRAKD 122


>gi|282895926|ref|ZP_06303966.1| Ribosome-binding factor A [Raphidiopsis brookii D9]
 gi|281199171|gb|EFA74040.1| Ribosome-binding factor A [Raphidiopsis brookii D9]
          Length = 120

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 57/106 (53%), Gaps = 3/106 (2%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           +RR  RV E ++  +  ++L+   +D  +   ++S+++V +S DL+ A +++S+      
Sbjct: 4   NRRVSRVAELIKREVSQMLLHG-IKDDRVGVGMVSVTDVDVSGDLQHAKIFVSIYGTEEA 62

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKL 113
             + ++ L     ++R  +G  +R LR  PE+ F  D SL+   K+
Sbjct: 63  KAQTMAGLKSATGYVRSELGARVR-LRRTPEVIFVEDRSLERGTKV 107


>gi|148657851|ref|YP_001278056.1| ribosome-binding factor A [Roseiflexus sp. RS-1]
 gi|172048090|sp|A5UZQ3|RBFA_ROSS1 RecName: Full=Ribosome-binding factor A
 gi|148569961|gb|ABQ92106.1| ribosome-binding factor A [Roseiflexus sp. RS-1]
          Length = 130

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 57/117 (48%), Gaps = 4/117 (3%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R  ++G E++  L  VI   E +D  +     ++  V ++ DL++A V IS+      
Sbjct: 2   SKRTEQLGHEIQRILGEVI-QYELKDPRVG--FATVVGVEVTADLQIARVRISVMGTPDE 58

Query: 69  DR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
            R  ++AL     F+R R+   L  LR+VPELR   DTS+     ++ L+       
Sbjct: 59  RRETMAALERARGFLRRRLAEELNYLRFVPELRLILDTSVDYSLHIDELLRRAAEER 115


>gi|312129254|ref|YP_003996594.1| ribosome-binding factor a [Leadbetterella byssophila DSM 17132]
 gi|311905800|gb|ADQ16241.1| ribosome-binding factor A [Leadbetterella byssophila DSM 17132]
          Length = 124

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 3/123 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R  +V   ++  L  +         L + + ++I++V +S DL VA VY+S   + 
Sbjct: 1   MESKRQKQVARLIQKDLGEIFQRE--FRSLFAGNFVTITDVKVSPDLSVAKVYLSFLKNH 58

Query: 67  SPDRVISALNCNIKFIRGRIG-RSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
           + + ++  +    K IRG  G ++ + LR +P   F  D + +   K+  L     IP A
Sbjct: 59  NRESLLEEIKEQTKKIRGMFGMKAGKQLRIIPHFSFFIDDTAEYAQKIEELFANIHIPPA 118

Query: 126 LEK 128
            E+
Sbjct: 119 EEE 121


>gi|71854003|gb|AAZ52026.1| ribosome-binding factor A [Streptococcus pyogenes MGAS5005]
          Length = 163

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 55/121 (45%), Gaps = 6/121 (4%)

Query: 3   NKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL 62
            +    + R  RVG E++  +  ++   + +D  +    ++I+EV M  DL +A VY ++
Sbjct: 44  KEMAMANHRIDRVGMEIKREVNDILQK-KVRDPRVQG--VTITEVQMQGDLSLAKVYYTI 100

Query: 63  PLD--VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             D      +  + L      I+  +G+ L  +  +P+L F  D S+    K++ L+   
Sbjct: 101 MSDLASDNQKAQTGLEKATGTIKRELGKQL-TMYKIPDLVFEKDNSIAYGNKIDQLLRDL 159

Query: 121 K 121
            
Sbjct: 160 D 160


>gi|295696159|ref|YP_003589397.1| ribosome-binding factor A [Bacillus tusciae DSM 2912]
 gi|295411761|gb|ADG06253.1| ribosome-binding factor A [Bacillus tusciae DSM 2912]
          Length = 119

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/116 (25%), Positives = 57/116 (49%), Gaps = 5/116 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  RV E+++  +  ++  +E +D  I    ++I+ V +S DL+ A V+ S+       
Sbjct: 4   IRPSRVAEQIKKEITDILY-HELKDPRIG--FVTITGVEVSRDLQHAKVFASVLGSDEEK 60

Query: 70  RVI-SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
            +   AL     FIR  +GR +R L + PE+ F+ DTS     +++ ++   +   
Sbjct: 61  ALSLEALQKATGFIRSEVGRRIR-LHHTPEIVFKLDTSEDYSQRISHVIRQLQGER 115


>gi|289676026|ref|ZP_06496916.1| ribosome-binding factor A [Pseudomonas syringae pv. syringae FF5]
          Length = 117

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/119 (26%), Positives = 62/119 (52%), Gaps = 7/119 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L   ++  E +D  +   +++I+ V +S D+  A +++++  
Sbjct: 1   MAKEYSRTQRIGDQMQRELAQ-LIRREIKDPRVG--LVTITAVDVSRDVGHAKIFMTVMG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             S + +   I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+   
Sbjct: 58  QDSAEEIAQTIKVLNAAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIERA 115


>gi|317968062|ref|ZP_07969452.1| ribosome-binding factor A [Synechococcus sp. CB0205]
          Length = 136

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 59/120 (49%), Gaps = 4/120 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-P 68
           RR  RV   +R  +  +++    +D  +S  ++SI+ V ++ DL+   +++S+       
Sbjct: 5   RRVERVAALIRREVSELLVTG-IKDERVSLGMVSITNVDVAGDLQHCKIFVSVYGSAEVQ 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
            + +  L     +++G +GR L N+R  PE+ F+ D  ++    +  L+   +    LE+
Sbjct: 64  QQALEGLRSASNYVKGELGRRL-NMRRTPEVIFQLDRGIEKGTSVLGLLNQLEEKR-LER 121


>gi|226329680|ref|ZP_03805198.1| hypothetical protein PROPEN_03590 [Proteus penneri ATCC 35198]
 gi|225202866|gb|EEG85220.1| hypothetical protein PROPEN_03590 [Proteus penneri ATCC 35198]
          Length = 133

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 65/132 (49%), Gaps = 13/132 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             ++  R+ RV +E++  +  +IL  E +D  I   + ++S V +S DL  A V+++   
Sbjct: 1   MARDFSRSQRVSQEMQKEIA-IILQREVKDPRIG--MATVSGVEISRDLAYAKVFVTFLN 57

Query: 65  DVSPDRVIS--------ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
               ++           ALN    FIR  +G+++R LR VPEL F YD SL    +++ L
Sbjct: 58  LSGGEKSEEEMVAEGLTALNEAAGFIRSLLGKAMR-LRIVPELTFAYDNSLVEGMRMSNL 116

Query: 117 MCLPKIPVALEK 128
           +    +    E+
Sbjct: 117 VSNV-VKSDEER 127


>gi|67459061|ref|YP_246685.1| ribosome-binding factor A [Rickettsia felis URRWXCal2]
 gi|75536505|sp|Q4ULQ3|RBFA_RICFE RecName: Full=Ribosome-binding factor A
 gi|67004594|gb|AAY61520.1| Ribosome-binding factor A [Rickettsia felis URRWXCal2]
          Length = 120

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 58/121 (47%), Gaps = 2/121 (1%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     NS R  ++   +  AL+ ++   +  D  +    ++I++V ++ DL++A  Y 
Sbjct: 1   MKKLTKTNSHRQQKLASIINEALIEILRRGKMLDSRLFDCPLTITKVIVTADLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                  + D ++ AL+ +   IR  I   + N+++ P++RF YD    +  K+  L+  
Sbjct: 61  LPFNTKLTIDEIMDALSNSKNAIRNFITNKI-NMKFSPDIRFHYDHGFDNAIKVEELLKN 119

Query: 120 P 120
            
Sbjct: 120 I 120


>gi|331002479|ref|ZP_08325997.1| ribosome-binding factor A [Lachnospiraceae oral taxon 107 str.
           F0167]
 gi|330410295|gb|EGG89729.1| ribosome-binding factor A [Lachnospiraceae oral taxon 107 str.
           F0167]
          Length = 123

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 63/124 (50%), Gaps = 5/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS ++  +  EV  A+  + +  E +D  +   + S+++  ++ DL+ AT+Y+S+  
Sbjct: 1   MRKNSLKSTMINSEVMKAVSEI-MRGEVKDPRV-APMTSVTDAEVTTDLKYATIYVSVLG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D     + ++ L  +  FIR  + R L NLR  PEL+F  D SL    K++ L+    I 
Sbjct: 59  DDEQSKKTLAGLKSSSGFIRKELARRL-NLRNTPELKFVLDESLAYGMKMDKLIDEV-IK 116

Query: 124 VALE 127
              +
Sbjct: 117 KDEK 120


>gi|51473624|ref|YP_067381.1| ribosome-binding factor A [Rickettsia typhi str. Wilmington]
 gi|61214908|sp|Q68WU3|RBFA_RICTY RecName: Full=Ribosome-binding factor A
 gi|51459936|gb|AAU03899.1| ribosome-binding factor A [Rickettsia typhi str. Wilmington]
          Length = 127

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 58/120 (48%), Gaps = 2/120 (1%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     NS R  ++   +   L+ ++   +  DR +    ++I+++ ++ DL++A  Y 
Sbjct: 1   MKKLTKTNSHRQQKLASIINEVLIEILKRGKMLDRRLFDCPLTITKIVVTADLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                  + + ++ ALN +   IR  I   + N+++ PE+RF YD    +  K+  L+  
Sbjct: 61  FPFNTKLTFNDIMDALNNSKHAIRNFITNKI-NMKFSPEIRFHYDYGFDNAIKIEKLLKS 119


>gi|300721539|ref|YP_003710814.1| ribosome-binding factor, role in processing of 10S rRNA
           [Xenorhabdus nematophila ATCC 19061]
 gi|297628031|emb|CBJ88580.1| ribosome-binding factor, role in processing of 10S rRNA
           [Xenorhabdus nematophila ATCC 19061]
          Length = 136

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 37/131 (28%), Positives = 64/131 (48%), Gaps = 12/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             ++  R  RV +E++  +  +IL  E +D  I   + ++S V +S DL  A V+++   
Sbjct: 1   MARDFSRTQRVAQEMQKEIA-IILQREIKDPRIG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 64  ------LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                         I ALN    FIR  +G+++R LR VPEL F YD+SL    +++ L+
Sbjct: 58  VLVEGHDSDQVKEGIKALNDASGFIRSLLGKAMR-LRIVPELTFSYDSSLVEGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               +    ++
Sbjct: 117 SNV-VKNDEQR 126


>gi|294788248|ref|ZP_06753491.1| ribosome-binding factor A [Simonsiella muelleri ATCC 29453]
 gi|294483679|gb|EFG31363.1| ribosome-binding factor A [Simonsiella muelleri ATCC 29453]
          Length = 123

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 50/119 (42%), Gaps = 5/119 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M         R  RV E+V   L   ++    +D      +I+I++V ++ D   ATV+ 
Sbjct: 1   MPKPQRNGYARIDRVKEQVMRELAE-LIRTGLKDPRAG--LITINDVEVTRDYSHATVFY 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++           AL     F+R  + + +   R  PEL F+YD SL+    L  L+  
Sbjct: 58  TVL-SGDRTASAEALEHAKGFLRSELAKRISVFR-TPELHFQYDESLERGVNLAHLIDQ 114


>gi|121604911|ref|YP_982240.1| ribosome-binding factor A [Polaromonas naphthalenivorans CJ2]
 gi|166219385|sp|A1VNU1|RBFA_POLNA RecName: Full=Ribosome-binding factor A
 gi|120593880|gb|ABM37319.1| ribosome-binding factor A [Polaromonas naphthalenivorans CJ2]
          Length = 122

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+ K+     R  RV ++++  L  +I   E +D  +   ++++  V ++ D   A +Y 
Sbjct: 1   MRKKSSTP-NRGFRVADQIQRDLTELIAR-ELKDPRVG--MVTVQSVEVTPDYAHAKIYF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           S+     P     ALN    F+R  + + L     VP L F +D + +    LNAL+   
Sbjct: 57  SVL-VGDPKECEIALNQAAGFLRNGLFKRLMT-HTVPTLHFHFDQTTERAADLNALIAKA 114

Query: 121 KIPVALE 127
               A +
Sbjct: 115 VSSRAQD 121


>gi|148241380|ref|YP_001226537.1| ribosome-binding factor A [Synechococcus sp. RCC307]
 gi|166219414|sp|A5GQM5|RBFA_SYNR3 RecName: Full=Ribosome-binding factor A
 gi|147849690|emb|CAK27184.1| Ribosome-binding factor A [Synechococcus sp. RCC307]
          Length = 131

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/116 (25%), Positives = 59/116 (50%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSP 68
           RR  RV   +R  +  +++N   +D  +++ ++SI+ V ++ DL+   V +S+   +   
Sbjct: 5   RRVERVASMIRREMSELLVNG-VRDERVNQGMVSITNVVVAGDLQHCKVSVSIFGSESEQ 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
           D+ ++ L     ++RG + R L N+R  PEL F +D  L    ++  L+   +   
Sbjct: 64  DQAMAGLRSAAPYLRGELSRRL-NMRRTPELVFHHDKGLAQGVEVLGLLSKLEEER 118


>gi|330447376|ref|ZP_08311025.1| ribosome-binding factor A [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328491567|dbj|GAA05522.1| ribosome-binding factor A [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 132

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 61/126 (48%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E ++  +   + +IS V +S D+  A VYI+   
Sbjct: 1   MAKEFSRTQRVAQQLQKELALILQR-ELKEPRL--AMTTISSVDVSRDMGYAKVYITFLT 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             D + +  ++ L     +IR  +G+ +R LR  PEL F +D SL    +++ L+    +
Sbjct: 58  IGDQTEEESLAILREKAPYIRSLLGKQIR-LRVTPELNFIFDQSLTEGMRISNLV-TNAV 115

Query: 123 PVALEK 128
               E+
Sbjct: 116 RSDEER 121


>gi|116071460|ref|ZP_01468728.1| Ribosome-binding factor A [Synechococcus sp. BL107]
 gi|116065083|gb|EAU70841.1| Ribosome-binding factor A [Synechococcus sp. BL107]
          Length = 134

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSP 68
           RR  RV   +R     +++N   +D  + + ++SI+ V ++ DL+   +++S+       
Sbjct: 5   RRVERVAALIRKETSELLING-IRDERVHKGMVSITSVEVAGDLQHCKIFVSIFGEPNDQ 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
           + V+  L     ++RG +GR L  +R  PE++F+ D  L+    +  L+   +   
Sbjct: 64  NEVMEGLEAASGYLRGELGRRL-QMRRAPEVKFQLDRGLEKGTSVLGLLNQLEDQR 118


>gi|222151110|ref|YP_002560264.1| ribosome-binding factor A [Macrococcus caseolyticus JCSC5402]
 gi|254789755|sp|B9EBF7|RBFA_MACCJ RecName: Full=Ribosome-binding factor A
 gi|222120233|dbj|BAH17568.1| ribosome-binding factor A [Macrococcus caseolyticus JCSC5402]
          Length = 114

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 63/113 (55%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-S 67
           S R+ RVGE+++  +  +I   + ++  +    ++++EV ++ DL +A+VY+++  +   
Sbjct: 2   SLRSERVGEQLKKEISEIINQ-KLKNPNVG--FVTVTEVEVTGDLSLASVYVTVLGEEKE 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             + +  L  +  FI+  I   + +LR VP+L+F+YD S+    K+  ++   
Sbjct: 59  RKKSLEGLEKSKGFIKSEIAHRM-DLRIVPDLKFKYDESIDYGNKIERMIAEL 110


>gi|153869167|ref|ZP_01998841.1| Ribosome-binding factor A [Beggiatoa sp. PS]
 gi|152074289|gb|EDN71159.1| Ribosome-binding factor A [Beggiatoa sp. PS]
          Length = 122

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 55/122 (45%), Gaps = 5/122 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K   R  R+G +++  L  +I        L    ++++S + +S DL+ A VY+++  + 
Sbjct: 2   KEFSRTQRLGVQIQRELADIIRREIVNPHL---GMLTVSSIDLSPDLKYARVYMTVLGEQ 58

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                 I  LN     +R  + + L   R  P L+F +D S++   +L+AL+        
Sbjct: 59  QGVKYTIQHLNQVAGRLRYHLSQRLTT-RTTPRLKFVHDNSIEESSRLSALINSLAPNRT 117

Query: 126 LE 127
            E
Sbjct: 118 KE 119


>gi|117620712|ref|YP_857793.1| ribosome-binding factor A [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|166218415|sp|A0KNE2|RBFA_AERHH RecName: Full=Ribosome-binding factor A
 gi|117562119|gb|ABK39067.1| ribosome-binding factor A [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 144

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 62/128 (48%), Gaps = 9/128 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             +   R  RVG++++  +  ++   E +D  I   ++++S+V +S DL  A VY++   
Sbjct: 1   MAREFSRTRRVGQQIQREIALILQR-EVKDPRIG--MVTVSDVEVSRDLNYAKVYVTFLQ 57

Query: 64  ---LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                      + AL     +IR  +G ++R LR VPELRF YD +L    +L+ L+   
Sbjct: 58  LENDAERIKEGLKALTEAAGYIRSLLGSAMR-LRVVPELRFFYDQTLVEGMRLSNLVTNT 116

Query: 121 KIPVALEK 128
            I     +
Sbjct: 117 -IREDKRR 123


>gi|228474959|ref|ZP_04059687.1| ribosome-binding factor A [Staphylococcus hominis SK119]
 gi|314936569|ref|ZP_07843916.1| ribosome-binding factor A [Staphylococcus hominis subsp. hominis
           C80]
 gi|228270944|gb|EEK12332.1| ribosome-binding factor A [Staphylococcus hominis SK119]
 gi|313655188|gb|EFS18933.1| ribosome-binding factor A [Staphylococcus hominis subsp. hominis
           C80]
          Length = 116

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 35/118 (29%), Positives = 65/118 (55%), Gaps = 5/118 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA RVGE+++  +M +I NN+ +D  +    I+I++V ++ DL  A V++++  + 
Sbjct: 1   MSNMRAERVGEQMKKEVMDII-NNKVKDPRVG--FITITDVELTNDLSQAKVFLTVLGNK 57

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
              +    AL+    FI+  +G  +R LR VPEL F YD S++   K+  ++      
Sbjct: 58  KEVNDTFKALDKAKGFIKSELGSRMR-LRIVPELFFEYDESIEYGNKIEKMIQDLHKQ 114


>gi|226323227|ref|ZP_03798745.1| hypothetical protein COPCOM_00999 [Coprococcus comes ATCC 27758]
 gi|225208417|gb|EEG90771.1| hypothetical protein COPCOM_00999 [Coprococcus comes ATCC 27758]
          Length = 123

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 6/125 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV  EV+  L  ++     +D  +   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRVNAEVQRELSTIL-RGGIKDPRV-APMTSVVAVEVAPDLKTCKAYISVLG 58

Query: 65  DVSPD-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D       +  L     +IR  +  +L N+R  PE++F  D S++   +++  +    + 
Sbjct: 59  DEKAQADTLKGLQSAEGYIRRELAHTL-NMRNTPEIKFVLDQSIEYGVRMSKKIDD--VT 115

Query: 124 VALEK 128
             L +
Sbjct: 116 RDLRE 120


>gi|288940252|ref|YP_003442492.1| ribosome-binding factor A [Allochromatium vinosum DSM 180]
 gi|288895624|gb|ADC61460.1| ribosome-binding factor A [Allochromatium vinosum DSM 180]
          Length = 127

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 57/124 (45%), Gaps = 7/124 (5%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
            N +   R  R+G E++ AL  V++ ++ +D  ++   I++ EV ++ DL  A VY +  
Sbjct: 1   MNEREFDRTERIGAEMKRALA-VLVRDQVKDPRLAN--ITVHEVRVTRDLAHAKVYFTCF 57

Query: 64  LDVSPDRVISAL--NCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                      L       F+R  + + +R LR +P+L F YD S+     L+ L+    
Sbjct: 58  PSDEDTPAQERLLNKQLAGFLRHALAQEVR-LRAMPQLHFVYDESIAQGQHLSDLIEQ-A 115

Query: 122 IPVA 125
           +   
Sbjct: 116 VAKD 119


>gi|92115188|ref|YP_575116.1| ribosome-binding factor A [Chromohalobacter salexigens DSM 3043]
 gi|122419135|sp|Q1QSZ1|RBFA_CHRSD RecName: Full=Ribosome-binding factor A
 gi|91798278|gb|ABE60417.1| ribosome-binding factor A [Chromohalobacter salexigens DSM 3043]
          Length = 131

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/117 (29%), Positives = 63/117 (53%), Gaps = 7/117 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           +  +R  RV ++++  L  V++  E +D  +   ++++S V +S DL  A +YI+L  + 
Sbjct: 2   REFKRTDRVADQLQQELA-VLIQREIKDPRLG--MVTVSSVKVSRDLGYADIYITLLGEN 58

Query: 67  SPDRVISALN---CNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              R+   L        F+R +I   ++ LR+VPELRF YD S+    +L++L+   
Sbjct: 59  DAARIDENLKVLRHARGFLRSQIANRIK-LRHVPELRFHYDESVVRGQRLSSLIDEA 114


>gi|121998527|ref|YP_001003314.1| ribosome-binding factor A [Halorhodospira halophila SL1]
 gi|166218443|sp|A1WXV0|RBFA_HALHL RecName: Full=Ribosome-binding factor A
 gi|121589932|gb|ABM62512.1| ribosome-binding factor A [Halorhodospira halophila SL1]
          Length = 126

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/117 (30%), Positives = 62/117 (52%), Gaps = 6/117 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K+  R+ R+ E++R  L  VI  ++  D  +    ++ISEV +S DL  ATVY+++  
Sbjct: 1   MAKDYPRSRRIAEQLRRELAEVI-RDDVDDPRVGS--VTISEVQVSRDLAHATVYVTVLG 57

Query: 65  DVSPDRV--ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
             + +    I  LN    F+R ++ R +R  +  P LRF +DT+     +L+AL+  
Sbjct: 58  AEAAEAQAGIDILNKAHGFLRSQVARRIRA-KRTPSLRFLHDTAFDRGARLSALIDE 113


>gi|312885212|ref|ZP_07744891.1| ribosome-binding factor A [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309367152|gb|EFP94725.1| ribosome-binding factor A [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 136

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 64/126 (50%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVAQQLQKELALILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  + AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESCLEALREHEVHIRMMLGKRIR-LRLTPEVRFYYDNTLVEGMRMSNLV-SEVV 115

Query: 123 PVALEK 128
                K
Sbjct: 116 NQDKRK 121


>gi|289449941|ref|YP_003474588.1| ribosome-binding factor A [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289184488|gb|ADC90913.1| ribosome-binding factor A [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 137

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 62/132 (46%), Gaps = 17/132 (12%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SPD 69
           RA RVG++++  L  ++     +D+ +     +++ V ++ DL  AT YIS+  D  +  
Sbjct: 5   RAERVGDQIKRELSKILQRG-LKDQRVL-PFTAVTAVDVTNDLSHATCYISVLGDALAQK 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC-----LPKIP- 123
             +  L     ++R +I   +R LR VPEL F+ D S+Q   +++ L+        K+  
Sbjct: 63  NCLLGLQSASGYLRRQIAGLIR-LRIVPELHFKPDNSVQEGLRMDKLIDATLAADAKVRA 121

Query: 124 -------VALEK 128
                     E+
Sbjct: 122 QAATVADKDEER 133


>gi|89072576|ref|ZP_01159148.1| ribosome-binding factor A [Photobacterium sp. SKA34]
 gi|89051680|gb|EAR57133.1| ribosome-binding factor A [Photobacterium sp. SKA34]
          Length = 131

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 6/118 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS--L 62
             K   R  RV ++++  L  ++   E +D  I   + +IS V +S D+  A +Y++   
Sbjct: 1   MAKEFSRTQRVAQQLQKELAVILQR-EIKDPAI--AMTTISSVDVSRDMNYAKIYVTFFP 57

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             + + +  ++AL     +IR  +G+ +R LR  PEL F +D SL    +++ L+   
Sbjct: 58  IGEQTAEGSLAALREMAPYIRSLLGKEIR-LRVTPELNFIFDQSLTEGMRISNLVSKA 114


>gi|323491072|ref|ZP_08096264.1| ribosome-binding factor A [Vibrio brasiliensis LMG 20546]
 gi|323314736|gb|EGA67808.1| ribosome-binding factor A [Vibrio brasiliensis LMG 20546]
          Length = 136

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 64/126 (50%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVSQQLQKELALILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  + AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESCLEALREHEVHIRMMLGKRIR-LRLTPEVRFYYDNTLVEGMRMSNLV-SEVV 115

Query: 123 PVALEK 128
                K
Sbjct: 116 NEDKRK 121


>gi|315924371|ref|ZP_07920593.1| ribosome-binding factor A [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315622250|gb|EFV02209.1| ribosome-binding factor A [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 121

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-D 65
             S R  ++  +++  L  +I+  + +D+ +  + +SI+ V  + DL+VATVYIS+   +
Sbjct: 1   MASHRKEKIDAQIQRELS-LIIRQKTKDKRLHNNTLSITGVKATPDLKVATVYISVLGSE 59

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                V+ AL     F+R  +G+ ++    +PEL F+ D S+     ++A++       
Sbjct: 60  EDAQGVMEALKKAKGFLRSSLGKIMKT-HMIPELHFKRDESVAYGMHIDAILNELHQQE 117


>gi|329905068|ref|ZP_08273996.1| Ribosome-binding factor A [Oxalobacteraceae bacterium IMCC9480]
 gi|327547740|gb|EGF32516.1| Ribosome-binding factor A [Oxalobacteraceae bacterium IMCC9480]
          Length = 129

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 63/129 (48%), Gaps = 6/129 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M   +     R +RV ++++  L  ++   E +D  +   +I+++EV ++ D   A V+ 
Sbjct: 1   MAKHSKTIPVRGIRVADQIQRDLAEIVA-YELKDPRVG--MITVTEVQLTPDYAHAKVFF 57

Query: 61  SLPLDVSP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           ++  D        ++ L     FIRG++GR L ++  +PEL F +DTS     +L+ L+ 
Sbjct: 58  TMLSDDKEAIKNTVTGLKIASGFIRGQLGRRL-HVHTLPELHFVHDTSTARGMELSKLID 116

Query: 119 LPKIPVALE 127
                 A +
Sbjct: 117 EANATRAKD 125


>gi|260775408|ref|ZP_05884305.1| ribosome-binding factor A [Vibrio coralliilyticus ATCC BAA-450]
 gi|260608589|gb|EEX34754.1| ribosome-binding factor A [Vibrio coralliilyticus ATCC BAA-450]
          Length = 137

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 64/126 (50%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVSQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  + AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESCLKALREHEVHIRMMLGKRIR-LRLTPEIRFEYDNTLVEGMRMSNLV-SEVV 115

Query: 123 PVALEK 128
                K
Sbjct: 116 SEDKRK 121


>gi|210612469|ref|ZP_03289327.1| hypothetical protein CLONEX_01528 [Clostridium nexile DSM 1787]
 gi|210151577|gb|EEA82584.1| hypothetical protein CLONEX_01528 [Clostridium nexile DSM 1787]
          Length = 123

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 6/125 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV  EV+  L  +I     +D  +   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRVNGEVQRELSNII-RGGIKDPRV-APMTSVVAVEVAPDLKTCKAYISVLG 58

Query: 65  DVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D    +  I  L     +IR  + R L N+R  PE++F  D S+     ++ ++    + 
Sbjct: 59  DEKAQEDTIKGLQSAEGYIRRELARKL-NMRNTPEIKFVMDQSIAYGVAMSKMIDD--VT 115

Query: 124 VALEK 128
             L++
Sbjct: 116 RDLKE 120


>gi|51594833|ref|YP_069024.1| ribosome-binding factor A [Yersinia pseudotuberculosis IP 32953]
 gi|108806043|ref|YP_649959.1| ribosome-binding factor A [Yersinia pestis Antiqua]
 gi|108813399|ref|YP_649166.1| ribosome-binding factor A [Yersinia pestis Nepal516]
 gi|145600791|ref|YP_001164867.1| ribosome-binding factor A [Yersinia pestis Pestoides F]
 gi|153946906|ref|YP_001402549.1| ribosome-binding factor A [Yersinia pseudotuberculosis IP 31758]
 gi|153997272|ref|ZP_02022372.1| ribosome-binding factor A [Yersinia pestis CA88-4125]
 gi|161484875|ref|NP_668026.2| ribosome-binding factor A [Yersinia pestis KIM 10]
 gi|161511439|ref|NP_991981.2| ribosome-binding factor A [Yersinia pestis biovar Microtus str.
           91001]
 gi|162419142|ref|YP_001608287.1| ribosome-binding factor A [Yersinia pestis Angola]
 gi|165925682|ref|ZP_02221514.1| ribosome-binding factor A [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165936784|ref|ZP_02225351.1| ribosome-binding factor A [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166010165|ref|ZP_02231063.1| ribosome-binding factor A [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166214622|ref|ZP_02240657.1| ribosome-binding factor A [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167401225|ref|ZP_02306725.1| ribosome-binding factor A [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420727|ref|ZP_02312480.1| ribosome-binding factor A [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167423323|ref|ZP_02315076.1| ribosome-binding factor A [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|167470845|ref|ZP_02335549.1| ribosome-binding factor A [Yersinia pestis FV-1]
 gi|170025944|ref|YP_001722449.1| ribosome-binding factor A [Yersinia pseudotuberculosis YPIII]
 gi|186893842|ref|YP_001870954.1| ribosome-binding factor A [Yersinia pseudotuberculosis PB1/+]
 gi|218930509|ref|YP_002348384.1| ribosome-binding factor A [Yersinia pestis CO92]
 gi|229839147|ref|ZP_04459306.1| 30s ribosome binding factor [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229896636|ref|ZP_04511803.1| 30s ribosome binding factor [Yersinia pestis Pestoides A]
 gi|229899711|ref|ZP_04514852.1| 30s ribosome binding factor [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229903873|ref|ZP_04518986.1| 30s ribosome binding factor [Yersinia pestis Nepal516]
 gi|270489137|ref|ZP_06206211.1| ribosome-binding factor A [Yersinia pestis KIM D27]
 gi|294505372|ref|YP_003569434.1| ribosome-binding factor A [Yersinia pestis Z176003]
 gi|20978601|sp|Q8ZBC3|RBFA_YERPE RecName: Full=Ribosome-binding factor A
 gi|61214873|sp|Q66F59|RBFA_YERPS RecName: Full=Ribosome-binding factor A
 gi|122383880|sp|Q1CC08|RBFA_YERPA RecName: Full=Ribosome-binding factor A
 gi|122384217|sp|Q1CEL4|RBFA_YERPN RecName: Full=Ribosome-binding factor A
 gi|166199575|sp|A4TRI2|RBFA_YERPP RecName: Full=Ribosome-binding factor A
 gi|166918680|sp|A7FMS1|RBFA_YERP3 RecName: Full=Ribosome-binding factor A
 gi|226723614|sp|A9R5A4|RBFA_YERPG RecName: Full=Ribosome-binding factor A
 gi|238688456|sp|B1JLX9|RBFA_YERPY RecName: Full=Ribosome-binding factor A
 gi|238691363|sp|B2K2Q6|RBFA_YERPB RecName: Full=Ribosome-binding factor A
 gi|51588115|emb|CAH19721.1| ribosome-binding factor A [Yersinia pseudotuberculosis IP 32953]
 gi|108777047|gb|ABG19566.1| ribosome-binding factor A [Yersinia pestis Nepal516]
 gi|108777956|gb|ABG12014.1| ribosome-binding factor A [Yersinia pestis Antiqua]
 gi|115349120|emb|CAL22083.1| ribosome-binding factor A [Yersinia pestis CO92]
 gi|145212487|gb|ABP41894.1| ribosome-binding factor A [Yersinia pestis Pestoides F]
 gi|149288909|gb|EDM38989.1| ribosome-binding factor A [Yersinia pestis CA88-4125]
 gi|152958401|gb|ABS45862.1| ribosome-binding factor A [Yersinia pseudotuberculosis IP 31758]
 gi|162351957|gb|ABX85905.1| ribosome-binding factor A [Yersinia pestis Angola]
 gi|165915433|gb|EDR34043.1| ribosome-binding factor A [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165922294|gb|EDR39471.1| ribosome-binding factor A [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165991072|gb|EDR43373.1| ribosome-binding factor A [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166204197|gb|EDR48677.1| ribosome-binding factor A [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166961533|gb|EDR57554.1| ribosome-binding factor A [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167049250|gb|EDR60658.1| ribosome-binding factor A [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167057493|gb|EDR67239.1| ribosome-binding factor A [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169752478|gb|ACA69996.1| ribosome-binding factor A [Yersinia pseudotuberculosis YPIII]
 gi|186696868|gb|ACC87497.1| ribosome-binding factor A [Yersinia pseudotuberculosis PB1/+]
 gi|229679643|gb|EEO75746.1| 30s ribosome binding factor [Yersinia pestis Nepal516]
 gi|229687203|gb|EEO79278.1| 30s ribosome binding factor [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229695513|gb|EEO85560.1| 30s ribosome binding factor [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229700414|gb|EEO88446.1| 30s ribosome binding factor [Yersinia pestis Pestoides A]
 gi|262363438|gb|ACY60159.1| ribosome-binding factor A [Yersinia pestis D106004]
 gi|262367187|gb|ACY63744.1| ribosome-binding factor A [Yersinia pestis D182038]
 gi|270337641|gb|EFA48418.1| ribosome-binding factor A [Yersinia pestis KIM D27]
 gi|294355831|gb|ADE66172.1| ribosome-binding factor A [Yersinia pestis Z176003]
 gi|320013698|gb|ADV97269.1| 30s ribosome binding factor [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 136

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 63/131 (48%), Gaps = 12/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R+ RV +E++  +  ++   E +D  +   + ++S + +S DL  A V+++   
Sbjct: 1   MAKEFSRSQRVSQEMQKEIALILQR-EIKDPRVG--MATVSGIELSRDLAYAKVFVTFLN 57

Query: 64  ------LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                    +    I AL     +IR  +G+++R LR VPEL F YD SL    +++ L+
Sbjct: 58  VLTDNADPDTVKNGIKALQDASGYIRTLLGKAMR-LRIVPELTFAYDNSLIEGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               I   +E+
Sbjct: 117 SNV-IKNDVER 126


>gi|314933449|ref|ZP_07840814.1| ribosome-binding factor A [Staphylococcus caprae C87]
 gi|313653599|gb|EFS17356.1| ribosome-binding factor A [Staphylococcus caprae C87]
          Length = 116

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 63/115 (54%), Gaps = 5/115 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA RVGE+++  +M + +NN+ +D  +    ++I++V ++ DL  A VY+++    
Sbjct: 1   MSNMRAERVGEQMKQEIMDI-VNNKVKDPRVG--FLTITDVELTNDLSHAKVYLTVLGSN 57

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              D    AL     FI+  +G  +R LR +P+L F YD S++   K+  ++   
Sbjct: 58  KEIDNTFKALEKAKGFIKSELGSRMR-LRIIPDLTFEYDKSIEYGNKIERMIQDL 111


>gi|91788292|ref|YP_549244.1| ribosome-binding factor A [Polaromonas sp. JS666]
 gi|123164888|sp|Q12AU6|RBFA_POLSJ RecName: Full=Ribosome-binding factor A
 gi|91697517|gb|ABE44346.1| ribosome-binding factor A [Polaromonas sp. JS666]
          Length = 122

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 54/120 (45%), Gaps = 6/120 (5%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+ K+     R  RV ++++  L  +I   E +D  +   +++I  V ++ D   A V+ 
Sbjct: 1   MRKKSSTP-NRGFRVADQIQRDLTELIAR-ELKDPRVG--MVTIQAVEVTPDYAHAKVFF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           S+     P     ALN    F+R  + + L     VP L F +D + +    +NAL+   
Sbjct: 57  SVL-VGDPKACEEALNQAAGFLRNGLFKRLMT-HTVPTLHFHFDRTTERAADMNALIAKA 114


>gi|73662804|ref|YP_301585.1| ribosome-binding factor A [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|123642449|sp|Q49X58|RBFA_STAS1 RecName: Full=Ribosome-binding factor A
 gi|72495319|dbj|BAE18640.1| ribosome-binding factor A [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 114

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 60/111 (54%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD- 69
           RA RVGE+++  +M +  NN+ +D  I    ++I++V ++ DL +ATVY+++  +     
Sbjct: 4   RAERVGEQMKQEIMDI-ANNKVKDPRIG--FLTITDVQLTNDLSIATVYLTVLGNEKQKA 60

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                L     FI+  +G  +R LR +PEL F YD S+    K+  ++   
Sbjct: 61  DTFKGLEKAKGFIKSELGSRMR-LRIIPELNFEYDESIDYGNKIERMIQDL 110


>gi|297617189|ref|YP_003702348.1| ribosome-binding factor A [Syntrophothermus lipocalidus DSM 12680]
 gi|297145026|gb|ADI01783.1| ribosome-binding factor A [Syntrophothermus lipocalidus DSM 12680]
          Length = 126

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 60/122 (49%), Gaps = 3/122 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            +SRR  R+ EE++  L  +      +D  I    +SI+ V +S DL  A V++S+  D 
Sbjct: 1   MSSRRQERLAEEIKRGLSALFFEG-LKDPGIDPRAVSITRVDVSRDLSYARVHVSVLGDE 59

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                 ++AL     FIR  +   L NLR+ PE+ F+ D S++   ++ A++   K    
Sbjct: 60  KKCRDTMAALERARGFIRSVLAGEL-NLRHAPEIVFQMDKSIEHGVRIAAILNELKAQEK 118

Query: 126 LE 127
            E
Sbjct: 119 RE 120


>gi|148240554|ref|YP_001225941.1| ribosome-binding factor A [Synechococcus sp. WH 7803]
 gi|166219413|sp|A5GNX9|RBFA_SYNPW RecName: Full=Ribosome-binding factor A
 gi|147849093|emb|CAK24644.1| Ribosome-binding factor A [Synechococcus sp. WH 7803]
          Length = 140

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 3/119 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP-LD 65
              RR  RV   +R     ++++   +D  + + +ISI++V +S DL+   +++S+    
Sbjct: 2   APGRRVERVAALIRKETSELLMHG-IRDDRVHQGLISITQVDVSGDLQHCKIFVSVLADP 60

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               +V+  L     F+RG +GR L  +R  PE+ F  D  L+    +  L+   +   
Sbjct: 61  EGRAQVMEGLQAASSFLRGELGRRL-QMRRAPEVVFHLDRGLEKGASVLGLLGDLERER 118


>gi|87125212|ref|ZP_01081058.1| Ribosome-binding factor A [Synechococcus sp. RS9917]
 gi|86166981|gb|EAQ68242.1| Ribosome-binding factor A [Synechococcus sp. RS9917]
          Length = 136

 Score =  100 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 57/119 (47%), Gaps = 3/119 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
              RR  RV   +R     ++++   +D  + + ++SI+EV +S DL+   +++S+  + 
Sbjct: 2   APGRRVERVAALIRRETSELLIHG-IRDERVHQGMVSITEVEVSGDLQHCKIFVSIYGED 60

Query: 67  -SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                V+  L     ++RG +GR L  +R  PE+ F+ D  ++    +  L+   +   
Sbjct: 61  ADKQNVLEGLKAASGYLRGELGRRL-QMRRAPEVVFQLDRGIEKGTTVLHLLNRLEEER 118


>gi|255319711|ref|ZP_05360919.1| ribosome-binding factor A [Acinetobacter radioresistens SK82]
 gi|262380007|ref|ZP_06073162.1| ribosome-binding factor A [Acinetobacter radioresistens SH164]
 gi|255303240|gb|EET82449.1| ribosome-binding factor A [Acinetobacter radioresistens SK82]
 gi|262298201|gb|EEY86115.1| ribosome-binding factor A [Acinetobacter radioresistens SH164]
          Length = 132

 Score =  100 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 32/132 (24%), Positives = 58/132 (43%), Gaps = 16/132 (12%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD--- 65
           S+R  R+G+ V+  L   ++  E +D  +   +++IS V +S DL  A VY+++      
Sbjct: 4   SQRLKRMGDSVQRELSE-LIRQELKDPRLGG-LVTISAVKVSPDLGYADVYVTVMGRELS 61

Query: 66  -----VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL- 119
                 +  + +  LN    F+R  + R ++  R  P LRF YD +      +  L+   
Sbjct: 62  DDQNEQAHQQTLEVLNKASGFLRQELSRRIKT-RITPRLRFHYDKTNAYGNYMFGLIAEA 120

Query: 120 ----PKIPVALE 127
               P+     E
Sbjct: 121 VKDLPERKEDEE 132


>gi|116073898|ref|ZP_01471160.1| ribosome-binding factor A [Synechococcus sp. RS9916]
 gi|116069203|gb|EAU74955.1| ribosome-binding factor A [Synechococcus sp. RS9916]
          Length = 133

 Score =  100 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 58/121 (47%), Gaps = 3/121 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
              RR  RV   +R     +++N   +D  + + ++SI+EV +S DL+   +++S+  + 
Sbjct: 2   APGRRVERVAALIRRETSELLING-IRDERVHQGMVSITEVEVSGDLQHCKIFVSIYSEE 60

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
               +V+  L     ++RG +GR L  +R  PE+ F+ D  ++    +  L+   +    
Sbjct: 61  EQRQQVLEGLQAASGYLRGELGRRL-QMRRAPEVVFQLDRGIEKGTSVLNLLNRLEDERE 119

Query: 126 L 126
            
Sbjct: 120 E 120


>gi|167630360|ref|YP_001680859.1| ribosome-binding factor a [Heliobacterium modesticaldum Ice1]
 gi|238687990|sp|B0THR5|RBFA_HELMI RecName: Full=Ribosome-binding factor A
 gi|167593100|gb|ABZ84848.1| ribosome-binding factor a [Heliobacterium modesticaldum Ice1]
          Length = 121

 Score =  100 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 39/119 (32%), Positives = 62/119 (52%), Gaps = 5/119 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP- 68
            R  R+ EE++  L   +L +E +D  +    +SI+ V +S D R A VY+S+  D S  
Sbjct: 4   HRMARMAEEIKRELAR-LLRDEMKDPRLG--FVSITAVEVSGDGRHAKVYVSVMGDESAR 60

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           D   +AL     F+R  + +SLR +RYVPEL F  D S++   ++  L+   +     E
Sbjct: 61  DNSQAALKQATGFLRTELSKSLR-VRYVPELVFLSDLSIERGTRIARLLTEMENHDDAE 118


>gi|32033693|ref|ZP_00133988.1| COG0858: Ribosome-binding factor A [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126208122|ref|YP_001053347.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae L20]
 gi|165976052|ref|YP_001651645.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|190149950|ref|YP_001968475.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|303249645|ref|ZP_07335850.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|303253710|ref|ZP_07339847.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|307245496|ref|ZP_07527583.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|307247610|ref|ZP_07529653.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|307249839|ref|ZP_07531815.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|307252191|ref|ZP_07534089.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|307254450|ref|ZP_07536287.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|307256662|ref|ZP_07538441.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|307258909|ref|ZP_07540640.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|307261097|ref|ZP_07542776.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|307263278|ref|ZP_07544896.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
 gi|166218414|sp|A3N006|RBFA_ACTP2 RecName: Full=Ribosome-binding factor A
 gi|238687490|sp|B0BNR6|RBFA_ACTPJ RecName: Full=Ribosome-binding factor A
 gi|238692383|sp|B3H164|RBFA_ACTP7 RecName: Full=Ribosome-binding factor A
 gi|126096914|gb|ABN73742.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           5b str. L20]
 gi|165876153|gb|ABY69201.1| ribosome binding factor A [Actinobacillus pleuropneumoniae serovar
           3 str. JL03]
 gi|189915081|gb|ACE61333.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           7 str. AP76]
 gi|302647435|gb|EFL77654.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           2 str. 4226]
 gi|302651457|gb|EFL81608.1| ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306853555|gb|EFM85773.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           1 str. 4074]
 gi|306855880|gb|EFM88040.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           2 str. S1536]
 gi|306858141|gb|EFM90221.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           4 str. M62]
 gi|306860335|gb|EFM92350.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           6 str. Femo]
 gi|306862591|gb|EFM94548.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           9 str. CVJ13261]
 gi|306864710|gb|EFM96614.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           10 str. D13039]
 gi|306866933|gb|EFM98790.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           11 str. 56153]
 gi|306869229|gb|EFN01027.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           12 str. 1096]
 gi|306871340|gb|EFN03066.1| Ribosome-binding factor A [Actinobacillus pleuropneumoniae serovar
           13 str. N273]
          Length = 127

 Score =  100 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/127 (26%), Positives = 65/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MSREFKRSDRVAQELQKEIAVILQR-EVKDPRIG--MVTVSDVEVSRDLAYAKIFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +   +  L     +IR  +G+++R LR VPELRF YD SL    +++ L+    
Sbjct: 58  DNDQSVIEQGMKGLEKASPYIRSLVGKAMR-LRIVPELRFIYDQSLVEGMRMSNLVSNV- 115

Query: 122 IPVALEK 128
           I     K
Sbjct: 116 IKNDEAK 122


>gi|313894756|ref|ZP_07828316.1| ribosome-binding factor A [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|312976437|gb|EFR41892.1| ribosome-binding factor A [Selenomonas sp. oral taxon 137 str.
           F0430]
          Length = 124

 Score =  100 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 58/115 (50%), Gaps = 5/115 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           R  +V E ++  +  +IL ++ +D  I    ++++ V  + DLR A +Y+S+  D     
Sbjct: 5   RVEKVQELMKQEISDIIL-HDLKDPRIG--FVTVTSVACTEDLREAKIYVSVMGDEKGVQ 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             ++ LN  + ++R  IGR +R LR+ PE+ F  DTSL     +  ++       
Sbjct: 62  ESLAGLNRALGYVRREIGRRIR-LRFTPEISFALDTSLNYSDHIQRILNTLHEEK 115


>gi|282880568|ref|ZP_06289275.1| ribosome-binding factor A [Prevotella timonensis CRIS 5C-B1]
 gi|281305671|gb|EFA97724.1| ribosome-binding factor A [Prevotella timonensis CRIS 5C-B1]
          Length = 111

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +  +     R     ++S++ V +S DL V T Y+S+      D 
Sbjct: 5   RQNRIARLLQKELAIIFQSQT---RATHGVMVSVTRVRVSPDLSVCTAYLSIFPSEKGDE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +N N K IR  +G  +RN LR +PELRF  D SL     ++ L+  
Sbjct: 62  ILENINKNNKSIRYELGSRMRNQLRIIPELRFFIDDSLDYIEHIDELLKK 111


>gi|228998587|ref|ZP_04158174.1| Ribosome-binding factor A [Bacillus mycoides Rock3-17]
 gi|229006087|ref|ZP_04163775.1| Ribosome-binding factor A [Bacillus mycoides Rock1-4]
 gi|228755163|gb|EEM04520.1| Ribosome-binding factor A [Bacillus mycoides Rock1-4]
 gi|228761055|gb|EEM10014.1| Ribosome-binding factor A [Bacillus mycoides Rock3-17]
          Length = 111

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 62/115 (53%), Gaps = 7/115 (6%)

Query: 15  VGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VSPDRVIS 73
           +GE+++  L  +I   + +D  I    +++++V +S DL++A VYIS+  D    +  + 
Sbjct: 1   MGEQMKKELGEIISR-KIKDPRIG--FVTVTDVQVSGDLQIAKVYISVLGDEQQKENTLK 57

Query: 74  ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
            L     FIR  IG+ +R LR  PE+ F +D S+    +++ L+   +I    ++
Sbjct: 58  GLAKAKGFIRAEIGQRIR-LRKTPEITFEFDESIAYGHRIDTLLH--EINKDGKR 109


>gi|110833191|ref|YP_692050.1| ribosome-binding factor A [Alcanivorax borkumensis SK2]
 gi|122959683|sp|Q0VSS0|RBFA_ALCBS RecName: Full=Ribosome-binding factor A
 gi|110646302|emb|CAL15778.1| ribosome-binding factor A [Alcanivorax borkumensis SK2]
          Length = 137

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 7/128 (5%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           +++ P+   R  RV ++++  L   +L  E +D  ++  + +I +V +S DL  A VY +
Sbjct: 3   RHRRPQGFNRTDRVADQIQRELSR-LLQFEMKDPRVN--LATIQDVTVSRDLSYAEVYFT 59

Query: 62  LPLDVSPDRVISA--LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           L          +   L     F+R  + + L N R  P+LRF YD + +    L+ L+  
Sbjct: 60  LLGQGEEAGAEAEEVLTKASGFLRSSLAQGL-NTRTTPKLRFHYDMTPERAAHLSQLIDE 118

Query: 120 PKIPVALE 127
            +     E
Sbjct: 119 AR-AEDRE 125


>gi|269103406|ref|ZP_06156103.1| ribosome-binding factor A [Photobacterium damselae subsp. damselae
           CIP 102761]
 gi|268163304|gb|EEZ41800.1| ribosome-binding factor A [Photobacterium damselae subsp. damselae
           CIP 102761]
          Length = 133

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 61/125 (48%), Gaps = 8/125 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E ++  +   + +IS V +S D+  A VY++   
Sbjct: 1   MAKEFSRTQRVAQQLQKELAVILQR-ELKEPRL--AMTTISSVEVSRDMGYAKVYVTFFA 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             D S +  ++ L     +IR  +G+ +R LR  PEL F +D SL    +++ L+   K+
Sbjct: 58  IGDQSEEESLAILREKAPYIRSLLGKQIR-LRVTPELTFIFDQSLTEGMRISNLVS--KV 114

Query: 123 PVALE 127
               E
Sbjct: 115 VRDDE 119


>gi|150003447|ref|YP_001298191.1| ribosome-binding factor A [Bacteroides vulgatus ATCC 8482]
 gi|212695394|ref|ZP_03303522.1| hypothetical protein BACDOR_04943 [Bacteroides dorei DSM 17855]
 gi|237711569|ref|ZP_04542050.1| ribosome-binding factor A [Bacteroides sp. 9_1_42FAA]
 gi|254881255|ref|ZP_05253965.1| ribosome-binding factor A [Bacteroides sp. 4_3_47FAA]
 gi|265752997|ref|ZP_06088566.1| ribosome-binding factor A [Bacteroides sp. 3_1_33FAA]
 gi|294777671|ref|ZP_06743122.1| ribosome-binding factor A [Bacteroides vulgatus PC510]
 gi|319640257|ref|ZP_07994982.1| ribosome-binding factor A [Bacteroides sp. 3_1_40A]
 gi|149931871|gb|ABR38569.1| ribosome-binding factor A [Bacteroides vulgatus ATCC 8482]
 gi|212662029|gb|EEB22603.1| hypothetical protein BACDOR_04943 [Bacteroides dorei DSM 17855]
 gi|229454264|gb|EEO59985.1| ribosome-binding factor A [Bacteroides sp. 9_1_42FAA]
 gi|254834048|gb|EET14357.1| ribosome-binding factor A [Bacteroides sp. 4_3_47FAA]
 gi|263236183|gb|EEZ21678.1| ribosome-binding factor A [Bacteroides sp. 3_1_33FAA]
 gi|294448739|gb|EFG17288.1| ribosome-binding factor A [Bacteroides vulgatus PC510]
 gi|317388032|gb|EFV68886.1| ribosome-binding factor A [Bacteroides sp. 3_1_40A]
          Length = 111

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 60/114 (52%), Gaps = 4/114 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + ++  ++S+S V +S D+ +A VY+S+    
Sbjct: 1   METTRQNKISRLIQKELSEIFL---LQTKSMNGVLVSVSAVRISPDMSIARVYLSVFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
               ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL    +++ L+  
Sbjct: 58  RSQEIVKNINDNMKSIRYELGTRVRHQLRIIPELKFFVDDSLDYAERIDELLKK 111


>gi|15602622|ref|NP_245694.1| ribosome-binding factor A [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|13431798|sp|P57872|RBFA_PASMU RecName: Full=Ribosome-binding factor A
 gi|12721055|gb|AAK02841.1| RbfA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 132

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 64/124 (51%), Gaps = 8/124 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A V+++   
Sbjct: 1   MAREFKRSDRVAQEIQKEIAVILQR-EVKDPRIG--MVTVSDVEVSSDLAYAKVFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D     +   +  L     +IR  +G+++R LR VPE+RF YD SL    +++ L+    
Sbjct: 58  DNDESAIDAGMKGLEKASPYIRSLLGKAMR-LRIVPEIRFIYDRSLIEGMRMSNLVSNV- 115

Query: 122 IPVA 125
           I   
Sbjct: 116 IRED 119


>gi|330685669|gb|EGG97310.1| ribosome-binding factor A [Staphylococcus epidermidis VCU121]
          Length = 116

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 34/118 (28%), Positives = 63/118 (53%), Gaps = 5/118 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA RVGE+++  +M + +NN+ +D  +    I+I++V ++ DL    VY+++  + 
Sbjct: 1   MSNMRAERVGEQMKKEIMDI-VNNKVKDPRVG--FITITDVELTNDLSQGKVYLTVLGNQ 57

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
              D    AL     FI+  +G  +R LR +PEL F YD S++   K+  ++      
Sbjct: 58  KEVDNTFKALEKAKGFIKSELGSRMR-LRIIPELSFEYDESIEYGNKIERMIQDLHKQ 114


>gi|315652144|ref|ZP_07905142.1| ribosome-binding factor A [Eubacterium saburreum DSM 3986]
 gi|315485636|gb|EFU76020.1| ribosome-binding factor A [Eubacterium saburreum DSM 3986]
          Length = 123

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 60/123 (48%), Gaps = 5/123 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS ++  +  EV   +  +I   E +D  ++    S+++  ++ DL+ AT+Y+S+  
Sbjct: 1   MRKNSLKSTMINSEVMKTVSEII-RGEVKDPRVAPVT-SVTDAEVTTDLKYATIYVSVLG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D     + +  L  +  FIR  + R L NLR  PEL+F  D SL    K++ L+    I 
Sbjct: 59  DDEQSKKTLLGLKSSAGFIRKELARRL-NLRNTPELKFVLDESLAYGMKMDKLIDEV-IK 116

Query: 124 VAL 126
              
Sbjct: 117 KDE 119


>gi|304437174|ref|ZP_07397135.1| ribosome-binding factor A [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369836|gb|EFM23500.1| ribosome-binding factor A [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 136

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 58/111 (52%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           R  +V E ++  +  +I  NE +D  I    ++++ V  + DLR A +Y+S+  D     
Sbjct: 18  RVEKVQELMKQEVSDIIF-NELKDPRIG--FVTVTSVACTEDLREAKIYVSVMGDEKKAR 74

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             ++ LN ++ F+R  IG+ +R LR+ PE+ F  DTSL     +  L+   
Sbjct: 75  DTLNGLNSSLGFVRREIGKRIR-LRFTPEISFSLDTSLNYSDHIQRLLNEI 124


>gi|253580819|ref|ZP_04858082.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847889|gb|EES75856.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 131

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 59/116 (50%), Gaps = 4/116 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I  NE +D  I   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRINGEVQKELSTII-RNEIKDPRIH-PMTSVMAVEVAPDLKTCRAYISVLG 58

Query: 65  DVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           +    +  I  LN    +IR ++ R+L NLR  PE+RF  D S++    ++ L+  
Sbjct: 59  EKEAKEATIKGLNSAEGYIRRQLARNL-NLRNTPEIRFILDESIEYGVNMSKLIDD 113


>gi|294674933|ref|YP_003575549.1| ribosome-binding factor A [Prevotella ruminicola 23]
 gi|294472925|gb|ADE82314.1| ribosome-binding factor A [Prevotella ruminicola 23]
          Length = 111

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  ++   ++  L  +        R     +IS++   +S DL + T Y+S+      + 
Sbjct: 5   RQNKIARLLQKELSLIFQQQT---RATHGVMISVTRTKISPDLSICTAYLSVFPSEKGEE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           +++ +N N K IR  +G  +RN +R +PELRF  D SL     ++ L+  
Sbjct: 62  ILTNINANTKQIRYELGTRVRNQMRIIPELRFFIDDSLDYIEHIDELLKK 111


>gi|268316869|ref|YP_003290588.1| ribosome-binding factor A [Rhodothermus marinus DSM 4252]
 gi|262334403|gb|ACY48200.1| ribosome-binding factor A [Rhodothermus marinus DSM 4252]
          Length = 126

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 29/111 (26%), Positives = 53/111 (47%), Gaps = 5/111 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S R  RVG  ++  L  ++    F+       + ++++V  + DL +A VY+S+      
Sbjct: 4   SIRVQRVGSLLKRELADILQ---FEFGDQLPPMTTVTDVQPTRDLSIAKVYVSIYGTPEQ 60

Query: 69  DRV-ISALNCNIKFIRGRIGRSLR-NLRYVPELRFRYDTSLQSYWKLNALM 117
            R     L      IR  + + +R  LR++PELRF  D +L+   ++  L+
Sbjct: 61  KRAAFRRLQELTPQIRAALAQRIRYQLRFMPELRFVLDETLERAQRVEELL 111


>gi|260221432|emb|CBA29990.1| Ribosome-binding factor A [Curvibacter putative symbiont of Hydra
           magnipapillata]
          Length = 122

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+ K+     R+ +V ++++  L  +I   E +D  +   +++I  V ++ D   A V+ 
Sbjct: 1   MRKKSATP-NRSFQVADQIQRDLAELIAR-ELKDPRVG--MVTIQGVEVTPDYAHAKVFF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           SL     P      LN    F+R  + + L ++  VP L F +D + +    +NAL+   
Sbjct: 57  SLL-VGDPVETAEGLNQAAGFLRAGLFKRL-HIHTVPTLHFIFDQTTERAADMNALIARA 114

Query: 121 KIPVALE 127
               A E
Sbjct: 115 VSSRAKE 121


>gi|163802305|ref|ZP_02196199.1| ribosome-binding factor A [Vibrio sp. AND4]
 gi|159173834|gb|EDP58648.1| ribosome-binding factor A [Vibrio sp. AND4]
          Length = 135

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 64/126 (50%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  +   +++IS+V  S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVSQQLQKELAMILQR-EVRDSRLG--MVTISDVEASRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESCLAALREHEVHIRMMLGKRIR-LRLTPEIRFYYDNTLVEGMRMSNLV-SEVV 115

Query: 123 PVALEK 128
                K
Sbjct: 116 SEDKRK 121


>gi|332160080|ref|YP_004296657.1| ribosome-binding factor A [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318607360|emb|CBY28858.1| ribosome-binding factor A [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325664310|gb|ADZ40954.1| ribosome-binding factor A [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330862025|emb|CBX72192.1| ribosome-binding factor A [Yersinia enterocolitica W22703]
          Length = 136

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 63/131 (48%), Gaps = 12/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R+ RV +E++  +  ++   E +D  +   + ++S + +S DL  A V+++   
Sbjct: 1   MAKEFSRSQRVSQEMQKEIALILQR-EIKDPRVG--MATVSGIELSRDLAYAKVFVTFLN 57

Query: 64  ------LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                    +    I AL     +IR  +G+++R LR VPEL F YD SL    +++ L+
Sbjct: 58  VLTDNADPDTAKNGIKALQDASGYIRTLLGKAMR-LRIVPELTFAYDNSLIEGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               I   +E+
Sbjct: 117 TNV-IKNDVER 126


>gi|153938139|ref|YP_001391715.1| ribosome-binding factor A [Clostridium botulinum F str. Langeland]
 gi|168180704|ref|ZP_02615368.1| ribosome-binding factor A [Clostridium botulinum NCTC 2916]
 gi|168184623|ref|ZP_02619287.1| ribosome-binding factor A [Clostridium botulinum Bf]
 gi|237795853|ref|YP_002863405.1| ribosome-binding factor A [Clostridium botulinum Ba4 str. 657]
 gi|166218433|sp|A7GG05|RBFA_CLOBL RecName: Full=Ribosome-binding factor A
 gi|259551954|sp|C3L0B5|RBFA_CLOB6 RecName: Full=Ribosome-binding factor A
 gi|152934035|gb|ABS39533.1| ribosome-binding factor A [Clostridium botulinum F str. Langeland]
 gi|182668591|gb|EDT80570.1| ribosome-binding factor A [Clostridium botulinum NCTC 2916]
 gi|182672289|gb|EDT84250.1| ribosome-binding factor A [Clostridium botulinum Bf]
 gi|229261048|gb|ACQ52081.1| ribosome-binding factor A [Clostridium botulinum Ba4 str. 657]
 gi|295319742|gb|ADG00120.1| ribosome-binding factor A [Clostridium botulinum F str. 230613]
          Length = 120

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 63/115 (54%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA R+ EEV+  +  +I  N+ +D  +   ++S+++V ++ DL+ A VY+S+  +    +
Sbjct: 5   RAGRINEEVKKEVSNIIH-NDIKDPRL-SAMVSVTDVNVTKDLKYAKVYVSIFGNEKAKE 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             + AL  ++ FIR  +GR ++ LR  PE+    D S++    ++ L+   K   
Sbjct: 63  ESLQALKSSVGFIRKEVGRRVK-LRNTPEVIIEVDNSIERGMHIDELLHSIKENE 116


>gi|160880904|ref|YP_001559872.1| ribosome-binding factor A [Clostridium phytofermentans ISDg]
 gi|189039535|sp|A9KNW3|RBFA_CLOPH RecName: Full=Ribosome-binding factor A
 gi|160429570|gb|ABX43133.1| ribosome-binding factor A [Clostridium phytofermentans ISDg]
          Length = 136

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 38/116 (32%), Positives = 60/116 (51%), Gaps = 4/116 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+ +EV+  L  +I   E +D  I   + SI  V ++ DL+ A VYIS+  
Sbjct: 1   MRKNSIKNTRINQEVQKELSMLISR-ELKDPRI-NPMTSIVAVEVAPDLKTAKVYISVLG 58

Query: 65  DV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           D  S    ++ L     F+RG++ R + NLR  PEL F  D S++    ++ L+  
Sbjct: 59  DELSQKNTLAGLKSAAPFLRGQLARGI-NLRNTPELLFVVDQSIEYGVSMSKLINE 113


>gi|15672750|ref|NP_266924.1| ribosome-binding factor A [Lactococcus lactis subsp. lactis Il1403]
 gi|281491264|ref|YP_003353244.1| ribosome-binding factor A [Lactococcus lactis subsp. lactis KF147]
 gi|13878682|sp|Q9CHG3|RBFA_LACLA RecName: Full=Ribosome-binding factor A
 gi|12723686|gb|AAK04866.1|AE006310_8 ribosome-binding factor A [Lactococcus lactis subsp. lactis Il1403]
 gi|281375005|gb|ADA64523.1| Ribosome-binding factor A [Lactococcus lactis subsp. lactis KF147]
          Length = 119

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 56/114 (49%), Gaps = 6/114 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
            NS R+ RV  E++  +  ++  N+ +D  +    I+  +V ++ DL  ATVY SL  + 
Sbjct: 2   GNSFRSDRVAVEIQREINDIL-RNKVRDPRVQDVNIT--DVQLTGDLSQATVYYSLLSNL 58

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
               ++  +AL       +  + + +   + +P+L F  D S++   K++ L+ 
Sbjct: 59  ASDNEKAATALKKATGLFKSELAKRMTIFK-IPDLTFAKDESVEYGSKIDELLR 111


>gi|21673081|ref|NP_661146.1| ribosome-binding factor A [Chlorobium tepidum TLS]
 gi|25453243|sp|Q8KFT0|RBFA_CHLTE RecName: Full=Ribosome-binding factor A
 gi|21646152|gb|AAM71488.1| ribosome-binding factor A [Chlorobium tepidum TLS]
          Length = 120

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 54/122 (44%), Gaps = 6/122 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-S 67
           S R  +V   ++  L  +      +    S  +++++EV M+ DL +A VY+S+      
Sbjct: 2   SIRTDKVSSLLQRELSAIFEKELPR----SGPLVTVTEVRMTADLGIARVYVSVIGSEAQ 57

Query: 68  PDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
              V+  L+   K IR  +   +R+  R +PEL F  D   +   ++  L+   K     
Sbjct: 58  RAEVMEYLDAENKMIRKTLSAKIRHQFRRIPELEFYEDRLFEQANRIEQLLKSVKPARDE 117

Query: 127 EK 128
           E+
Sbjct: 118 EQ 119


>gi|170076709|ref|YP_001733347.1| ribosome-binding factor A [Synechococcus sp. PCC 7002]
 gi|238692796|sp|B1XLD1|RBFA_SYNP2 RecName: Full=Ribosome-binding factor A
 gi|169884378|gb|ACA98091.1| ribosome-binding factor A [Synechococcus sp. PCC 7002]
          Length = 131

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 61/118 (51%), Gaps = 3/118 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            NSRR  +V   ++  +  +++  + +D  +   ++SI+EV +S DL+ A +++S+    
Sbjct: 2   ANSRRVSKVSSLIKREVSLMLMQ-DIKDDRVGAGMVSITEVEVSGDLQHAKIFVSIYGSE 60

Query: 67  SPD-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                 +  L  +  F+R  +G+ +R LR  PE+ F  D SL+   ++  L+   +I 
Sbjct: 61  EARAETMEGLRASQGFVRRTLGQRIR-LRRSPEVLFIEDRSLEEGDRMIHLINQLEIK 117


>gi|119774099|ref|YP_926839.1| ribosome-binding factor A [Shewanella amazonensis SB2B]
 gi|166219403|sp|A1S463|RBFA_SHEAM RecName: Full=Ribosome-binding factor A
 gi|119766599|gb|ABL99169.1| ribosome-binding factor A [Shewanella amazonensis SB2B]
          Length = 137

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 64/125 (51%), Gaps = 8/125 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             +   R  R+G++++  L +V+   + +D  I   ++++++V +S DL  A VY++   
Sbjct: 1   MAREFSRTRRIGQQLQQELAFVLQR-DMKDPRIG--MVTVNDVDVSRDLSHAKVYVTFFE 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 +  ++ALN    + R  +   ++ LR +PELRF YD SL    +++ L+   K+
Sbjct: 58  EDPQVIEAKLAALNTAAPYARTLVAGRMK-LRVMPELRFIYDASLVEGMRMSNLVS--KV 114

Query: 123 PVALE 127
               E
Sbjct: 115 IRDDE 119


>gi|239636252|ref|ZP_04677254.1| ribosome-binding factor A [Staphylococcus warneri L37603]
 gi|239597607|gb|EEQ80102.1| ribosome-binding factor A [Staphylococcus warneri L37603]
          Length = 116

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 34/118 (28%), Positives = 64/118 (54%), Gaps = 5/118 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA RVGE+++  +M + +NN+ +D  +    I+I++V ++ DL    VY+++  + 
Sbjct: 1   MSNMRAERVGEQMKKEIMDI-VNNKVKDPRVG--FITITDVELTNDLSQGKVYLTVLGNQ 57

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
              D    AL+    FI+  +G  +R LR +PEL F YD S++   K+  ++      
Sbjct: 58  KEVDNTFKALDKAKGFIKSELGSRMR-LRIIPELSFEYDESIEYGNKIERMIQDLHKQ 114


>gi|86131462|ref|ZP_01050060.1| Ribosome-binding factor A [Dokdonia donghaensis MED134]
 gi|85817907|gb|EAQ39075.1| Ribosome-binding factor A [Dokdonia donghaensis MED134]
          Length = 130

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 54/113 (47%), Gaps = 2/113 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S R  +V   ++  L  V+  N  +D      ++S+++V +  DL +A VY+S+  + 
Sbjct: 1   MESNRQKKVAGVLQKDLAEVL-QNALRDSGQGGIIVSVTKVKVPTDLSIAKVYLSIFPND 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
               ++  +N     IR  I +  R+ LR +PEL+F  D +L+    +   + 
Sbjct: 60  KATEILKEVNQVKPIIRHNISQRTRHQLRRMPELQFYIDDTLEYLDGIERSLK 112


>gi|237725978|ref|ZP_04556459.1| ribosome-binding factor A [Bacteroides sp. D4]
 gi|229435786|gb|EEO45863.1| ribosome-binding factor A [Bacteroides dorei 5_1_36/D4]
          Length = 111

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 60/114 (52%), Gaps = 4/114 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + ++  ++S+S V ++ D+ +A VY+S+    
Sbjct: 1   METTRQNKISRLIQKELSEIFL---LQTKSMNGVLVSVSAVRITPDMSIARVYLSVFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
               ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL    +++ L+  
Sbjct: 58  RSQEIVKNINDNMKSIRYELGTRVRHQLRIIPELKFFVDDSLDYAERIDELLKK 111


>gi|121609700|ref|YP_997507.1| ribosome-binding factor A [Verminephrobacter eiseniae EF01-2]
 gi|166199573|sp|A1WLI2|RBFA_VEREI RecName: Full=Ribosome-binding factor A
 gi|121554340|gb|ABM58489.1| ribosome-binding factor A [Verminephrobacter eiseniae EF01-2]
          Length = 120

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 6/123 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K S RA +V ++++  L  ++     +D  +   ++++  V +S D   A V+ SL  
Sbjct: 3   GKKPSHRAFKVADQIQRDLTQLLAR--LKDPRLG--LVTLQGVEISPDYAHAKVFFSLL- 57

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             +P++  +AL+    F+R  + + L  +  VP L F +D S +    +NAL+       
Sbjct: 58  TGTPEQTQAALDQAAGFLRNGLFKRL-QIHTVPTLHFVFDRSCERAADMNALIAKAVSTR 116

Query: 125 ALE 127
           A E
Sbjct: 117 AKE 119


>gi|118579400|ref|YP_900650.1| ribosome-binding factor A [Pelobacter propionicus DSM 2379]
 gi|166219384|sp|A1AMM2|RBFA_PELPD RecName: Full=Ribosome-binding factor A
 gi|118502110|gb|ABK98592.1| ribosome-binding factor A [Pelobacter propionicus DSM 2379]
          Length = 122

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 57/120 (47%), Gaps = 5/120 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R+ ++ E +   +  ++      D  I    ++++ V +  DL +A +Y +   D   
Sbjct: 2   SKRSEKLAETIHETISSILSRG-LNDPRIG--FVTLTAVDVVEDLSIARIYFTAIGDRDA 58

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
                + LN    ++R  +G+ +  +R++PEL F+YD S +   ++++++         +
Sbjct: 59  RKNSEAGLNSAKGYLRRELGK-VLTIRHIPELIFKYDESQEYGNRIDSILREIATEHDRD 117


>gi|294142059|ref|YP_003558037.1| ribosome-binding factor A [Shewanella violacea DSS12]
 gi|293328528|dbj|BAJ03259.1| ribosome-binding factor A [Shewanella violacea DSS12]
          Length = 140

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 59/114 (51%), Gaps = 6/114 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L  V+   + +D  +   ++++++V +S DL  A V+++   
Sbjct: 1   MAKEFSRTRRIGQQLQQELAQVLHR-DIKDPRVG--MVTVNDVEVSRDLSYAKVFVTFFE 57

Query: 65  DVSPDRVIS--ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
           +      +   AL+    +IR  +   ++ LR +PELRF YD SL    +++ L
Sbjct: 58  EDEKIVAVKLEALSSAAGYIRSLVAGRMK-LRVMPELRFIYDASLVEGMRMSNL 110


>gi|269127535|ref|YP_003300905.1| ribosome-binding factor A [Thermomonospora curvata DSM 43183]
 gi|268312493|gb|ACY98867.1| ribosome-binding factor A [Thermomonospora curvata DSM 43183]
          Length = 156

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 57/123 (46%), Gaps = 10/123 (8%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SPD 69
           RA ++ + ++  +  ++     +D  +    +++++  ++ DLR ATVY ++        
Sbjct: 6   RARKLADRIQQIVAEMLERR-IKDPRLG--FVTVTDAKVTGDLRDATVYYTVYGSEGERA 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM-----CLPKIPV 124
              +AL      IR  +GR +  +R+ P L F +D  + +  +++ L+        ++  
Sbjct: 63  DTAAALESAKGLIRSEVGRRI-GIRHTPTLTFEFDAVIDNARQIDELLARARAHDEQVAK 121

Query: 125 ALE 127
           A E
Sbjct: 122 AAE 124


>gi|262377019|ref|ZP_06070245.1| ribosome-binding factor A [Acinetobacter lwoffii SH145]
 gi|262308057|gb|EEY89194.1| ribosome-binding factor A [Acinetobacter lwoffii SH145]
          Length = 134

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 53/120 (44%), Gaps = 11/120 (9%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL---- 64
           S+R  R+ + V+  L   ++  E +D  +   +++IS V +S DL  A VY+++      
Sbjct: 4   SQRLKRMADTVQRELSE-LIRQELKDPRLGG-LVTISAVKVSPDLGYAEVYVTVMGRELG 61

Query: 65  ----DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 +    +  LN    F+R  + R ++  R  P LRF YD +      +  L+   
Sbjct: 62  DEQSQEANKETLDVLNKASGFLRHELSRRIKT-RITPRLRFHYDKTNAYGNYMFGLIAEA 120


>gi|260893507|ref|YP_003239604.1| ribosome-binding factor A [Ammonifex degensii KC4]
 gi|260865648|gb|ACX52754.1| ribosome-binding factor A [Ammonifex degensii KC4]
          Length = 121

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 30/114 (26%), Positives = 58/114 (50%), Gaps = 5/114 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S R+ R+ E ++  +  V+  +E +D  +    ++++ V +S DLR A +++S+      
Sbjct: 2   SYRSARLAEAIKEVVADVL-QHELKDPRLG--FVTVTRVEVSADLRHAKIFLSVYGSPEE 58

Query: 69  D-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           +      L     FIR  +G+ LR LR+VPE+  + D S+    ++  L+   K
Sbjct: 59  EKESFEVLEKAKGFIRSALGKRLR-LRHVPEIVLKPDPSISYGVRVMELLSEIK 111


>gi|148380372|ref|YP_001254913.1| ribosome-binding factor A [Clostridium botulinum A str. ATCC 3502]
 gi|153933206|ref|YP_001384592.1| ribosome-binding factor A [Clostridium botulinum A str. ATCC 19397]
 gi|153935306|ref|YP_001388108.1| ribosome-binding factor A [Clostridium botulinum A str. Hall]
 gi|226949770|ref|YP_002804861.1| ribosome-binding factor A [Clostridium botulinum A2 str. Kyoto]
 gi|166218431|sp|A7FVZ2|RBFA_CLOB1 RecName: Full=Ribosome-binding factor A
 gi|166218432|sp|A5I4J2|RBFA_CLOBH RecName: Full=Ribosome-binding factor A
 gi|254789742|sp|C1FS58|RBFA_CLOBJ RecName: Full=Ribosome-binding factor A
 gi|148289856|emb|CAL83964.1| ribosome-binding factor A [Clostridium botulinum A str. ATCC 3502]
 gi|152929250|gb|ABS34750.1| ribosome-binding factor A [Clostridium botulinum A str. ATCC 19397]
 gi|152931220|gb|ABS36719.1| ribosome-binding factor A [Clostridium botulinum A str. Hall]
 gi|226844456|gb|ACO87122.1| ribosome-binding factor A [Clostridium botulinum A2 str. Kyoto]
 gi|322806683|emb|CBZ04252.1| ribosome-binding factor A [Clostridium botulinum H04402 065]
          Length = 120

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 63/115 (54%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA R+ EEV+  +  +I  N+ +D  +   ++S+++V ++ DL+ A VY+S+  +    +
Sbjct: 5   RAGRINEEVKKEVSNIIH-NDIKDPRL-SAMVSVTDVNVTKDLKYAKVYVSIFGNEKAKE 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             + AL  ++ FIR  +GR ++ LR  PE+    D S++    ++ L+   K   
Sbjct: 63  ESLEALKSSVGFIRKEVGRRVK-LRNTPEVIIEVDNSIERGMHIDELLHSIKENE 116


>gi|146308622|ref|YP_001189087.1| ribosome-binding factor A [Pseudomonas mendocina ymp]
 gi|166219393|sp|A4XYD9|RBFA_PSEMY RecName: Full=Ribosome-binding factor A
 gi|145576823|gb|ABP86355.1| ribosome-binding factor A [Pseudomonas mendocina ymp]
          Length = 129

 Score =  100 bits (250), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 65/127 (51%), Gaps = 9/127 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K+  R  R+G++++  L  V++  E +D  +   +++I+ V +S DL  A V+I++  
Sbjct: 1   MAKDYSRTQRIGDQMQRELA-VLIQREIKDPRLG--LVTITAVDVSRDLSHAKVFITVMG 57

Query: 65  DVSPDRVI----SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                  I      L     ++R  +G+S++ +R +P+L F YD S++   +L+AL+   
Sbjct: 58  KDDDAEQIKLNLEILGEAAGYLRMLLGKSMK-VRTIPQLHFHYDASIRRGAELSALIER- 115

Query: 121 KIPVALE 127
            +    +
Sbjct: 116 AVAEDRK 122


>gi|332528895|ref|ZP_08404865.1| ribosome-binding factor A [Hylemonella gracilis ATCC 19624]
 gi|332041652|gb|EGI78008.1| ribosome-binding factor A [Hylemonella gracilis ATCC 19624]
          Length = 122

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 6   PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD 65
                R  +V ++++  L  +I   E +D  +   ++++  V ++ D   A VY S+   
Sbjct: 5   KSPINRGHKVADQIQRDLSELIAR-ELKDPRVG--MVTLQGVEVTPDYAHAKVYFSVL-I 60

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
             P     ALN    F+R  + + L ++  VP L F +D + +    +NAL+       A
Sbjct: 61  GEPQEAQDALNQAAGFLRNGLFKRL-HIHTVPTLHFVFDRTTERAADMNALIAKAVSSRA 119

Query: 126 LE 127
            E
Sbjct: 120 KE 121


>gi|146298830|ref|YP_001193421.1| ribosome-binding factor A [Flavobacterium johnsoniae UW101]
 gi|189039541|sp|A5FL10|RBFA_FLAJO RecName: Full=Ribosome-binding factor A
 gi|146153248|gb|ABQ04102.1| ribosome-binding factor A [Flavobacterium johnsoniae UW101]
          Length = 130

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 57/116 (49%), Gaps = 2/116 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++G  ++  L+ ++   E +   +S  VIS+S+V ++ DL VATVY+S+    
Sbjct: 1   METNRQKKIGSVIQKDLVDIL-QGEVRKNGVSNLVISVSKVSVTSDLSVATVYLSIFPQE 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLR-NLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                +  +  N   I+  + + +R  LR VP L F  D SL    K++  +   +
Sbjct: 60  KAKETLEGIKSNTTLIKHDLSQRVRLQLRRVPNLVFFIDDSLDYIEKIDNALAGKE 115


>gi|326406319|gb|ADZ63390.1| ribosome-binding factor A [Lactococcus lactis subsp. lactis CV56]
          Length = 119

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 55/114 (48%), Gaps = 6/114 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
            NS R  RV  E++  +  ++  N+ +D  +    I+  +V ++ DL  ATVY SL  + 
Sbjct: 2   GNSFRNDRVAVEIQREINDIL-RNKVRDPRVQDVNIT--DVQLTGDLSQATVYYSLLSNL 58

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
               ++  +AL       +  + + +   + +P+L F  D S++   K++ L+ 
Sbjct: 59  ASDNEKAATALKKATGLFKSELAKRMTIFK-IPDLTFAKDESVEYGSKIDELLR 111


>gi|116511577|ref|YP_808793.1| ribosome-binding factor A [Lactococcus lactis subsp. cremoris SK11]
 gi|125624581|ref|YP_001033064.1| ribosome-binding factor A [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|123320521|sp|Q030K1|RBFA_LACLS RecName: Full=Ribosome-binding factor A
 gi|166218445|sp|A2RM36|RBFA_LACLM RecName: Full=Ribosome-binding factor A
 gi|116107231|gb|ABJ72371.1| ribosome-binding factor A [Lactococcus lactis subsp. cremoris SK11]
 gi|124493389|emb|CAL98363.1| Ribosome-binding factor A [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300071372|gb|ADJ60772.1| ribosome-binding factor A [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 119

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/114 (23%), Positives = 56/114 (49%), Gaps = 6/114 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
            NS R+ RV  E++  +  ++  N+ +D  +    I+  +V ++ DL  ATVY SL  + 
Sbjct: 2   GNSFRSDRVAVEIQREINDIL-RNKVRDPRVQDVNIT--DVQLTGDLSQATVYYSLLSNL 58

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
               ++  +AL       +  + + +   + +P+L F  D S++   K++ L+ 
Sbjct: 59  ASDNEKAATALKKATGLFKSELAKRMTIFK-IPDLTFAKDESVEYGSKIDELLR 111


>gi|87119790|ref|ZP_01075687.1| Ribosome-binding factor A [Marinomonas sp. MED121]
 gi|86165266|gb|EAQ66534.1| Ribosome-binding factor A [Marinomonas sp. MED121]
          Length = 130

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 9/127 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
                 R  R+G++++  L  +I   E +D  +   +++I+EV ++ DL  A VY ++  
Sbjct: 1   MASEFSRTSRIGDQLQKELASII-QFEVKDPRLG--IVTINEVRVAKDLGYADVYYTVLG 57

Query: 65  DVSP----DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                       +AL+    F+R R  + ++ LR +P LRF YD S+ +  K++AL+   
Sbjct: 58  MDDKPEKLAENQTALDSASNFLRRRASQEIK-LRVMPLLRFHYDDSVVNGAKMSALI-DE 115

Query: 121 KIPVALE 127
            I    +
Sbjct: 116 AIKADAK 122


>gi|290969151|ref|ZP_06560676.1| ribosome-binding factor A [Megasphaera genomosp. type_1 str. 28L]
 gi|290780657|gb|EFD93260.1| ribosome-binding factor A [Megasphaera genomosp. type_1 str. 28L]
          Length = 115

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 56/115 (48%), Gaps = 5/115 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  ++ E ++  +  ++L  E +D  +    +++++  ++ DLR ATVY+SL       R
Sbjct: 5   RVRKIQEFIKQEVSAMLLR-EIKDPRVG--FVTVTDAKITGDLREATVYVSLYGSPEEKR 61

Query: 71  VI-SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                L  +  + R  +G+ L  +RY P + F  DTSL    K++ L+   +   
Sbjct: 62  ATLQVLRQSAGYFRTAVGKRL-GIRYAPSITFAEDTSLDYGMKIDRLLRDVEKKE 115


>gi|194366587|ref|YP_002029197.1| ribosome-binding factor A [Stenotrophomonas maltophilia R551-3]
 gi|259552073|sp|B4SQR9|RBFA_STRM5 RecName: Full=Ribosome-binding factor A
 gi|194349391|gb|ACF52514.1| ribosome-binding factor A [Stenotrophomonas maltophilia R551-3]
          Length = 127

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            PK   R  RV  ++R  L   +++N  ++  +    +S+S+V ++ D+  A V+++  +
Sbjct: 1   MPKTFHRTDRVSAQLRRELG-TLVHNAVREHGLPS--VSVSDVEITRDMAHAKVFVTALM 57

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                  ++ L      +R  + R+++ LR+VPEL F YD S+     ++ ++   
Sbjct: 58  PERSAEAVAGLKELGYRLRMDLARAMK-LRHVPELHFHYDDSVDRGEHIDNILRDL 112


>gi|163752372|ref|ZP_02159567.1| ribosome-binding factor A [Shewanella benthica KT99]
 gi|161327744|gb|EDP98931.1| ribosome-binding factor A [Shewanella benthica KT99]
          Length = 140

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 30/134 (22%), Positives = 61/134 (45%), Gaps = 15/134 (11%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L  V+   + +D  +   ++++++V +S DL  A V+++   
Sbjct: 1   MAKEFSRTRRIGQQLQQELAQVLHR-DIKDPRVG--MVTVNDVEVSRDLSYAKVFVTFFE 57

Query: 65  DVSPDRVIS--ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM----- 117
           +          AL+    +IR  +   ++ LR +PELRF YD SL    +++ L+     
Sbjct: 58  EDEKIVAQKLEALSSAAGYIRSLVAGRMK-LRVMPELRFIYDASLVEGMRMSNLVTRVIH 116

Query: 118 ----CLPKIPVALE 127
                  K     +
Sbjct: 117 NDEAKQKKAKRDEQ 130


>gi|88807131|ref|ZP_01122643.1| possible Ribosome-binding factor A [Synechococcus sp. WH 7805]
 gi|88788345|gb|EAR19500.1| possible Ribosome-binding factor A [Synechococcus sp. WH 7805]
          Length = 140

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 3/119 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP-LD 65
              RR  RV   +R     ++++   +D  + + +ISI+ V +S DL+   +++S+    
Sbjct: 2   APGRRVERVAALIRKETSELLIHG-IRDERVHQGLISITGVEVSGDLQHCKIFVSVLADP 60

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
               +V+  L     F+RG +GR L+ +R  PE+ F  D  L+    +  L+   +   
Sbjct: 61  EGKAQVMDGLQAASSFLRGELGRRLK-MRRAPEVVFHLDRGLEKGASVLGLLGDLERER 118


>gi|284048691|ref|YP_003399030.1| ribosome-binding factor A [Acidaminococcus fermentans DSM 20731]
 gi|283952912|gb|ADB47715.1| ribosome-binding factor A [Acidaminococcus fermentans DSM 20731]
          Length = 118

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 52/115 (45%), Gaps = 5/115 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           RA ++   ++  +  +++  + +D  +    ++I+ V +S DL  A +Y+SL        
Sbjct: 5   RAEKLQALIKQEMSNMMIR-DVKDPRVK--FVTITGVEVSNDLSYAKIYVSLYGSEEQQA 61

Query: 71  V-ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                L   + F R  I R + +LR  P L F  DTS++    + +++   K   
Sbjct: 62  AAWKGLQSALGFFRREIARRI-DLRVAPVLSFHKDTSMEYSAHIESILHELKKEE 115


>gi|319793513|ref|YP_004155153.1| ribosome-binding factor a [Variovorax paradoxus EPS]
 gi|315595976|gb|ADU37042.1| ribosome-binding factor A [Variovorax paradoxus EPS]
          Length = 123

 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 57/128 (44%), Gaps = 5/128 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  +      RA +V ++++  L  +I   E +D  +   +++I  V ++ D   A VY 
Sbjct: 1   MPKRKAAAPNRAFKVADQIQRDLTELIAR-ELKDPRVG--MVTIQAVEVTPDYAHAKVYF 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           SL           ALN    F+R  + + L ++  VP L F +D + +    +NAL+   
Sbjct: 58  SLL-TGDVAETTEALNQAAGFLRNGLFKRL-HIHTVPTLHFLFDRTTERAADMNALIAQA 115

Query: 121 KIPVALEK 128
               + ++
Sbjct: 116 VASRSKDE 123


>gi|113460965|ref|YP_719032.1| ribosome-binding factor A [Haemophilus somnus 129PT]
 gi|170717522|ref|YP_001784613.1| ribosome-binding factor A [Haemophilus somnus 2336]
 gi|123327302|sp|Q0I3P4|RBFA_HAES1 RecName: Full=Ribosome-binding factor A
 gi|189039544|sp|B0UU14|RBFA_HAES2 RecName: Full=Ribosome-binding factor A
 gi|112823008|gb|ABI25097.1| ribosome-binding factor A [Haemophilus somnus 129PT]
 gi|168825651|gb|ACA31022.1| ribosome-binding factor A [Haemophilus somnus 2336]
          Length = 126

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 66/127 (51%), Gaps = 8/127 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MAREFKRSDRVAQEIQKEVAVILQR-EVKDPRIG--MVTVSDVEISSDLAYAKIFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D   + +   +  L     +IR  +G+ +R LR VPELRF YD SL    +++ L+    
Sbjct: 58  DQDENVIEQGMKGLEKASPYIRSLLGKVMR-LRIVPELRFIYDQSLVDGMRMSNLVTNV- 115

Query: 122 IPVALEK 128
           +    ++
Sbjct: 116 VREDEKR 122


>gi|310828064|ref|YP_003960421.1| hypothetical protein ELI_2476 [Eubacterium limosum KIST612]
 gi|308739798|gb|ADO37458.1| hypothetical protein ELI_2476 [Eubacterium limosum KIST612]
          Length = 130

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
             S R  ++  +++  L  +I   + +D   +RD +SI+ V  + DL+ ATVY+S+    
Sbjct: 1   MASHRIEKINGQIQRELSLIIQQ-KMKDSRFNRDTLSITHVKAAPDLKTATVYVSIFGTS 59

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
              + V+  L+    F+R  +G+ L+ +  +P L F+ D S++    +++++   K   
Sbjct: 60  EEKEEVLGLLDNAKGFLRANLGKVLK-VHSIPALTFKLDDSVEYGMHIDSILASLKKNK 117


>gi|300312897|ref|YP_003776989.1| ribosome-binding factor A protein [Herbaspirillum seropedicae SmR1]
 gi|300075682|gb|ADJ65081.1| ribosome-binding factor A protein [Herbaspirillum seropedicae SmR1]
          Length = 130

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 59/129 (45%), Gaps = 6/129 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M   +     R LRV ++++  L  +I   E +D  +   +I+I+EV ++ D   A V+ 
Sbjct: 1   MAKHSKSIPGRGLRVADQIQRDLSELIA-FELKDPRVG--MITITEVQVTPDYAHAKVFF 57

Query: 61  SLP--LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           +       +    ++ L     ++R ++GR L  +  +PEL F +D S     +++ L+ 
Sbjct: 58  TTLVDNPEAIKNTLAGLRKAGGYLRTQLGRRL-TIHTLPELHFVHDNSTARGIEMSRLID 116

Query: 119 LPKIPVALE 127
                 A +
Sbjct: 117 EANATRAKD 125


>gi|197287231|ref|YP_002153103.1| ribosome-binding factor A [Proteus mirabilis HI4320]
 gi|227357074|ref|ZP_03841444.1| ribosome-binding factor A [Proteus mirabilis ATCC 29906]
 gi|238690098|sp|B4F2C0|RBFA_PROMH RecName: Full=Ribosome-binding factor A
 gi|194684718|emb|CAR46706.1| ribosome-binding factor A [Proteus mirabilis HI4320]
 gi|227162766|gb|EEI47729.1| ribosome-binding factor A [Proteus mirabilis ATCC 29906]
          Length = 133

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 65/132 (49%), Gaps = 13/132 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             ++  RA RV +E++  +  +IL  E +D  I   + ++S V +S DL  A V+++   
Sbjct: 1   MARDFSRAQRVSQEMQKEIA-IILQREVKDPRIG--MATVSGVEISRDLAYAKVFVTFLN 57

Query: 65  DVSPDRVIS--------ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
             + +            ALN    FIR  +G+++R LR VPEL F YD SL    +++ L
Sbjct: 58  LSAGEESDEEMVENGLKALNEAAGFIRSLLGKAMR-LRVVPELTFAYDNSLVEGMRMSNL 116

Query: 117 MCLPKIPVALEK 128
           +    +    ++
Sbjct: 117 VSNV-VKDDEKR 127


>gi|170754753|ref|YP_001781960.1| ribosome-binding factor A [Clostridium botulinum B1 str. Okra]
 gi|229564414|sp|B1II48|RBFA_CLOBK RecName: Full=Ribosome-binding factor A
 gi|169119965|gb|ACA43801.1| ribosome-binding factor A [Clostridium botulinum B1 str. Okra]
          Length = 120

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 63/115 (54%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA R+ EEV+  +  +I  N+ +D  +   ++S+++V ++ DL+ A VY+S+  +    +
Sbjct: 5   RAGRINEEVKKEVSNIIH-NDIKDPRL-SAMVSVTDVDVTKDLKYAKVYVSIFGNEKAKE 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             + AL  ++ FIR  IGR ++ LR  PE+    D S++    ++ L+   K   
Sbjct: 63  ESLQALKSSVGFIRKEIGRRVK-LRNTPEVIIEVDNSIERGMHIDELLHSIKENE 116


>gi|146283629|ref|YP_001173782.1| ribosome-binding factor A [Pseudomonas stutzeri A1501]
 gi|166219395|sp|A4VPN9|RBFA_PSEU5 RecName: Full=Ribosome-binding factor A
 gi|145571834|gb|ABP80940.1| ribosome-binding factor A [Pseudomonas stutzeri A1501]
 gi|327482024|gb|AEA85334.1| ribosome-binding factor A [Pseudomonas stutzeri DSM 4166]
          Length = 129

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L  +++  E +D  +   +I+I+ V +S DL  A ++I++  
Sbjct: 1   MAKEFSRTQRIGDQMQRELA-LLIQREIKDPRLG--LITITAVDVSRDLSHAKIFITIMG 57

Query: 65  DVSPDRVISA----LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                  I      LN    F+R ++G+S++ LR VP+L F YD S++   +L++L+   
Sbjct: 58  QDDDQEAIKGNLRILNDAAGFLRMQLGKSMK-LRTVPQLHFNYDASIRRGVELSSLIER- 115

Query: 121 KIPVALE 127
            +    +
Sbjct: 116 AVAEDRK 122


>gi|160943260|ref|ZP_02090496.1| hypothetical protein FAEPRAM212_00746 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445499|gb|EDP22502.1| hypothetical protein FAEPRAM212_00746 [Faecalibacterium prausnitzii
           M21/2]
          Length = 164

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 58/128 (45%), Gaps = 5/128 (3%)

Query: 2   KNKNPKNSRRAL-RVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           +N     S++ + R+ ++++  ++ +I     +D  +   +++++ + ++ DL VA VY+
Sbjct: 29  QNLEKTMSQKNMGRLAQDMKREVIAIIGR--LKDPRLEGGLLTVTRLDVTPDLDVAKVYV 86

Query: 61  SLPLDVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           S+      P   I ALN     +R  + + + ++R  P   F  D        +N L+  
Sbjct: 87  SVMGRADGPKPAIEALNRAAGHVRTEVSKKM-HIRKAPRFIFVEDDGAAYAAHINELLRS 145

Query: 120 PKIPVALE 127
             +    E
Sbjct: 146 LNVNGEEE 153


>gi|223984476|ref|ZP_03634609.1| hypothetical protein HOLDEFILI_01903 [Holdemania filiformis DSM
           12042]
 gi|223963547|gb|EEF67926.1| hypothetical protein HOLDEFILI_01903 [Holdemania filiformis DSM
           12042]
          Length = 114

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 28/113 (24%), Positives = 57/113 (50%), Gaps = 5/113 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S +  RV + +   +  +I     +D  +    ++I++V ++ D   AT+Y+S       
Sbjct: 2   SVKQERVAQIILKDVTDII-QFSLKDPSVG--FVTITDVQVTNDYSYATIYVSFLGKEER 58

Query: 69  DRVI-SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            +    ALN    FIR  +G+ L ++R VP+L F+ D SL+   ++++++   
Sbjct: 59  KQAGLKALNRAKGFIRSELGKRL-SIRKVPDLIFKLDDSLEKGERIDSIISQI 110


>gi|332881242|ref|ZP_08448892.1| ribosome-binding factor A [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332680618|gb|EGJ53565.1| ribosome-binding factor A [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 111

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 28/114 (24%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + +    Q + +   ++S+S   +S DL +  VY+S+    
Sbjct: 1   METTRQNKISRLIQKELSEIFM---LQTKAMKGVLVSVSACRISPDLSICRVYLSIFPSQ 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
             + ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL     ++ L+  
Sbjct: 58  QSEEIVKNINGNMKAIRYELGTRVRHQLRIIPELKFFVDDSLDYIENIDKLLKE 111


>gi|187778990|ref|ZP_02995463.1| hypothetical protein CLOSPO_02585 [Clostridium sporogenes ATCC
           15579]
 gi|187772615|gb|EDU36417.1| hypothetical protein CLOSPO_02585 [Clostridium sporogenes ATCC
           15579]
          Length = 120

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 63/115 (54%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA R+ EEV+  +  +I  N+ +D  +   ++S+++V ++ DL+ A VY+S+  +    +
Sbjct: 5   RAGRINEEVKKEVSSIIH-NDIKDPRL-SAMVSVTDVNVTKDLKYAKVYVSIFGNEKAKE 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             + AL  ++ FIR  IGR ++ LR  PE+    D S++    ++ L+   K   
Sbjct: 63  ESLQALKSSVGFIRKEIGRRVK-LRNTPEVIIEVDNSIERGMHIDELLHSIKENE 116


>gi|148976706|ref|ZP_01813393.1| ribosome-binding factor A [Vibrionales bacterium SWAT-3]
 gi|145964057|gb|EDK29315.1| ribosome-binding factor A [Vibrionales bacterium SWAT-3]
          Length = 137

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 32/126 (25%), Positives = 67/126 (53%), Gaps = 8/126 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  I   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVSQQLQKELALILQR-EVRDSRIG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   IR  +G+ +R+ R  PE+RF YD +L    +++ L+   ++
Sbjct: 58  IGEQTPESCLAALKEHEVPIRMALGKRIRH-RLTPEVRFTYDNTLVEGMRMSNLVS--EV 114

Query: 123 PVALEK 128
               ++
Sbjct: 115 LNDDKR 120


>gi|291550233|emb|CBL26495.1| ribosome-binding factor A [Ruminococcus torques L2-14]
          Length = 124

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV  EV+  L  ++     +D  +   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRVNAEVQRELSNIL-RGGIKDPRV-APLTSVVAVEVAPDLKTCKAYISVLG 58

Query: 65  DVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D    +  I  L     +IR  + R++ N+R  P++ F  D S++    ++  +   ++ 
Sbjct: 59  DKKAQEDTIKGLQSAEGYIRRELARTV-NMRNTPQITFIVDQSIEYGVNISKKID--EVT 115

Query: 124 VALE 127
             L+
Sbjct: 116 RDLK 119


>gi|241764253|ref|ZP_04762284.1| ribosome-binding factor A [Acidovorax delafieldii 2AN]
 gi|241366376|gb|EER60898.1| ribosome-binding factor A [Acidovorax delafieldii 2AN]
          Length = 123

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 58/127 (45%), Gaps = 5/127 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      RA +V ++++  L  +I   E +D  +   ++++  V ++ D   A V+ 
Sbjct: 1   MAAKKSSTPNRAFKVADQIQRDLTELIAR-ELKDPRVG--MVTLQGVEVTPDYAHAKVFF 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           SL     P    +ALN    F+R  + + L ++  VP L F +D + +    +NAL+   
Sbjct: 58  SLL-VGDPVETQAALNQAAGFLRNGLFKRL-HIHTVPTLHFVFDRTSERAADMNALIAKA 115

Query: 121 KIPVALE 127
               A E
Sbjct: 116 VSSRAKE 122


>gi|28380146|sp|Q9X765|RBFA_LACLC RecName: Full=Ribosome-binding factor A
 gi|4583984|emb|CAB40558.1| ribosome binding factor A [Lactococcus lactis]
          Length = 113

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 26/113 (23%), Positives = 56/113 (49%), Gaps = 6/113 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
            NS R+ RV  E++  +  ++  N+ +D  +    I+  +V ++ DL  ATVY SL  + 
Sbjct: 2   GNSFRSDRVAVEIQREINDIL-RNKVRDPRVQDVNIT--DVQLTGDLSQATVYYSLLSNL 58

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
               ++  +AL       +  + + +   + +P+L F  D S++   K++ ++
Sbjct: 59  ASDNEKAATALKKATGLFKSELAKRMTIFK-IPDLTFAKDESVEYGSKIDEIL 110


>gi|153855234|ref|ZP_01996400.1| hypothetical protein DORLON_02414 [Dorea longicatena DSM 13814]
 gi|149752233|gb|EDM62164.1| hypothetical protein DORLON_02414 [Dorea longicatena DSM 13814]
          Length = 128

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 56/124 (45%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K S +  RV  EV+  L  +I     +D  +     S+    ++ DL+    YIS+  
Sbjct: 1   MRKRSIKNTRVNTEVQHELSNII-RGGLKDPRV-APWTSVVAAEVAPDLKTCKAYISVLG 58

Query: 65  D-VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D    ++ I  L     +IR  + R+L NLR  PE++F  D S++    ++  +   ++ 
Sbjct: 59  DAYEQEQTIKGLQSAEGYIRRELARTL-NLRNTPEIKFVLDQSIEYGVNMSKKID--EVT 115

Query: 124 VALE 127
             L+
Sbjct: 116 KDLK 119


>gi|197303048|ref|ZP_03168096.1| hypothetical protein RUMLAC_01775 [Ruminococcus lactaris ATCC
           29176]
 gi|197297903|gb|EDY32455.1| hypothetical protein RUMLAC_01775 [Ruminococcus lactaris ATCC
           29176]
          Length = 127

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 58/124 (46%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV  EV+  L  ++     +D  +   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRVNAEVQRELSNIL-RAGIKDPRV-APMTSVVAVEVAPDLKTCKAYISVLG 58

Query: 65  DVSPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D    +  I  L     +IR  + R++ N+R  PE+RF  D S++    ++  +   ++ 
Sbjct: 59  DEKAQQDTIRGLQSAEGYIRRELARTI-NMRNTPEIRFIVDQSIEYGVNISKKID--EVT 115

Query: 124 VALE 127
             L+
Sbjct: 116 RDLK 119


>gi|28210962|ref|NP_781906.1| ribosome-binding factor A [Clostridium tetani E88]
 gi|32171612|sp|Q895J7|RBFA_CLOTE RecName: Full=Ribosome-binding factor A
 gi|28203401|gb|AAO35843.1| ribosome-binding factor A [Clostridium tetani E88]
          Length = 121

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 62/116 (53%), Gaps = 4/116 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA R+ EEV+  +  +I   + +D  I   ++S+++V ++ D R A VY+S+  D    +
Sbjct: 5   RAGRINEEVKKEISSII-RMDLKDPRI-SAMVSVTKVDVTKDQRYAKVYVSIFGDEKSKE 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
             + AL  +  FIR  +G  ++ LRY PE+  + D S++    +++++   K    
Sbjct: 63  ETLEALKSSSGFIRREVGHRIK-LRYTPEIIIQNDDSIEHGMHIDSILDKIKENED 117


>gi|121535263|ref|ZP_01667077.1| ribosome-binding factor A [Thermosinus carboxydivorans Nor1]
 gi|121306148|gb|EAX47076.1| ribosome-binding factor A [Thermosinus carboxydivorans Nor1]
          Length = 117

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 32/112 (28%), Positives = 57/112 (50%), Gaps = 5/112 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  ++ E ++  +  +IL  E +D  I    ++++ V +S DLR A +++SL        
Sbjct: 5   RVEKIQEFIKQEVSKIILT-ELKDPRIG--FVTVTRVEVSGDLRYAKIFLSLMGSDEEKA 61

Query: 71  -VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
              + L+  + +IR  IG+ L  +R+VPEL    D SLQ   ++  L+   K
Sbjct: 62  GTWAGLHRALGYIRTEIGKHL-GIRHVPELSLHLDESLQYSARIQELLNKIK 112


>gi|123440814|ref|YP_001004805.1| ribosome-binding factor A [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166199574|sp|A1JIX0|RBFA_YERE8 RecName: Full=Ribosome-binding factor A
 gi|122087775|emb|CAL10561.1| ribosome-binding factor A [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 136

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 34/131 (25%), Positives = 63/131 (48%), Gaps = 12/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R+ RV +E++  +  ++   E +D  +   + ++S + +S DL  A V+++   
Sbjct: 1   MAKEFSRSQRVSQEMQKEIALILQR-EIKDPRVG--MATVSGIELSRDLAYAKVFVTFLN 57

Query: 64  ------LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                    +    I AL     +IR  +G+++R LR VPEL F YD SL    +++ L+
Sbjct: 58  VLTDNADPDTVKNGIKALQDASGYIRTLLGKAMR-LRIVPELTFAYDNSLIEGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               I   +E+
Sbjct: 117 -TNVIKNDVER 126


>gi|153814917|ref|ZP_01967585.1| hypothetical protein RUMTOR_01132 [Ruminococcus torques ATCC 27756]
 gi|317500429|ref|ZP_07958653.1| ribosome-binding factor A [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331089564|ref|ZP_08338463.1| ribosome-binding factor A [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145847948|gb|EDK24866.1| hypothetical protein RUMTOR_01132 [Ruminococcus torques ATCC 27756]
 gi|316898184|gb|EFV20231.1| ribosome-binding factor A [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330404932|gb|EGG84470.1| ribosome-binding factor A [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 127

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 58/124 (46%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV  EV+  L  ++     +D  +   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRVNAEVQRELSNIL-RGGIKDPRV-SPMTSVVAVEVAPDLKTCKAYISVLG 58

Query: 65  DVSPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D    +  I  L     FIR  + R++ N+R  PE++F  D S++    ++  +   ++ 
Sbjct: 59  DEKAQQDTIKGLQSAEGFIRRELARTI-NMRNTPEIKFIVDQSIEYGVNISKKID--EVT 115

Query: 124 VALE 127
             L+
Sbjct: 116 KDLK 119


>gi|325955537|ref|YP_004239197.1| ribosome-binding factor A [Weeksella virosa DSM 16922]
 gi|323438155|gb|ADX68619.1| Ribosome-binding factor A [Weeksella virosa DSM 16922]
          Length = 119

 Score =  100 bits (249), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 58/113 (51%), Gaps = 3/113 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            +S R  +VG+  +  L        +   L   +++S++EV ++ DL +A V+IS+  + 
Sbjct: 1   MDSNRQQKVGKLFQEELAEAFRK--WASELFPGNLVSVTEVKVTPDLSIAKVFISIFPND 58

Query: 67  SPDRVISALNCNIKFIRGRIGR-SLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
             D ++  +N    + RG + + + +N+R  PEL FR D +L    K++  + 
Sbjct: 59  KKDEILQEINTQAPYFRGILSKGAAKNMRLTPELIFRLDPTLDEMDKIDRALS 111


>gi|329847332|ref|ZP_08262360.1| ribosome-binding factor A [Asticcacaulis biprosthecum C19]
 gi|328842395|gb|EGF91964.1| ribosome-binding factor A [Asticcacaulis biprosthecum C19]
          Length = 118

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/107 (29%), Positives = 53/107 (49%), Gaps = 6/107 (5%)

Query: 25  WVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRVI-----SALNCNI 79
            ++   E  D  +    ++I+EV MS DLR ATV++          V       ALN + 
Sbjct: 2   EILREEEIHDDALHDVSVTITEVRMSPDLRHATVFVEPLGAGINSNVQVGAIVEALNKHS 61

Query: 80  KFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
           K++RG +G  + ++++ P LRF +D S     +++AL   P I   L
Sbjct: 62  KYMRGVLG-RMIDMKFTPALRFLHDESFNEAARIDALFMRPDIARDL 107


>gi|304384251|ref|ZP_07366662.1| ribosome-binding factor A [Prevotella marshii DSM 16973]
 gi|304334567|gb|EFM00849.1| ribosome-binding factor A [Prevotella marshii DSM 16973]
          Length = 154

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 57/121 (47%), Gaps = 4/121 (3%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K +      R  R+   ++  L  +        R +   ++S++   +S DL + T Y+S
Sbjct: 26  KKEITMQETRQNRIARLLQKELSLIFQTQT---RSMHGVMVSVTRCRISPDLSICTGYLS 82

Query: 62  LPLDVSPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +      + ++  +N N + IR  +G  +RN LR +PE+RF  D SL    K++ L+   
Sbjct: 83  IFPSERGEEILKNINANAQTIRYDLGTRVRNQLRIIPEVRFFLDDSLDYIEKIDRLLEKD 142

Query: 121 K 121
           K
Sbjct: 143 K 143


>gi|302387316|ref|YP_003823138.1| ribosome-binding factor A [Clostridium saccharolyticum WM1]
 gi|302197944|gb|ADL05515.1| ribosome-binding factor A [Clostridium saccharolyticum WM1]
          Length = 120

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 57/125 (45%), Gaps = 6/125 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I   E +D  I   + ++    ++ DL+    +IS+  
Sbjct: 1   MRKNSIKNTRINMEVQRELSDII-RLEIKDPRIH-PMTTVVSAQVTPDLKYCKAFISILG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D       I  L     +IR  + R + NLR  PE++F  D S++    ++ L+   ++ 
Sbjct: 59  DEEAGKATIEGLKSAEGYIRRELARRV-NLRNTPEIKFILDQSIEYGVNMSRLID--EVT 115

Query: 124 VALEK 128
             + +
Sbjct: 116 KDIRE 120


>gi|182417577|ref|ZP_02948902.1| ribosome-binding factor A [Clostridium butyricum 5521]
 gi|237668125|ref|ZP_04528109.1| ribosome-binding factor A [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182378590|gb|EDT76118.1| ribosome-binding factor A [Clostridium butyricum 5521]
 gi|237656473|gb|EEP54029.1| ribosome-binding factor A [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 117

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 5/116 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP--L 64
             + R  R+ EE +  +   ++ NE +D  +   +IS+++V ++ DLR A VY+S+    
Sbjct: 1   MANYRGGRINEEFKREISN-LIQNEIKDPRL-TAMISVTDVKVTKDLRYAKVYVSIFCND 58

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +      ++AL     FIR  +G+ + NLR+ PE+    D S+     ++ L+   
Sbjct: 59  EEEKKSNLAALRGASGFIRKNVGQRI-NLRHTPEILIELDDSINYGMHMDELIHKI 113


>gi|254516616|ref|ZP_05128675.1| ribosome-binding factor A [gamma proteobacterium NOR5-3]
 gi|219675039|gb|EED31406.1| ribosome-binding factor A [gamma proteobacterium NOR5-3]
          Length = 157

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 58/124 (46%), Gaps = 7/124 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RVG+ +R  L  +I   E +D  +   ++SI+ V +S D+  A V+ +L  
Sbjct: 1   MAKEFSRTERVGDYLRRELALIIQR-EVRDPRLG--MVSITAVDVSRDISHARVHFTLLG 57

Query: 65  DVSPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             + +        LN    F+R  + R   ++R VP+LRF +D+S+     L AL+   +
Sbjct: 58  CDTAEEAKPSTDVLNKAAGFLRSALARD-ASMRSVPKLRFVFDSSIGRGRDLEALIHRAR 116

Query: 122 IPVA 125
               
Sbjct: 117 TADD 120


>gi|254282436|ref|ZP_04957404.1| ribosome-binding factor A [gamma proteobacterium NOR51-B]
 gi|219678639|gb|EED34988.1| ribosome-binding factor A [gamma proteobacterium NOR51-B]
          Length = 134

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/130 (26%), Positives = 56/130 (43%), Gaps = 11/130 (8%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R+ RVG+ ++  L  +I   E +D      ++S++ V ++ D   A VY +   
Sbjct: 1   MAREFTRSQRVGDFLQQELARLIQQ-EVRDPR--AHMVSVTGVDVTRDFAHAKVYYTQLG 57

Query: 65  DVS---PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             S    +     LN    F+R RI RS   +R VP L+FR+D S+     +  L+   K
Sbjct: 58  VDSREAAEETTQVLNGAAGFLRSRIARS-ATMRTVPRLQFRFDESVGYGRSMEQLIDRVK 116

Query: 122 IP----VALE 127
                    E
Sbjct: 117 DADRRLRDAE 126


>gi|332291313|ref|YP_004429922.1| ribosome-binding factor A [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169399|gb|AEE18654.1| ribosome-binding factor A [Krokinobacter diaphorus 4H-3-7-5]
          Length = 130

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 55/116 (47%), Gaps = 2/116 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S R  +V   ++  L  V+  N  +D      ++S+++V +  DL +A VY+S+  + 
Sbjct: 1   MESNRQKKVAGVLQKDLAEVL-QNALRDSGKGGIIVSVTKVKVPTDLSIAKVYLSVFPND 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               ++  +N     IR  I +  R+ LR +PEL+F  D +L+    +   +   +
Sbjct: 60  KAADILKEVNQVKPIIRHNISQRTRHQLRRMPELQFFIDDTLEYLDGIERSLKREE 115


>gi|219850519|ref|YP_002464952.1| ribosome-binding factor A [Chloroflexus aggregans DSM 9485]
 gi|254789740|sp|B8GAE1|RBFA_CHLAD RecName: Full=Ribosome-binding factor A
 gi|219544778|gb|ACL26516.1| ribosome-binding factor A [Chloroflexus aggregans DSM 9485]
          Length = 127

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           +R  +V + ++  L  VI   E +D  +     S+++V +S DL+ A VYIS+       
Sbjct: 4   QRLQQVADTMQRILGEVI-QTELKDPRVG--FASVTKVEVSADLQHAKVYISIMGTPEER 60

Query: 70  -RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
              ++AL     F+R R+   +R++R++PEL    DTS+     +N ++   +   
Sbjct: 61  ATTMAALQRARGFLRKRVAEEMRHMRFIPELHLIEDTSIDYSLHINDVIRQIQHER 116


>gi|239947275|ref|ZP_04699028.1| ribosome-binding factor A [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921551|gb|EER21575.1| ribosome-binding factor A [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 122

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 58/119 (48%), Gaps = 2/119 (1%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     NS R  ++   +  AL+ ++   +  D  +    ++I++V ++ DL++A  Y 
Sbjct: 1   MKKLTKTNSYRQQKLASIINEALIEILRRGKMLDSRLFDCPLTITKVIVTADLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
                  + D ++ ALN +   IR  I   + N+++ P++RF YD    +  K+  L+ 
Sbjct: 61  LPFNTKLTIDEIMDALNNSKNAIRNFITNKI-NIKFSPDIRFHYDYGFDNAIKVEELLK 118


>gi|261879008|ref|ZP_06005435.1| ribosome-binding factor A [Prevotella bergensis DSM 17361]
 gi|270334392|gb|EFA45178.1| ribosome-binding factor A [Prevotella bergensis DSM 17361]
          Length = 111

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  +V   ++  L  +  +     R +   ++S+++V +S DL + T Y+S+        
Sbjct: 5   RQNKVSRLLQKELAEIFQSQT---RQMKGVLVSVTKVRISPDLSICTAYLSIFPSEKGSE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +  N K IR  +G+ +RN LR +PELRF  D SL     ++ L+  
Sbjct: 62  LLDNIKANEKTIRYELGKRVRNQLRIIPELRFFIDDSLDYSEHIDELLKK 111


>gi|323356818|ref|YP_004223214.1| ribosome-binding factor A [Microbacterium testaceum StLB037]
 gi|323273189|dbj|BAJ73334.1| ribosome-binding factor A [Microbacterium testaceum StLB037]
          Length = 163

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 54/117 (46%), Gaps = 6/117 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SPD 69
           R  RV + +R  L   +     +D  +    ++I++V ++ DL+ A+V+ ++  D    +
Sbjct: 5   RQARVADRIRVVLAERLEKG-LRDPRLG--FVTITDVRVTGDLQHASVFYTVMGDEAHRN 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
              +AL      +R  +G++L N R  P L F  D   ++   ++AL+   +     
Sbjct: 62  DTAAALKSATGMLRSEVGKNL-NTRLTPTLEFILDAIPENADHISALLREAR-ERDE 116


>gi|119477400|ref|ZP_01617591.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2143]
 gi|119449326|gb|EAW30565.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2143]
          Length = 133

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 58/119 (48%), Gaps = 7/119 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV + ++  L   ++ +E +D  +   ++SI++V +S D+  A V+ ++  
Sbjct: 1   MAREYSRTQRVADFLKQELA-TLIQSEMRDPRVG--MVSITDVEVSRDMSHAKVFTTVLG 57

Query: 65  DVSPDRVISA---LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             S      A   LN    F+R  + + + N R  P+LRF +D+S+     L++L+   
Sbjct: 58  KESEQEAAEAIAVLNKAAGFLRSEMAK-INNARTTPKLRFYFDSSVGRGQFLSSLIDKA 115


>gi|260887253|ref|ZP_05898516.1| ribosome-binding factor A [Selenomonas sputigena ATCC 35185]
 gi|330838990|ref|YP_004413570.1| Ribosome-binding factor A [Selenomonas sputigena ATCC 35185]
 gi|260863315|gb|EEX77815.1| ribosome-binding factor A [Selenomonas sputigena ATCC 35185]
 gi|329746754|gb|AEC00111.1| Ribosome-binding factor A [Selenomonas sputigena ATCC 35185]
          Length = 119

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/108 (28%), Positives = 56/108 (51%), Gaps = 5/108 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           R  +V E ++  +  +IL  E +D  I    +++++V M+ DLR A +++S+        
Sbjct: 5   RIEKVQELMKQEISQIILQ-ELKDPRIG--FVTVTKVEMTGDLREAKIFVSIMGKDEALK 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
             +  L  ++ FIR  IG+ +R LR+ PE+ F  D SL     +  L+
Sbjct: 62  DTLQGLKSSLGFIRREIGKRIR-LRFTPEISFALDDSLAYSSHIQELL 108


>gi|190575261|ref|YP_001973106.1| ribosome-binding factor A [Stenotrophomonas maltophilia K279a]
 gi|254521412|ref|ZP_05133467.1| ribosome-binding factor A [Stenotrophomonas sp. SKA14]
 gi|259552102|sp|B2FN89|RBFA_STRMK RecName: Full=Ribosome-binding factor A
 gi|190013183|emb|CAQ46816.1| putative ribosome-binding factor A [Stenotrophomonas maltophilia
           K279a]
 gi|219719003|gb|EED37528.1| ribosome-binding factor A [Stenotrophomonas sp. SKA14]
          Length = 127

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            PK   R  RV  ++R  L   +++N  ++  +    +S+S+V ++ D+  A V+++  +
Sbjct: 1   MPKTFHRTDRVSAQLRRELG-TLVHNAVREHGLPS--VSVSDVEITRDMAHAKVFVTALM 57

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                  ++ L      +R  + R+++ LR+VPEL F YD S+     ++ ++   
Sbjct: 58  PERSAEAVAGLKELGYRLRMDLARAMK-LRHVPELHFHYDDSVDRGEHIDNILRDL 112


>gi|293400736|ref|ZP_06644881.1| ribosome-binding factor A [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305762|gb|EFE47006.1| ribosome-binding factor A [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 114

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 56/110 (50%), Gaps = 5/110 (4%)

Query: 12  ALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRV 71
           A ++   ++  +  +I   E +D  I    I+I++V ++ DL +A +Y+S     + +  
Sbjct: 5   AEKIAGIIQKEVSEII-QFELKDPKIG--FITITDVTVTNDLSIAKIYVSFLGQKAREEA 61

Query: 72  -ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            + ALN +  FIR  + + L  +R VPEL F  D +L+   K+  ++   
Sbjct: 62  GMKALNRSKGFIRSALAKRL-TMRKVPELHFLIDDALERGNKIEKIISKI 110


>gi|296129358|ref|YP_003636608.1| ribosome-binding factor A [Cellulomonas flavigena DSM 20109]
 gi|296021173|gb|ADG74409.1| ribosome-binding factor A [Cellulomonas flavigena DSM 20109]
          Length = 144

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 49/118 (41%), Gaps = 6/118 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA ++ E ++  +  +I     +D  +    +++++V ++ DL+ A VY ++  D    +
Sbjct: 6   RARKLAERIQQVVAQMIDTR-VKDPRLG--FVTVTDVRVTGDLQHADVYYTVLGDDESRE 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
               AL      IR  +G+    +R  P L F  D   ++   L   +         E
Sbjct: 63  GSAKALESAKGMIRSEVGKQ-TGIRLTPTLAFHLDAVPETAAHLEEAL-SEAARRDAE 118


>gi|227968183|pdb|1KKG|A Chain A, Nmr Structure Of Ribosome-Binding Factor A (Rbfa)
          Length = 108

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 56/109 (51%), Gaps = 6/109 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K   R  RV +E++  +  ++   E +D  +   + ++S V MS DL  A VY++   D 
Sbjct: 3   KEFGRPQRVAQEMQKEIALILQR-EIKDPRL-GMMTTVSGVEMSRDLAYAKVYVTFLNDK 60

Query: 67  SPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWK 112
             D V   I AL     FIR  +G+++R LR VPEL F YD SL    +
Sbjct: 61  DEDAVKAGIKALQEASGFIRSLLGKAMR-LRIVPELTFFYDNSLVEGMR 108


>gi|291562549|emb|CBL41365.1| ribosome-binding factor A [butyrate-producing bacterium SS3/4]
          Length = 131

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 62/127 (48%), Gaps = 9/127 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             KNS + +R+  EV+ AL  +I  +E +D  +   + S+ +V ++ DL++   YIS+  
Sbjct: 1   MRKNSVKNIRINGEVQKALSEII-RSELKDPRVH-PMTSVVQVSVTPDLKICKAYISVLA 58

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL---- 119
            +      I  L     FIR ++ + + NLR  P++ F  D S++   +++ L+      
Sbjct: 59  DEEQAKDTIRGLKSAEGFIRTQLAKKV-NLRNTPQIFFVLDQSIEYGVRMSKLIDEVTKN 117

Query: 120 -PKIPVA 125
            P+    
Sbjct: 118 MPEEQED 124


>gi|313204741|ref|YP_004043398.1| ribosome-binding factor a [Paludibacter propionicigenes WB4]
 gi|312444057|gb|ADQ80413.1| ribosome-binding factor A [Paludibacter propionicigenes WB4]
          Length = 121

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/115 (23%), Positives = 55/115 (47%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L      R +   +I+++ V +S DL +A  ++S+    
Sbjct: 1   METTRQQKISRMLQKELGEIFL---LYARELQGTLITVTAVRVSPDLGIARTHLSIFPSD 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLP 120
               V++ +  + + IR  +G+ +R+ LR VPEL F  D SL     ++ L+   
Sbjct: 58  RSAAVLAKVQDDSRAIRFDLGKRVRHQLRIVPELFFHVDDSLDYLENIDNLLKSD 112


>gi|184155210|ref|YP_001843550.1| ribosome-binding factor A [Lactobacillus fermentum IFO 3956]
 gi|260662290|ref|ZP_05863186.1| ribosome-binding factor A [Lactobacillus fermentum 28-3-CHN]
 gi|238692966|sp|B2GBN8|RBFA_LACF3 RecName: Full=Ribosome-binding factor A
 gi|183226554|dbj|BAG27070.1| ribosome-binding factor A [Lactobacillus fermentum IFO 3956]
 gi|260553673|gb|EEX26565.1| ribosome-binding factor A [Lactobacillus fermentum 28-3-CHN]
          Length = 120

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 58/124 (46%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            P    R  R+ ++++  +  ++L    +D  ++   ++++ V ++ DL+ AT+Y ++  
Sbjct: 1   MPNKQFRVERLAQQIQREVDDILLKR-VRDPRVNG--VTVTGVDVTGDLQQATIYYTILS 57

Query: 65  D--VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 ++  + L+     +R  +G  L   +  PE++F  D S++   +++ L+     
Sbjct: 58  KLASDAEKTQTGLDKATGLVRSELGSRLNIFK-APEIKFVRDPSIEYGSRIDELLNELHK 116

Query: 123 PVAL 126
              L
Sbjct: 117 NNEL 120


>gi|224367582|ref|YP_002601745.1| RbfA [Desulfobacterium autotrophicum HRM2]
 gi|259551968|sp|C0QHM3|RBFA_DESAH RecName: Full=Ribosome-binding factor A
 gi|223690298|gb|ACN13581.1| RbfA [Desulfobacterium autotrophicum HRM2]
          Length = 119

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/122 (27%), Positives = 58/122 (47%), Gaps = 5/122 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K   R+ RV   ++  L   ++  + QD  I   +++IS V ++ DLR+A VY S+  D 
Sbjct: 2   KPYPRSERVAARIQEILSD-LIKKKVQDPRIE--LVTISSVRLTSDLRIAYVYFSVFGDE 58

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
           +  +     L  +  FI+  +   L  LRY+PEL+F +D S      ++ L+        
Sbjct: 59  ARVEEATQGLKSSHGFIKRHVASQL-GLRYMPELKFIHDQSFDRGTHMDQLLKSVLKGDD 117

Query: 126 LE 127
            E
Sbjct: 118 SE 119


>gi|168333343|ref|ZP_02691627.1| ribosome-binding factor A [Epulopiscium sp. 'N.t. morphotype B']
          Length = 116

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 62/113 (54%), Gaps = 1/113 (0%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             +++ +RV EE++  +  +I  +  +D  +   ++S++ V  + DL+ A ++IS+  D 
Sbjct: 1   MANQKIIRVNEEIQKEVAEIIRGDSIKDARMKDIMVSVTAVDTTTDLKNAKIFISVLQDN 60

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
             D V+  LN + KFIR  + R + NLR  PE+ F+ D S+    K+  ++  
Sbjct: 61  KKDDVLDVLNGSSKFIRKELARRI-NLRNTPEISFKLDNSIAYGIKMAKIIHE 112


>gi|239815727|ref|YP_002944637.1| ribosome-binding factor A [Variovorax paradoxus S110]
 gi|259552123|sp|C5CLW4|RBFA_VARPS RecName: Full=Ribosome-binding factor A
 gi|239802304|gb|ACS19371.1| ribosome-binding factor A [Variovorax paradoxus S110]
          Length = 123

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 54/124 (43%), Gaps = 5/124 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  +      RA +V ++++  L  +I   E +D  +   +++I  V ++ D   A +Y 
Sbjct: 1   MPKRKAAAPNRAFKVADQIQRDLTELIAR-ELKDPRVG--MVTIQAVEVTPDYAHAKIYF 57

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           S+           ALN    F+R  + + L ++  VP L F +D + +    +NAL+   
Sbjct: 58  SML-TGDVTETTEALNQAAGFLRNGLFKRL-HIHTVPTLHFLFDRTTERAADMNALIAQA 115

Query: 121 KIPV 124
               
Sbjct: 116 VASR 119


>gi|217967597|ref|YP_002353103.1| ribosome-binding factor A [Dictyoglomus turgidum DSM 6724]
 gi|217336696|gb|ACK42489.1| ribosome-binding factor A [Dictyoglomus turgidum DSM 6724]
          Length = 127

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/121 (28%), Positives = 60/121 (49%), Gaps = 4/121 (3%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK    +  +R  R+   +R  +  ++L    +D  IS  ++ I+ V MS DLR A +Y+
Sbjct: 1   MKQGVIEMRQRQERLSALIRQEVSEILLRR-VKDPRISSFLV-ITGVKMSKDLRYAHIYV 58

Query: 61  SLPL-DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           S+   +    + +  L     FIR  +G+ LR +R+VPE+ F  D SL+   ++   +  
Sbjct: 59  SVYGSEEEKKQTMKGLESAKGFIRSELGKDLR-IRFVPEIFFELDDSLEKGDRILRKLKE 117

Query: 120 P 120
            
Sbjct: 118 L 118


>gi|258516330|ref|YP_003192552.1| ribosome-binding factor A [Desulfotomaculum acetoxidans DSM 771]
 gi|257780035|gb|ACV63929.1| ribosome-binding factor A [Desulfotomaculum acetoxidans DSM 771]
          Length = 119

 Score = 99.8 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 5/115 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  R+ E ++  +  +I+ NE +D  I     SI+ V +S DL  A +++S+       
Sbjct: 3   HRPERLAESIKKEVSDMII-NELKDPRIG--FTSITSVEVSRDLSFAKIFVSVLGTEEEQ 59

Query: 70  R-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           +  + AL+    FIR  IGR +R LR+VPEL F  D S+    K+  L+   ++ 
Sbjct: 60  KATVEALSRANGFIRAEIGRRIR-LRHVPELAFISDQSIAHGTKIMKLLQDVQVQ 113


>gi|330888657|gb|EGH21318.1| ribosome-binding factor A [Pseudomonas syringae pv. mori str.
           301020]
          Length = 131

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 60/117 (51%), Gaps = 8/117 (6%)

Query: 12  ALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRV 71
             R+G++++  L   ++  E +D  +   +++I  V +S D+  A +++++    S + +
Sbjct: 1   TQRIGDQMQRELAQ-LIRREIKDPRVG--LVTIPAVDVSRDVGHAKIFMTVMGQDSAEEI 57

Query: 72  ---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              I  LN    F+R ++ R ++ LR VP+L F YD S+     L+AL+    +   
Sbjct: 58  AQTIKVLNSAAGFLRMQLAREMK-LRSVPQLHFHYDESVVRGAHLSALIER-AVAQD 112


>gi|311695957|gb|ADP98830.1| ribosome-binding factor A [marine bacterium HP15]
          Length = 140

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 65/123 (52%), Gaps = 11/123 (8%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            P+   R  R+G++++  L  +I   E +D  +   +++++ V +S DL  A +Y+SL  
Sbjct: 1   MPREFSRIDRIGDQMQRELAQLIQR-EVKDPRVG--MVTVNAVKVSRDLGYADIYVSLLS 57

Query: 65  D-------VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                         I+ LN    F+RG++GR+++ LR VP+LRF +DT      K+++L+
Sbjct: 58  TEELTEESPEVRESIAVLNKASGFLRGQVGRAMK-LRVVPQLRFHFDTLQGYSRKMDSLI 116

Query: 118 CLP 120
              
Sbjct: 117 REA 119


>gi|297571196|ref|YP_003696970.1| ribosome-binding factor A [Arcanobacterium haemolyticum DSM 20595]
 gi|296931543|gb|ADH92351.1| ribosome-binding factor A [Arcanobacterium haemolyticum DSM 20595]
          Length = 162

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 54/122 (44%), Gaps = 10/122 (8%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVS 67
           + RA +V E ++  +  ++     +D  +   +++I++V ++ DL+ A V+ ++   +  
Sbjct: 3   NPRAAKVAERIQQVVASMLDKQ-IKDPRLG--MVTITDVRVTGDLQHADVFYTVFGSEHD 59

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM-----CLPKI 122
                +AL      IR  +G+ L  LR  P L F  D   +S   +  L+        +I
Sbjct: 60  AKNSGAALKSATGMIRSAVGKQL-GLRLTPTLAFHLDALPESAKSIEDLLVAARFRDEQI 118

Query: 123 PV 124
             
Sbjct: 119 RK 120


>gi|257066117|ref|YP_003152373.1| ribosome-binding factor A [Anaerococcus prevotii DSM 20548]
 gi|256797997|gb|ACV28652.1| ribosome-binding factor A [Anaerococcus prevotii DSM 20548]
          Length = 128

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 64/123 (52%), Gaps = 5/123 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISR-DVISISEVCMSVDLRVATVYISLPLD 65
            N RR  R+  EV+  L  ++  ++  D  +S   +++I++V ++ DL  A  Y+S+  D
Sbjct: 1   MNKRRTERISSEVKKELSKIL-RDDLNDPRLSTEAMVTITDVEVTNDLSYADCYVSVLGD 59

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             + + V+ AL     +I+  IG  +R LR +PE RF+ D S++    ++ L+    I  
Sbjct: 60  ATNKEDVLEALEQAKGYIKILIGERMR-LRSMPEFRFKIDNSIEHGAYMDKLIAET-IAK 117

Query: 125 ALE 127
             +
Sbjct: 118 DKK 120


>gi|260593343|ref|ZP_05858801.1| ribosome-binding factor A [Prevotella veroralis F0319]
 gi|260534619|gb|EEX17236.1| ribosome-binding factor A [Prevotella veroralis F0319]
          Length = 111

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +        R++   ++S++ V +S DL + T Y+S+      D 
Sbjct: 5   RQNRISRLLQKELASIFQTQT---RMMHGVLVSVTRVKVSPDLSICTAYLSIFPSEKGDE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +N N K IR  +G+ + N LR +PELRF  D SL    +++ L+  
Sbjct: 62  LLKNINANEKTIRYELGQRVHNQLRIIPELRFFIDDSLDYIERIDELLKK 111


>gi|160913526|ref|ZP_02076217.1| hypothetical protein EUBDOL_00002 [Eubacterium dolichum DSM 3991]
 gi|158434078|gb|EDP12367.1| hypothetical protein EUBDOL_00002 [Eubacterium dolichum DSM 3991]
          Length = 120

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 27/110 (24%), Positives = 53/110 (48%), Gaps = 5/110 (4%)

Query: 12  ALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRV 71
             ++   ++  +  +I   + +D  I    I+I++V +S DL +A VY+S     + +  
Sbjct: 13  TEKIAGIIQKEVSEII-QFQLKDPKIG--FITITDVVVSGDLSIAKVYVSFLGQKAREAA 69

Query: 72  -ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            + AL  +  FIR  + + +  +R VP L F  D SL+   K+  ++   
Sbjct: 70  GMKALERSKGFIRSELAKRM-TIRKVPSLVFLIDDSLEKGNKIENIIKEL 118


>gi|15892529|ref|NP_360243.1| ribosome-binding factor A [Rickettsia conorii str. Malish 7]
 gi|20139548|sp|Q92I14|RBFA_RICCN RecName: Full=Ribosome-binding factor A
 gi|15619690|gb|AAL03144.1| ribosome-binding factor A [Rickettsia conorii str. Malish 7]
          Length = 120

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 58/121 (47%), Gaps = 2/121 (1%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     +S R  ++   +  AL+ ++   +  D  +    ++I++V ++ DL++A  Y 
Sbjct: 1   MKKLTKTHSHRQQKLASIINEALIEILRRGKMLDSRLFDCPLTITKVIVTADLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                  + D ++ ALN +   IR  I   + N+++ P++RF YD    +  K+  L+  
Sbjct: 61  LPFNTKLTIDEIMDALNNSKNAIRNFITNKI-NMKFSPDIRFHYDHGFDNAIKVAHLLKD 119

Query: 120 P 120
            
Sbjct: 120 L 120


>gi|120556254|ref|YP_960605.1| ribosome-binding factor A [Marinobacter aquaeolei VT8]
 gi|166218447|sp|A1U5Z9|RBFA_MARAV RecName: Full=Ribosome-binding factor A
 gi|120326103|gb|ABM20418.1| ribosome-binding factor A [Marinobacter aquaeolei VT8]
          Length = 143

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 16/133 (12%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             +   R  R+G++++  L  +I   E +D  +   ++++++V +S DL  A +YISL  
Sbjct: 1   MAREYSRVDRIGDQMQRELAQLIQR-EVKDPRVG--MVTVNDVKVSRDLGYADIYISLLS 57

Query: 64  ------LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                         ++ LN    F+RG++GR+++ LR VP LRF +D  L    K++ L+
Sbjct: 58  TEELTEDSPEVQDSLTVLNKASGFLRGQVGRAMK-LRVVPHLRFHFDKLLGQSRKMDRLI 116

Query: 118 CL-----PKIPVA 125
                  P +P  
Sbjct: 117 REAVGDKPAVPRD 129


>gi|226226963|ref|YP_002761069.1| ribosome-binding factor A [Gemmatimonas aurantiaca T-27]
 gi|259551997|sp|C1A8N9|RBFA_GEMAT RecName: Full=Ribosome-binding factor A
 gi|226090154|dbj|BAH38599.1| ribosome-binding factor A [Gemmatimonas aurantiaca T-27]
          Length = 146

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 4/120 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SP 68
           RR  RV E +R  +   +     +D  I R  ++++ V ++ DLR ATV++SL  D    
Sbjct: 5   RRPDRVAEAIREEVATFLSEG-AKDPRI-RAFVTVTAVEVTRDLRHATVFVSLMGDDADK 62

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
               + L      +R ++G+SLR LR  PE+ FR D S+    ++  L+   +     ++
Sbjct: 63  KSTTAGLASVASHLRSQLGKSLR-LRSAPEIHFRTDESVARASRIEHLLAKIRDEREAQE 121


>gi|126664890|ref|ZP_01735874.1| ribosome-binding factor A [Marinobacter sp. ELB17]
 gi|126631216|gb|EBA01830.1| ribosome-binding factor A [Marinobacter sp. ELB17]
          Length = 152

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 34/133 (25%), Positives = 63/133 (47%), Gaps = 16/133 (12%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             +   R  R+G++++  L  +I   E +D  +   +I+++ V +S DL  A +Y+SL  
Sbjct: 1   MAREFSRIDRIGDQMQRELAQLIQR-EIKDPRVG--MITVNAVKVSRDLGYADIYVSLLT 57

Query: 64  ------LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                         ++ LN    F+RG++GR+++ LR VP LRF +D       +L+ L+
Sbjct: 58  TEELGAESPEVKESLAVLNKASGFLRGQVGRAMK-LRVVPLLRFHFDELQGYSRRLDGLI 116

Query: 118 C-----LPKIPVA 125
                  P +   
Sbjct: 117 RKAVGDQPAVSDD 129


>gi|33152522|ref|NP_873875.1| ribosome-binding factor A [Haemophilus ducreyi 35000HP]
 gi|38372437|sp|Q7VLI3|RBFA_HAEDU RecName: Full=Ribosome-binding factor A
 gi|33148745|gb|AAP96264.1| ribosome binding factor A [Haemophilus ducreyi 35000HP]
          Length = 126

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 64/118 (54%), Gaps = 7/118 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +  +R+ RV +E++  +  ++   E +D  I   ++++S+V +S DL  A ++++   
Sbjct: 1   MSREFKRSDRVAQELQKEIAVILQR-EVKDPRIG--MVTVSDVEVSRDLAYAKIFVTFLF 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           D   D +   +  L     +IR  +G+++R LR +PELRF YD SL    +++ L+  
Sbjct: 58  DNDQDIIAQGMKGLEKAGPYIRTLLGKAMR-LRILPELRFIYDQSLVEGMRMSNLVSN 114


>gi|297798442|ref|XP_002867105.1| hypothetical protein ARALYDRAFT_353351 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297312941|gb|EFH43364.1| hypothetical protein ARALYDRAFT_353351 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 787

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 58/127 (45%), Gaps = 13/127 (10%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQD-----------RLISRDVISISEVCMSVDLRVATV 58
           RR   V +++   L  ++L +                     + +IS+V +S DL+V  V
Sbjct: 565 RRVKMVAKQIMRELSDMLLTDTVLQHAVLPEAALGADRYLSSLTTISDVEVSNDLQVVKV 624

Query: 59  YISLPLDVSPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
           Y+S+  D     V  A L    K++R  +G+ ++ LR  PE+RF  D S++   ++ A++
Sbjct: 625 YVSVFGDDRGKDVAIAGLKSKAKYVRSELGKRMK-LRLTPEVRFIEDESMERGSRVIAIL 683

Query: 118 CLPKIPV 124
              K   
Sbjct: 684 DKIKAEK 690


>gi|124267109|ref|YP_001021113.1| ribosome-binding factor A [Methylibium petroleiphilum PM1]
 gi|166218448|sp|A2SH39|RBFA_METPP RecName: Full=Ribosome-binding factor A
 gi|124259884|gb|ABM94878.1| ribosome-binding factor A [Methylibium petroleiphilum PM1]
          Length = 130

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 7/127 (5%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK+K      R LRV ++++  +  +I   E +D  I   +++I  V ++ D   A V+ 
Sbjct: 1   MKHKRAIP-NRGLRVADQIQRDVAGLIR--ELKDPRIG--MVTIQAVEVTPDYAHAKVFF 55

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           S+     P    +ALN    ++R  + + L  +  VP L F++D + +    LNAL+   
Sbjct: 56  SVL-IGDPAECAAALNEAAGYLRNSLFKRL-QIHTVPTLHFQFDRTTERAADLNALIHQA 113

Query: 121 KIPVALE 127
               A +
Sbjct: 114 NATRAKD 120


>gi|238019438|ref|ZP_04599864.1| hypothetical protein VEIDISOL_01307 [Veillonella dispar ATCC 17748]
 gi|237864137|gb|EEP65427.1| hypothetical protein VEIDISOL_01307 [Veillonella dispar ATCC 17748]
          Length = 118

 Score = 99.4 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 61/119 (51%), Gaps = 7/119 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R  ++ E ++  +  +++    +D  I     +I++V ++ DLR AT+Y+SL   D   +
Sbjct: 5   RVRKLQEFIKQEVSQMLMRG-LKDPRIG--FTTITDVHVTGDLREATIYVSLFGSDKEKE 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             + AL      IR  +G+ L+ LR++P + F  DTSL     + +L+   +I    EK
Sbjct: 62  DTLIALKHAAGHIRTELGKVLK-LRHIPSITFDKDTSLDYSMHIESLLN--EIKKDEEK 117


>gi|291519302|emb|CBK74523.1| ribosome-binding factor A [Butyrivibrio fibrisolvens 16/4]
          Length = 124

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 54/116 (46%), Gaps = 4/116 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+ EEV   L  +I   E +D  IS    S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSVKNTRINEEVMRELSNII-RLEVKDPRISPVT-SVVSVEVAPDLKTCKAYISVLG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           D     + I  L  +  FIR  +   + NLR  PE+ F  D S+    K++ L+  
Sbjct: 59  DDEAVAKTIEGLKSSAGFIRRELAHRI-NLRNTPEITFVSDQSIAYAAKMSKLIDE 113


>gi|170758382|ref|YP_001787728.1| ribosome-binding factor A [Clostridium botulinum A3 str. Loch
           Maree]
 gi|238688515|sp|B1KWK6|RBFA_CLOBM RecName: Full=Ribosome-binding factor A
 gi|169405371|gb|ACA53782.1| ribosome-binding factor A [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 120

 Score = 99.4 bits (247), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/115 (28%), Positives = 63/115 (54%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           RA R+ EEV+  +  +I  N+ +D  +   ++S+++V ++ DL+ A VY+S+  +    +
Sbjct: 5   RAGRINEEVKKEVSSIIH-NDIKDPRL-SAMVSVTDVDVTKDLKYAKVYVSIFGNEKAKE 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             + AL  ++ FIR  IGR ++ LR  PE+    D S++    ++ L+   K   
Sbjct: 63  ESLQALKSSVGFIRKEIGRRVK-LRNTPEVIIEVDNSIERGMHIDELLHSIKENK 116


>gi|113868280|ref|YP_726769.1| ribosome-binding factor A [Ralstonia eutropha H16]
 gi|123032888|sp|Q0K9C0|RBFA_RALEH RecName: Full=Ribosome-binding factor A
 gi|113527056|emb|CAJ93401.1| Ribosome-binding factor A [Ralstonia eutropha H16]
          Length = 122

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 59/124 (47%), Gaps = 6/124 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K    S R LR+ ++++  L  +I   E +D  +   ++++  V ++ D   A VY 
Sbjct: 1   MAKKGSI-SSRNLRISDQIQKDLAEMIQR-ELRDPRLG--LVTLQSVALTPDYAHAKVYF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    + +   + LN    ++   + + L ++  VP LRF +DTS++   +++ L+   
Sbjct: 57  TVLGAEAAEA-EAILNEKAGYLHSLLYKRL-HIHTVPTLRFFHDTSVEHAIEMSKLINEA 114

Query: 121 KIPV 124
               
Sbjct: 115 NATR 118


>gi|212709944|ref|ZP_03318072.1| hypothetical protein PROVALCAL_00994 [Providencia alcalifaciens DSM
           30120]
 gi|212687456|gb|EEB46984.1| hypothetical protein PROVALCAL_00994 [Providencia alcalifaciens DSM
           30120]
          Length = 136

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/131 (29%), Positives = 63/131 (48%), Gaps = 12/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R+ RV +E++  +  +IL  E +D  I   + ++S V +S DL    V+++   
Sbjct: 1   MAKEFSRSQRVAQEMQKEIA-IILQREIKDPRIG--MATVSGVELSRDLAYGKVFVTFFN 57

Query: 65  DVSPDRV-------ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
             +           I ALN    FIR  +G+++R LR +PEL F YD SL    +++ L+
Sbjct: 58  FANEKSEEEMVADGIKALNEASGFIRSLLGKAMR-LRIIPELTFEYDNSLVDGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               I    E+
Sbjct: 117 SNV-IRSDEER 126


>gi|229586718|ref|YP_002845219.1| ribosome-binding factor A [Rickettsia africae ESF-5]
 gi|259552067|sp|C3PNG6|RBFA_RICAE RecName: Full=Ribosome-binding factor A
 gi|228021768|gb|ACP53476.1| Ribosome-binding factor A [Rickettsia africae ESF-5]
          Length = 120

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 58/121 (47%), Gaps = 2/121 (1%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     +S R  ++   +  AL+ ++   +  D  +    ++I++V ++ DL++A  Y 
Sbjct: 1   MKKLTKTHSHRQQKLASIINEALIEILRRGKMLDTRLFDCPLTITKVIVTADLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                  + D ++ ALN +   IR  I   + N+++ P++RF YD    +  K+  L+  
Sbjct: 61  LPFNTKLTIDEIMDALNNSKNAIRNFITNKI-NMKFSPDIRFYYDHGFDNAIKVAHLLKD 119

Query: 120 P 120
            
Sbjct: 120 L 120


>gi|303229587|ref|ZP_07316375.1| ribosome-binding factor A [Veillonella atypica ACS-134-V-Col7a]
 gi|302515712|gb|EFL57666.1| ribosome-binding factor A [Veillonella atypica ACS-134-V-Col7a]
          Length = 118

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 60/118 (50%), Gaps = 7/118 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R  ++ E ++  +  +++    +D  I     ++++V ++ DLR AT+Y+SL   D   +
Sbjct: 5   RVRKLQEFIKQEVSQMLMRG-LKDPRIG--FTTVTDVHVTGDLREATIYVSLFGSDKEKE 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
             + AL      +R  +G+ L+ LR++P + F  DTSL     + +L+   +I    E
Sbjct: 62  DTLIALKHASGHVRTELGKVLK-LRHIPTITFDKDTSLDYSMHIESLLN--EIKKDEE 116


>gi|126662574|ref|ZP_01733573.1| ribosome-binding factor A [Flavobacteria bacterium BAL38]
 gi|126625953|gb|EAZ96642.1| ribosome-binding factor A [Flavobacteria bacterium BAL38]
          Length = 130

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/112 (25%), Positives = 60/112 (53%), Gaps = 2/112 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++G  +++ L+ ++   E +   I+  VIS+S+V ++ DL +A V++S+    
Sbjct: 1   METNRQKKIGALLQNDLVSIL-QGEIRKNNINNLVISVSKVNVTSDLSIAKVHLSVFPTD 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALM 117
               +++A+  N   I+  + + ++N LR VP L F  D SL    K++  +
Sbjct: 60  KAPEILAAVKSNAPLIKHDLAQRVKNQLRKVPNLIFYIDDSLDYIEKIDKAL 111


>gi|327312746|ref|YP_004328183.1| ribosome-binding factor A [Prevotella denticola F0289]
 gi|326944148|gb|AEA20033.1| ribosome-binding factor A [Prevotella denticola F0289]
          Length = 111

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +        R++   ++S++ V +S DL + T Y+S+      D 
Sbjct: 5   RQNRISHLLQKELASIFQTQT---RMMHGVLVSVTRVKVSPDLSICTAYLSIFPSEKGDE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +N N K IR  +G+ + N LR +PELRF  D SL    +++ L+  
Sbjct: 62  LLKNINANEKTIRYDLGQRVHNQLRIIPELRFFIDDSLDYIERIDELLKK 111


>gi|313888345|ref|ZP_07822016.1| ribosome-binding factor A [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845748|gb|EFR33138.1| ribosome-binding factor A [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 117

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 37/120 (30%), Positives = 60/120 (50%), Gaps = 4/120 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
            N++R  R+ EEVR  +  + + NE +D  I   + SIS V ++ DL  A VY+S+  D 
Sbjct: 1   MNNKRINRISEEVRKTISNI-VQNELKDPRIPS-ITSISHVEVTNDLSFAKVYVSVLGDD 58

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              D  +  LN    FI+  +   ++ LR +PEL F  D S++   +L+ L+        
Sbjct: 59  YDRDEAVEGLNSAKGFIKKELAHRVK-LRAMPELIFIKDDSIEKAMELDKLIEEVNRKND 117


>gi|290473448|ref|YP_003466315.1| ribosome-binding factor, role in processing of 10S rRNA
           [Xenorhabdus bovienii SS-2004]
 gi|289172748|emb|CBJ79519.1| ribosome-binding factor, role in processing of 10S rRNA
           [Xenorhabdus bovienii SS-2004]
          Length = 136

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/131 (27%), Positives = 64/131 (48%), Gaps = 12/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             +   R  RV +E++  +  +IL  E +D  I   + ++S V +S DL  A V+++   
Sbjct: 1   MAREFSRTQRVAQEMQKEIA-IILQREVKDPRIG--MATVSGVEVSRDLAYAKVFVTFLN 57

Query: 64  ------LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                      +  I ALN    FIR  +G+++R LR +PEL F YD+SL    +++ L+
Sbjct: 58  VLVEGQDSDMVNVGIKALNEASGFIRSLLGKAMR-LRVIPELTFSYDSSLVDGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               +    ++
Sbjct: 117 -TKVVKNDEQR 126


>gi|237808989|ref|YP_002893429.1| ribosome-binding factor A [Tolumonas auensis DSM 9187]
 gi|259552120|sp|C4L8X3|RBFA_TOLAT RecName: Full=Ribosome-binding factor A
 gi|237501250|gb|ACQ93843.1| ribosome-binding factor A [Tolumonas auensis DSM 9187]
          Length = 134

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 66/123 (53%), Gaps = 7/123 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   RA RV ++++  +  ++   E +D  +   ++++S+V ++ DL+ A ++++  L
Sbjct: 1   MAKEFGRADRVAQQIQREIAVILQR-EVKDPRVG--MVTVSDVELTRDLQHAKIFVTFFL 57

Query: 65  D--VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
           +     +  +  LN    +IR  +G++++ LR VPE+RF YD +L    +++ L+    +
Sbjct: 58  NEVDDIEAGVKVLNDASGYIRILMGKAMK-LRVVPEIRFVYDKTLVEGMRISNLVTNT-V 115

Query: 123 PVA 125
              
Sbjct: 116 RDD 118


>gi|330504826|ref|YP_004381695.1| ribosome-binding factor A [Pseudomonas mendocina NK-01]
 gi|328919112|gb|AEB59943.1| ribosome-binding factor A [Pseudomonas mendocina NK-01]
          Length = 129

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 66/127 (51%), Gaps = 9/127 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K+  R  R+G++++  L  V++  E +D  +   +++I+ V +S DL  A V+I++  
Sbjct: 1   MAKDYSRTQRIGDQMQRELA-VLIQREIKDPRLG--LVTITAVDVSRDLSHAKVFITVMG 57

Query: 65  DVSPDRVI----SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                  I      L     ++R  +G+S++ +R +P+L F+YD S++   +L+AL+   
Sbjct: 58  KDDDAEQIKLNLEILGEAAGYLRMLLGKSMK-VRTIPQLHFQYDASIRRGAELSALIER- 115

Query: 121 KIPVALE 127
            +    +
Sbjct: 116 AVAEDRK 122


>gi|257439275|ref|ZP_05615030.1| ribosome-binding factor A [Faecalibacterium prausnitzii A2-165]
 gi|257198150|gb|EEU96434.1| ribosome-binding factor A [Faecalibacterium prausnitzii A2-165]
          Length = 136

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 23/116 (19%), Positives = 53/116 (45%), Gaps = 4/116 (3%)

Query: 14  RVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PDRVI 72
           R+ ++++  ++ +I     +D  +   +++++ + ++ DL VA VY+S+      P   I
Sbjct: 15  RLAQDMKREVIAIIGR--LKDPRLEGGLLTVTRLDVTPDLDVAKVYVSVMGREDGPKPAI 72

Query: 73  SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
            ALN     +R  + + + ++R  P   F  D        +N L+    +    E+
Sbjct: 73  EALNRAAGHVRTEVSKKM-HIRKAPRFIFVEDDGAAYAAHINELLRTLNVNGDAEE 127


>gi|255689941|ref|ZP_05413616.1| ribosome-binding factor A [Bacteroides finegoldii DSM 17565]
 gi|260624547|gb|EEX47418.1| ribosome-binding factor A [Bacteroides finegoldii DSM 17565]
          Length = 110

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 61/113 (53%), Gaps = 4/113 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   ++S+S V +S D+ +A VY+S+    
Sbjct: 1   METTRQNKISRLLQKELSEIFL---LQTKAMPGVLVSVSAVRISPDMSIARVYLSVFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
             + ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL    K+++L+ 
Sbjct: 58  KAEEIVKNVNDNMKTIRYELGTRVRHQLRIIPELKFFVDDSLDYIEKIDSLLK 110


>gi|149375754|ref|ZP_01893522.1| ribosome-binding factor A [Marinobacter algicola DG893]
 gi|149359879|gb|EDM48335.1| ribosome-binding factor A [Marinobacter algicola DG893]
          Length = 145

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 61/123 (49%), Gaps = 11/123 (8%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            P+   R  R+G++++  L  +I   E +D  +   +++++ V +S DL  A VY+SL  
Sbjct: 1   MPREFSRIDRIGDQMQRELAQLIQR-EVKDPRVG--MVTVNAVKVSRDLGYADVYVSLLT 57

Query: 65  DVSPDRVIS-------ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                            LN    F++G++GR+++ LR  P+LRF +DT L     ++ L+
Sbjct: 58  TEELTEESPQVRDSLTVLNKAAGFLKGQVGRAMK-LRVTPQLRFHFDTLLGHSRHMDNLI 116

Query: 118 CLP 120
              
Sbjct: 117 REA 119


>gi|150016087|ref|YP_001308341.1| ribosome-binding factor A [Clostridium beijerinckii NCIMB 8052]
 gi|189039533|sp|A6LSQ5|RBFA_CLOB8 RecName: Full=Ribosome-binding factor A
 gi|149902552|gb|ABR33385.1| ribosome-binding factor A [Clostridium beijerinckii NCIMB 8052]
          Length = 118

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 5/116 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  R+ EE +  +   ++ NE +D  +   +IS+++V ++ DLR A VY+S+    
Sbjct: 1   MANYRGGRINEEFKREISN-LIQNEVKDPRL-TAMISVTDVKVTKDLRYAKVYVSIFSKD 58

Query: 67  SPDRVIS--ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             ++  +  AL     FIR  +G+ + NLR+ PE+    D S+     ++ L+   
Sbjct: 59  DEEKKNNLEALKNASGFIRKSVGQKI-NLRHTPEIIIELDDSINYGMHMDELIQRI 113


>gi|300725871|ref|ZP_07059335.1| ribosome-binding factor A [Prevotella bryantii B14]
 gi|299776859|gb|EFI73405.1| ribosome-binding factor A [Prevotella bryantii B14]
          Length = 111

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 56/110 (50%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +      +   +   ++S++ V +S DL + T Y+S+      + 
Sbjct: 5   RQNRISRLLQKELSLIFETETRK---MRGVMVSVTRVKVSPDLGICTAYLSIFPSEKGEE 61

Query: 71  VISALNCNIKFIRGRIGRSL-RNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           +++ +N N K IR  +G+ + + LR VPELRF  D SL    +++ L+  
Sbjct: 62  LMANINSNEKSIRYELGKRVGKQLRIVPELRFFIDDSLDYIERIDELLKK 111


>gi|295094746|emb|CBK83837.1| ribosome-binding factor A [Coprococcus sp. ART55/1]
          Length = 137

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 4/117 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I   E +D  I   + S+ +V ++ DL+    YIS+  
Sbjct: 1   MRKNSVKNNRINGEVQRELSRIISR-EIKDPRI-SPMTSVVDVVVTPDLKFCKAYISVLG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           D    D   + LN  + +IR  +  S+ NLR  PE+ F  D S++    ++  +   
Sbjct: 59  DQDAVDSTFAGLNSAMGYIRRELAHSV-NLRNTPEITFIMDQSIEYGVSMSHKIDEA 114


>gi|282916530|ref|ZP_06324288.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           D139]
 gi|283770334|ref|ZP_06343226.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus H19]
 gi|282319017|gb|EFB49369.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           D139]
 gi|283460481|gb|EFC07571.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus H19]
          Length = 119

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 35/121 (28%), Positives = 65/121 (53%), Gaps = 5/121 (4%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
               +S RA RVGE+++  LM +I NN+ +D  +    I+I++V ++ DL  A V++++ 
Sbjct: 1   MTRMSSMRAERVGEQMKKELMDII-NNKVKDPRVG--FITITDVVLTNDLSQAKVFLTVL 57

Query: 64  LDVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
            +    +    AL+    FI+  +G  +R LR +PEL + YD S++   K+  ++     
Sbjct: 58  GNDKEVENTFKALDKAKGFIKSELGSRMR-LRIMPELMYEYDQSIEYGNKIERMIQDLHK 116

Query: 123 P 123
            
Sbjct: 117 Q 117


>gi|295102734|emb|CBL00279.1| ribosome-binding factor A [Faecalibacterium prausnitzii L2-6]
          Length = 128

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 52/115 (45%), Gaps = 4/115 (3%)

Query: 14  RVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PDRVI 72
           R+ ++++  L+ +I     +D  +   +++++ + ++ DL VA VY+S+      P   I
Sbjct: 8   RLAQDMKRELIAIIGR--LKDPRLEGGLLTVTRLDVTPDLDVAKVYVSVMGREDGPKPAI 65

Query: 73  SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
            ALN     +R  + + + ++R  P   F  D        +N L+    +    E
Sbjct: 66  EALNRAAGHVRTEVSKKM-HIRKAPRFIFVEDDGAAYAAHINELLRTLNVNGDAE 119


>gi|330997439|ref|ZP_08321290.1| ribosome-binding factor A [Paraprevotella xylaniphila YIT 11841]
 gi|329570813|gb|EGG52529.1| ribosome-binding factor A [Paraprevotella xylaniphila YIT 11841]
          Length = 111

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 57/114 (50%), Gaps = 4/114 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + +    Q + +   ++S+S   +S DL +  VY+S+    
Sbjct: 1   METTRQNKISRLIQKELSEIFM---LQTKAMKGVLVSVSACRISPDLSICRVYLSIFPSR 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
             + +I  +N N+K IR  +G  +R+ LR +PEL+F  D SL     ++ L+  
Sbjct: 58  QSEEIIKNINGNMKAIRYELGTRVRHQLRIIPELKFFVDDSLDYIENIDKLLKE 111


>gi|114562169|ref|YP_749682.1| ribosome-binding factor A [Shewanella frigidimarina NCIMB 400]
 gi|122300516|sp|Q086H1|RBFA_SHEFN RecName: Full=Ribosome-binding factor A
 gi|114333462|gb|ABI70844.1| ribosome-binding factor A [Shewanella frigidimarina NCIMB 400]
          Length = 143

 Score = 99.0 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 10/126 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+ ++++  L  V+   + +D  I    +++++V +S DL  A VY++   
Sbjct: 1   MAKEFSRTRRIAQQLQQELAMVLQR-DMKDPRIG--FVTVNDVDVSRDLSYAKVYVTFFE 57

Query: 65  DVSP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL----MC 118
           + +    + I AL     ++R  +   ++ LR +PELRF YD+SL    +++ L    + 
Sbjct: 58  EDTELVQQKIDALTVAAPYVRTLVAGRMK-LRVMPELRFIYDSSLVEGMRMSNLVTQVIN 116

Query: 119 LPKIPV 124
             K   
Sbjct: 117 KDKAKQ 122


>gi|33866739|ref|NP_898298.1| ribosome-binding factor A [Synechococcus sp. WH 8102]
 gi|39931754|sp|Q7TTS8|RBFA_SYNPX RecName: Full=Ribosome-binding factor A
 gi|33639340|emb|CAE08722.1| possible Ribosome-binding factor A [Synechococcus sp. WH 8102]
          Length = 134

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 58/116 (50%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
           RR  RV   +R     +++N   +D  + + ++SI+ V +S DL+   +++S+  D +  
Sbjct: 5   RRVERVAALIRKETSELLING-IRDERVHQGMVSITNVEVSGDLQHCKIFVSIFGDEASQ 63

Query: 70  -RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
            +V+  L     +++G +GR L  +R  P++ F+ D  ++    +  L+   +   
Sbjct: 64  LQVMEGLQAASGYLKGELGRRL-QMRRAPDVVFQLDRGIERGTSVLGLLNKLEDER 118


>gi|157828480|ref|YP_001494722.1| ribosome-binding factor A [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933198|ref|YP_001649987.1| ribosome-binding factor A [Rickettsia rickettsii str. Iowa]
 gi|166219401|sp|A8GS39|RBFA_RICRS RecName: Full=Ribosome-binding factor A
 gi|189039553|sp|B0BXK5|RBFA_RICRO RecName: Full=Ribosome-binding factor A
 gi|157800961|gb|ABV76214.1| ribosome-binding factor A [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908285|gb|ABY72581.1| hypothetical protein RrIowa_0723 [Rickettsia rickettsii str. Iowa]
          Length = 120

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 58/121 (47%), Gaps = 2/121 (1%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     +S R  ++   +  AL+ ++   +  D  +    ++I++V ++ DL++A  Y 
Sbjct: 1   MKKLTKTHSHRQQKLASIINEALIEILRRGKMLDSRLFDCPLTITKVIVTTDLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                  + D ++ ALN +   IR  I   + ++++ P++RF YD    +  K+  L+  
Sbjct: 61  LPFNTKLTIDEIMDALNNSKNAIRNFITNKI-HMKFSPDIRFHYDHGFDNAIKVAHLLKD 119

Query: 120 P 120
            
Sbjct: 120 L 120


>gi|225572732|ref|ZP_03781487.1| hypothetical protein RUMHYD_00921 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039905|gb|EEG50151.1| hypothetical protein RUMHYD_00921 [Blautia hydrogenotrophica DSM
           10507]
          Length = 126

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 57/120 (47%), Gaps = 4/120 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV  EV   L  +I  NE +D  I   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRVNTEVLRELSNII-RNEIKDPRIH-PMTSVMAVEVAPDLKTCKAYISVLG 58

Query: 65  DVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           +    +  +  L     ++R ++ R+L NLR  PE+RF  D S++    ++ L+      
Sbjct: 59  NQEAQEETMVGLKSAESYVRRQLARNL-NLRNTPEIRFLLDQSIEYGVHMSKLIDEVAKK 117


>gi|212634075|ref|YP_002310600.1| ribosome-binding factor A [Shewanella piezotolerans WP3]
 gi|226736651|sp|B8CKH4|RBFA_SHEPW RecName: Full=Ribosome-binding factor A
 gi|212555559|gb|ACJ28013.1| Ribosome-binding factor A [Shewanella piezotolerans WP3]
          Length = 142

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 59/117 (50%), Gaps = 6/117 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+ ++++  L  V+   + +D  I    +++++V +S DL  A V+++   
Sbjct: 1   MAKEFSRTRRIAQQLQQELAVVLQR-DMKDPRIG--FVTVNDVDVSRDLSYAKVFVTFFE 57

Query: 65  DVSP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           +        + AL+    +IR  +   ++ LR +PELRF YD+SL    +++ L+  
Sbjct: 58  EDEKLVQEKVEALDAAAGYIRSLVAGRMK-LRVMPELRFIYDSSLVEGMRMSNLVSR 113


>gi|206900907|ref|YP_002250934.1| ribosome-binding factor A [Dictyoglomus thermophilum H-6-12]
 gi|226723598|sp|B5YEH6|RBFA_DICT6 RecName: Full=Ribosome-binding factor A
 gi|206740010|gb|ACI19068.1| ribosome-binding factor A [Dictyoglomus thermophilum H-6-12]
          Length = 120

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSP 68
           +R  R+   +R  +  ++L    +D  IS  ++ I+EV MS DLR A +Y+S+   +   
Sbjct: 3   QRQERLSALIREEISEILLRR-VKDPRISSFLV-ITEVKMSKDLRYAHIYVSVYGSEEEK 60

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            + +  L     FIR  +G+ LR +R+VPE+ F  D SL+   ++   +   
Sbjct: 61  KQTMQGLESAKGFIRSELGKDLR-IRFVPEIFFELDDSLEKGDRILRKLKEL 111


>gi|221214878|ref|ZP_03587846.1| ribosome-binding factor A [Burkholderia multivorans CGD1]
 gi|221165105|gb|EED97583.1| ribosome-binding factor A [Burkholderia multivorans CGD1]
          Length = 166

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  +I+  E +D  I   +++I  V ++ D   A VY 
Sbjct: 35  MSRKRTSP-NRNVQIADQIQRDLSELIMR-EVKDPRIG--IVTIQSVELTPDYAHAKVYF 90

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +      P     ALN     +   + + L ++  VP L F YD +++    ++ L+   
Sbjct: 91  TTL-TGDPAATQQALNHASGHLHNLLFKRL-HIHTVPALHFHYDQTIEKAVAMSRLIDEA 148

Query: 121 KIPVALE 127
               A +
Sbjct: 149 NATRAKD 155


>gi|294791741|ref|ZP_06756889.1| ribosome-binding factor A [Veillonella sp. 6_1_27]
 gi|294456971|gb|EFG25333.1| ribosome-binding factor A [Veillonella sp. 6_1_27]
          Length = 118

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 60/118 (50%), Gaps = 7/118 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R  ++ E ++  +  +++    +D  I     +I++V ++ DLR AT+Y+SL   D   +
Sbjct: 5   RVRKLQEFIKQEVSQMLMRG-LKDPRIG--FTTITDVHVTGDLREATIYVSLFGSDKEKE 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
             + AL      IR  +G+ L+ LR++P + F  DTSL     + +L+   +I    E
Sbjct: 62  DTLIALKHAAGHIRTELGKVLK-LRHIPSITFDKDTSLDYSMHIESLLN--EIKKDEE 116


>gi|157964520|ref|YP_001499344.1| ribosome-binding factor A [Rickettsia massiliae MTU5]
 gi|157844296|gb|ABV84797.1| Ribosome-binding factor A [Rickettsia massiliae MTU5]
          Length = 117

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 58/118 (49%), Gaps = 2/118 (1%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     NS R  ++   +  AL+ ++   +  D  +    ++I++V ++ DL++A  Y 
Sbjct: 1   MKKLTKTNSHRQQKLASIINEALIEILRRGKMLDSRLFDCPLTITKVIVTADLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                  + D ++ ALN +   IR  I   + N+++ P++RF YD    +  K+  L+
Sbjct: 61  LPFNTKLTIDEIMDALNNSKNAIRNFITNKI-NMKFSPDIRFHYDYGFDNAIKVAHLL 117


>gi|238927227|ref|ZP_04658987.1| ribosome-binding factor A [Selenomonas flueggei ATCC 43531]
 gi|238885009|gb|EEQ48647.1| ribosome-binding factor A [Selenomonas flueggei ATCC 43531]
          Length = 118

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 34/118 (28%), Positives = 59/118 (50%), Gaps = 5/118 (4%)

Query: 12  ALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-DR 70
             +V E ++  +  +I  NE +D  I    ++++ V  + DLR A +Y+S+  D      
Sbjct: 1   MEKVQELMKQEISDIIF-NELKDPRIG--FVTVTSVACTEDLREAKIYVSVMGDEKKARD 57

Query: 71  VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
            ++ LN ++ F+R  IG+ +R LR+ PE+ F  DTSL     +  L+         EK
Sbjct: 58  TLNGLNSSLGFVRREIGKRIR-LRFTPEISFALDTSLNYSDHIQRLLNEIHEDQPQEK 114


>gi|238650293|ref|YP_002916145.1| ribosome-binding factor A [Rickettsia peacockii str. Rustic]
 gi|259552070|sp|C4K0J6|RBFA_RICPU RecName: Full=Ribosome-binding factor A
 gi|238624391|gb|ACR47097.1| ribosome-binding factor A [Rickettsia peacockii str. Rustic]
          Length = 120

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 58/121 (47%), Gaps = 2/121 (1%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     +S R  ++   +  AL+ ++   +  D  +    ++I++V ++ DL++A  Y 
Sbjct: 1   MKKLTKTHSHRQQKLASIINEALIEILRRGKMLDSRLFDCPLTITKVIVTTDLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                  + D ++ ALN +   IR  I   + N+++ P++RF YD    +  K+  L+  
Sbjct: 61  LPFNTKLTIDEIMDALNNSKNAIRNFITNKI-NMKFSPDIRFHYDHGFDNAIKVAHLLKD 119

Query: 120 P 120
            
Sbjct: 120 L 120


>gi|255011427|ref|ZP_05283553.1| putative ribosome-binding factor A [Bacteroides fragilis 3_1_12]
 gi|313149243|ref|ZP_07811436.1| ribosome-binding factor A [Bacteroides fragilis 3_1_12]
 gi|313138010|gb|EFR55370.1| ribosome-binding factor A [Bacteroides fragilis 3_1_12]
          Length = 110

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 61/113 (53%), Gaps = 4/113 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   ++S+S V +S D+ +A VY+S+    
Sbjct: 1   METTRQNKIARLLQKELSEIFL---LQTKAMPGVLVSVSAVRISPDMSIARVYLSVFPSD 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
             + ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL    K++AL+ 
Sbjct: 58  KSEEMVKNINNNMKSIRFELGTRVRHQLRIIPELKFFVDDSLDYIEKIDALLK 110


>gi|262374028|ref|ZP_06067305.1| ribosome-binding factor A [Acinetobacter junii SH205]
 gi|262311039|gb|EEY92126.1| ribosome-binding factor A [Acinetobacter junii SH205]
          Length = 133

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 53/120 (44%), Gaps = 11/120 (9%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-- 66
           S+R  R+ + V+  L   ++  E +D  +   +++IS V +S DL  A VY+++      
Sbjct: 4   SQRLKRMADSVQRELSE-LIRQELKDPRLGG-LVTISAVKVSADLGYAEVYVTVMGRELG 61

Query: 67  ------SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 +    +  LN    F+R  + R ++  R  P LRF YD +      +  L+   
Sbjct: 62  DEQSEAANKETLDVLNKASGFLRHELSRRIKT-RITPRLRFHYDKTNAYGNYMFGLIAEA 120


>gi|312898339|ref|ZP_07757729.1| ribosome-binding factor A [Megasphaera micronuciformis F0359]
 gi|310620258|gb|EFQ03828.1| ribosome-binding factor A [Megasphaera micronuciformis F0359]
          Length = 115

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 62/114 (54%), Gaps = 5/114 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R  ++ E ++  +  ++L  E +D  +    +++++  ++ DLR ATVY+SL   D    
Sbjct: 5   RVRKIQEFIKQEVSRIVLQ-ELKDPRLG--FVTVTDARITGDLREATVYVSLFGSDEEKK 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
             ++AL+    +IR  +G+ L  +RY P++ F+ D SL+   K+ +++   +  
Sbjct: 62  NTLAALSKAQGYIRSEVGKRL-GIRYSPQIEFKEDESLEYGMKIESILHDIEKK 114


>gi|3914553|sp|O34272|RBFA_YEREN RecName: Full=Ribosome-binding factor A
 gi|2462713|emb|CAA71698.1| yhbB [Yersinia enterocolitica]
          Length = 133

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 33/128 (25%), Positives = 62/128 (48%), Gaps = 12/128 (9%)

Query: 8   NSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP---- 63
              R+ RV +E++  +  ++   E +D  +   + ++S + +S DL  A V+++      
Sbjct: 1   EFSRSQRVSQEMQKEIALILQR-EIKDPRVG--MATVSGIELSRDLAYAKVFVTFLNVLT 57

Query: 64  ---LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 +    I AL     +IR  +G+++R LR VPEL F YD SL    +++ L+   
Sbjct: 58  DNADPDTAKNGIKALQDASGYIRTLLGKAMR-LRIVPELTFAYDNSLIEGMRMSNLVTNV 116

Query: 121 KIPVALEK 128
            I   +E+
Sbjct: 117 -IKNDVER 123


>gi|24378915|ref|NP_720870.1| ribosome-binding factor A [Streptococcus mutans UA159]
 gi|29427727|sp|Q8DVP8|RBFA_STRMU RecName: Full=Ribosome-binding factor A
 gi|24376799|gb|AAN58176.1|AE014889_1 ribosome binding factor A [Streptococcus mutans UA159]
          Length = 116

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 59/120 (49%), Gaps = 6/120 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
            ++ R  RVG E++  +  ++   + +D  +    ++I++V MS DL +A VY ++  D 
Sbjct: 1   MSNHRIERVGMEIKREVNEILQK-KVRDPRVQG--VTITDVQMSGDLSLAKVYYTIMSDL 57

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                +V   L      I+  +G++L  +  +P+L F  D S++   K++ ++   +   
Sbjct: 58  ASDNQKVQIGLEKAKGTIKRELGKNL-TMYKIPDLTFIKDESIEYGNKIDQMLRDLEKRN 116


>gi|163814222|ref|ZP_02205614.1| hypothetical protein COPEUT_00376 [Coprococcus eutactus ATCC 27759]
 gi|158450671|gb|EDP27666.1| hypothetical protein COPEUT_00376 [Coprococcus eutactus ATCC 27759]
          Length = 134

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 4/117 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I   E +D  I   + S+ +V ++ DL+    YIS+  
Sbjct: 1   MRKNSVKNNRINGEVQRELSRIISR-EIKDPRI-SPMTSVVDVVVTPDLKFCKAYISVLG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           D    D   + L   + +IR  +  S+ NLR  PE+ F  D S++    ++  +   
Sbjct: 59  DQDAVDSTFAGLTSAMGYIRRELAHSV-NLRNTPEITFIMDQSIEYGVNMSHKIDEA 114


>gi|149369322|ref|ZP_01889174.1| ribosome-binding factor A [unidentified eubacterium SCB49]
 gi|149356749|gb|EDM45304.1| ribosome-binding factor A [unidentified eubacterium SCB49]
          Length = 131

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 58/115 (50%), Gaps = 2/115 (1%)

Query: 8   NSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS 67
            S R  ++   ++  L  V+  N  ++      +IS+S+V ++VDL +A VY+S+    +
Sbjct: 3   ESNRQKKIAGVLQEDLAGVL-QNILRESGQLGTLISVSKVNVTVDLSIAKVYVSVFPTTN 61

Query: 68  PDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
              ++  +N     I+ ++ +  R+ LR +PEL F  D SL    +++  +   +
Sbjct: 62  AAAIVKEINDGKSKIKHQVAQLTRHQLRRMPELHFFNDDSLDYIEQIDEAVKGKE 116


>gi|34580479|ref|ZP_00141959.1| ribosome-binding factor A [Rickettsia sibirica 246]
 gi|28261864|gb|EAA25368.1| ribosome-binding factor A [Rickettsia sibirica 246]
          Length = 120

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 57/121 (47%), Gaps = 2/121 (1%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     +S R  ++   +   L+ ++   +  D  +    ++I++V ++ DL++A  Y 
Sbjct: 1   MKKLTKTHSHRQQKLASIINEVLIEILRRGKMLDTRLFDCPLTITKVIVTADLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                  + D ++ ALN +   IR  I   + N+++ P++RF YD    +  K+  L+  
Sbjct: 61  LPFNTKLTIDEIMDALNNSKNAIRNFITNKI-NMKFSPDIRFHYDHGFDNAIKVAHLLKD 119

Query: 120 P 120
            
Sbjct: 120 L 120


>gi|193214187|ref|YP_001995386.1| ribosome-binding factor A [Chloroherpeton thalassium ATCC 35110]
 gi|238692695|sp|B3QUN3|RBFA_CHLT3 RecName: Full=Ribosome-binding factor A
 gi|193087664|gb|ACF12939.1| ribosome-binding factor A [Chloroherpeton thalassium ATCC 35110]
          Length = 125

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 46/114 (40%), Gaps = 6/114 (5%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S R  RV E ++  L  +      +    S  + +I  V ++ DL +A VY+S+      
Sbjct: 2   SIRTERVAELIQRELSGIFEKELPR----SGVLTTIVGVKITPDLSIARVYVSILGSKEM 57

Query: 69  -DRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLP 120
              V++ +    K  R  +   +R+  + +P L F  D        +N L+   
Sbjct: 58  GASVMAHIQKENKHFRKLLSSKIRHQFKRMPSLEFYQDDLFDQAAHINELIRKA 111


>gi|319944108|ref|ZP_08018386.1| ribosome-binding factor A [Lautropia mirabilis ATCC 51599]
 gi|319742602|gb|EFV95011.1| ribosome-binding factor A [Lautropia mirabilis ATCC 51599]
          Length = 156

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 52/116 (44%), Gaps = 6/116 (5%)

Query: 14  RVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD--RV 71
           RV E +   +   ++  E +D  +   +++++ V ++ D   ATV+ S+  D        
Sbjct: 2   RVTELLHQEIAE-LIRTEVKDPRLG--LVTVTGVDLTPDYAHATVHFSVLPDDDERVAET 58

Query: 72  ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           +  L     F+R  +GR +R +   PEL F +D S Q   ++  L+       A +
Sbjct: 59  LRGLRAASGFLRSLVGRRVR-IHTTPELHFVHDASAQRGIEMGRLIDEANSRRAAD 113


>gi|148267760|ref|YP_001246703.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus JH9]
 gi|151221391|ref|YP_001332213.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|253731889|ref|ZP_04866054.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253733492|ref|ZP_04867657.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257425324|ref|ZP_05601749.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257427985|ref|ZP_05604383.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257430618|ref|ZP_05607000.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433378|ref|ZP_05609736.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257436220|ref|ZP_05612267.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           M876]
 gi|257795674|ref|ZP_05644653.1| ribosome-binding factor A [Staphylococcus aureus A9781]
 gi|258416077|ref|ZP_05682345.1| ribosome-binding factor A [Staphylococcus aureus A9763]
 gi|258421660|ref|ZP_05684584.1| ribosome-binding factor A [Staphylococcus aureus A9719]
 gi|258423889|ref|ZP_05686774.1| ribosome-binding factor A [Staphylococcus aureus A9635]
 gi|258434816|ref|ZP_05688890.1| ribosome-binding factor A [Staphylococcus aureus A9299]
 gi|258444608|ref|ZP_05692937.1| ribosome-binding factor A [Staphylococcus aureus A8115]
 gi|258447559|ref|ZP_05695703.1| ribosome-binding factor A [Staphylococcus aureus A6300]
 gi|258449401|ref|ZP_05697504.1| ribosome-binding factor A [Staphylococcus aureus A6224]
 gi|258452569|ref|ZP_05700575.1| ribosome-binding factor A [Staphylococcus aureus A5948]
 gi|258454780|ref|ZP_05702744.1| ribosome-binding factor A [Staphylococcus aureus A5937]
 gi|282892758|ref|ZP_06300993.1| ribosome-binding factor A [Staphylococcus aureus A8117]
 gi|282903825|ref|ZP_06311713.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           C160]
 gi|282905588|ref|ZP_06313443.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908563|ref|ZP_06316393.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282910842|ref|ZP_06318645.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914047|ref|ZP_06321834.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           M899]
 gi|282918969|ref|ZP_06326704.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           C427]
 gi|282920514|ref|ZP_06328235.1| ribosome-binding factor A [Staphylococcus aureus A9765]
 gi|282924092|ref|ZP_06331768.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           C101]
 gi|282927612|ref|ZP_06335228.1| ribosome-binding factor A [Staphylococcus aureus A10102]
 gi|283958013|ref|ZP_06375464.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293501079|ref|ZP_06666930.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510041|ref|ZP_06668749.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           M809]
 gi|297208084|ref|ZP_06924515.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297591285|ref|ZP_06949923.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus MN8]
 gi|300912165|ref|ZP_07129608.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304381166|ref|ZP_07363819.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|147740829|gb|ABQ49127.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus JH9]
 gi|150374191|dbj|BAF67451.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus str.
           Newman]
 gi|253724299|gb|EES93028.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253728546|gb|EES97275.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257271781|gb|EEV03919.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257274826|gb|EEV06313.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278746|gb|EEV09365.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281471|gb|EEV11608.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257284502|gb|EEV14622.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           M876]
 gi|257789646|gb|EEV27986.1| ribosome-binding factor A [Staphylococcus aureus A9781]
 gi|257839225|gb|EEV63701.1| ribosome-binding factor A [Staphylococcus aureus A9763]
 gi|257842346|gb|EEV66771.1| ribosome-binding factor A [Staphylococcus aureus A9719]
 gi|257845918|gb|EEV69947.1| ribosome-binding factor A [Staphylococcus aureus A9635]
 gi|257849177|gb|EEV73159.1| ribosome-binding factor A [Staphylococcus aureus A9299]
 gi|257850101|gb|EEV74054.1| ribosome-binding factor A [Staphylococcus aureus A8115]
 gi|257853750|gb|EEV76709.1| ribosome-binding factor A [Staphylococcus aureus A6300]
 gi|257857389|gb|EEV80287.1| ribosome-binding factor A [Staphylococcus aureus A6224]
 gi|257859787|gb|EEV82629.1| ribosome-binding factor A [Staphylococcus aureus A5948]
 gi|257863163|gb|EEV85927.1| ribosome-binding factor A [Staphylococcus aureus A5937]
 gi|269940761|emb|CBI49143.1| putative ribosome-binding factor A [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282314064|gb|EFB44456.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           C101]
 gi|282316779|gb|EFB47153.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           C427]
 gi|282322115|gb|EFB52439.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           M899]
 gi|282325447|gb|EFB55756.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282327625|gb|EFB57908.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282330880|gb|EFB60394.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282590615|gb|EFB95692.1| ribosome-binding factor A [Staphylococcus aureus A10102]
 gi|282594176|gb|EFB99163.1| ribosome-binding factor A [Staphylococcus aureus A9765]
 gi|282595443|gb|EFC00407.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           C160]
 gi|282764755|gb|EFC04880.1| ribosome-binding factor A [Staphylococcus aureus A8117]
 gi|283470485|emb|CAQ49696.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           ST398]
 gi|283790162|gb|EFC28979.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|291096084|gb|EFE26345.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291466985|gb|EFF09503.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           M809]
 gi|296887327|gb|EFH26229.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297576171|gb|EFH94887.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus MN8]
 gi|300886411|gb|EFK81613.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302751093|gb|ADL65270.1| ribosome-binding factor A (P15B PROTEIN) [Staphylococcus aureus
           subsp. aureus str. JKD6008]
 gi|304340149|gb|EFM06090.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312438350|gb|ADQ77421.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|320140913|gb|EFW32760.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320144371|gb|EFW36137.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323441050|gb|EGA98757.1| ribosome-binding factor A [Staphylococcus aureus O11]
 gi|323443919|gb|EGB01530.1| ribosome-binding factor A [Staphylococcus aureus O46]
 gi|329313940|gb|AEB88353.1| Ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329727531|gb|EGG63987.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           21172]
 gi|329727805|gb|EGG64256.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           21189]
 gi|329733675|gb|EGG70003.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           21193]
          Length = 130

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 66/123 (53%), Gaps = 5/123 (4%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K     +S RA RVGE+++  LM +I NN+ +D  +    I+I++V ++ DL  A V+++
Sbjct: 10  KEVTRMSSMRAERVGEQMKKELMDII-NNKVKDPRVG--FITITDVVLTNDLSQAKVFLT 66

Query: 62  LPLDVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +  +    +    AL+    FI+  +G  +R LR +PEL + YD S++   K+  ++   
Sbjct: 67  VLGNDKEVENTFKALDKAKGFIKSELGSRMR-LRIMPELMYEYDQSIEYGNKIERMIQDL 125

Query: 121 KIP 123
              
Sbjct: 126 HKQ 128


>gi|269797848|ref|YP_003311748.1| ribosome-binding factor A [Veillonella parvula DSM 2008]
 gi|269094477|gb|ACZ24468.1| ribosome-binding factor A [Veillonella parvula DSM 2008]
          Length = 118

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 7/118 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R  ++ E ++  +  +++    +D  I     +I++V ++ DLR AT+Y+SL   D    
Sbjct: 5   RVRKLQEFIKQEVSQMLMRG-LKDPRIG--FTTITDVHVTGDLREATIYVSLFGSDKEKQ 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
             + AL      IR  +G+ L+ LR++P + F  DTSL     + +L+   +I    E
Sbjct: 62  DTLIALKHAAGHIRTELGKVLK-LRHIPSITFDKDTSLDYSMHIESLLN--EIKKDEE 116


>gi|121600095|ref|YP_992836.1| ribosome-binding factor A [Burkholderia mallei SAVP1]
 gi|124383895|ref|YP_001026179.1| ribosome-binding factor A [Burkholderia mallei NCTC 10229]
 gi|126440943|ref|YP_001058780.1| ribosome-binding factor A [Burkholderia pseudomallei 668]
 gi|126448377|ref|YP_001080551.1| ribosome-binding factor A [Burkholderia mallei NCTC 10247]
 gi|126454142|ref|YP_001066032.1| ribosome-binding factor A [Burkholderia pseudomallei 1106a]
 gi|134282412|ref|ZP_01769117.1| ribosome-binding factor A [Burkholderia pseudomallei 305]
 gi|167001015|ref|ZP_02266816.1| ribosome-binding factor A [Burkholderia mallei PRL-20]
 gi|167824414|ref|ZP_02455885.1| ribosome-binding factor A [Burkholderia pseudomallei 9]
 gi|167911164|ref|ZP_02498255.1| ribosome-binding factor A [Burkholderia pseudomallei 112]
 gi|226199713|ref|ZP_03795266.1| ribosome-binding factor A [Burkholderia pseudomallei Pakistan 9]
 gi|237812043|ref|YP_002896494.1| ribosome-binding factor A [Burkholderia pseudomallei MSHR346]
 gi|238563927|ref|ZP_00438018.2| ribosome-binding factor A [Burkholderia mallei GB8 horse 4]
 gi|242316055|ref|ZP_04815071.1| ribosome-binding factor A [Burkholderia pseudomallei 1106b]
 gi|254261738|ref|ZP_04952792.1| ribosome-binding factor A [Burkholderia pseudomallei 1710a]
 gi|76580488|gb|ABA49963.1| ribosome-binding factor A [Burkholderia pseudomallei 1710b]
 gi|121228905|gb|ABM51423.1| ribosome-binding factor A [Burkholderia mallei SAVP1]
 gi|124291915|gb|ABN01184.1| ribosome-binding factor A [Burkholderia mallei NCTC 10229]
 gi|126220436|gb|ABN83942.1| ribosome-binding factor A [Burkholderia pseudomallei 668]
 gi|126227784|gb|ABN91324.1| ribosome-binding factor A [Burkholderia pseudomallei 1106a]
 gi|126241247|gb|ABO04340.1| ribosome-binding factor A [Burkholderia mallei NCTC 10247]
 gi|134246450|gb|EBA46539.1| ribosome-binding factor A [Burkholderia pseudomallei 305]
 gi|225928299|gb|EEH24333.1| ribosome-binding factor A [Burkholderia pseudomallei Pakistan 9]
 gi|237506713|gb|ACQ99031.1| ribosome-binding factor A [Burkholderia pseudomallei MSHR346]
 gi|238519663|gb|EEP83132.1| ribosome-binding factor A [Burkholderia mallei GB8 horse 4]
 gi|242139294|gb|EES25696.1| ribosome-binding factor A [Burkholderia pseudomallei 1106b]
 gi|243063193|gb|EES45379.1| ribosome-binding factor A [Burkholderia mallei PRL-20]
 gi|254220427|gb|EET09811.1| ribosome-binding factor A [Burkholderia pseudomallei 1710a]
          Length = 138

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  +I+  E +D  I   +++I  V ++ D   A VY 
Sbjct: 17  MSKKRSSP-NRNVQIADQIQRDLSELIMR-EVKDPRIG--IVTIQSVELTPDYAHAKVYF 72

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +       D    ALN     +   + + L ++  VP L F YD +++    ++ L+   
Sbjct: 73  TALTGTPAD-TQEALNHAAGHLHNLLFKRL-HIHTVPTLHFHYDQTIEKAVAMSRLIDEA 130

Query: 121 KIPVALE 127
               A +
Sbjct: 131 NATRAKD 137


>gi|86148616|ref|ZP_01066899.1| ribosome-binding factor A [Vibrio sp. MED222]
 gi|218710444|ref|YP_002418065.1| ribosome-binding factor A [Vibrio splendidus LGP32]
 gi|254789773|sp|B7VJH6|RBFA_VIBSL RecName: Full=Ribosome-binding factor A
 gi|85833607|gb|EAQ51782.1| ribosome-binding factor A [Vibrio sp. MED222]
 gi|218323463|emb|CAV19640.1| ribosome-binding factor A [Vibrio splendidus LGP32]
          Length = 137

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 67/126 (53%), Gaps = 8/126 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  I   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVSQQLQKELALILQR-EVRDSRIG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   +R  +G+ +R+ R  PE+RF YD +L    +++ L+   ++
Sbjct: 58  IGEQTPESCLAALKEHEVPVRMALGKRIRH-RLTPEVRFTYDNTLVEGMRMSNLVS--EV 114

Query: 123 PVALEK 128
               ++
Sbjct: 115 LNDDKR 120


>gi|332519405|ref|ZP_08395872.1| ribosome-binding factor A [Lacinutrix algicola 5H-3-7-4]
 gi|332045253|gb|EGI81446.1| ribosome-binding factor A [Lacinutrix algicola 5H-3-7-4]
          Length = 133

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/115 (26%), Positives = 58/115 (50%), Gaps = 2/115 (1%)

Query: 8   NSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS 67
            S+R  ++G  ++  L+ ++         +   +IS+S+V ++VDL VA VY+S+  +  
Sbjct: 5   ESQRQKKIGSVLQRDLVDIL-QTAATQGGMRGVIISVSKVSVTVDLSVAKVYLSIFPNDK 63

Query: 68  PDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
              ++  +  N  FIR  + +  +N LR +P+L F  D SL+   K+   +    
Sbjct: 64  AKELVEGIKSNQPFIRHELAKRTKNQLRRMPQLYFFVDDSLEHIDKIEQSLKRED 118


>gi|160884142|ref|ZP_02065145.1| hypothetical protein BACOVA_02119 [Bacteroides ovatus ATCC 8483]
 gi|237717204|ref|ZP_04547685.1| ribosome-binding factor A [Bacteroides sp. D1]
 gi|237721800|ref|ZP_04552281.1| ribosome-binding factor A [Bacteroides sp. 2_2_4]
 gi|260173073|ref|ZP_05759485.1| putative ribosome-binding factor A [Bacteroides sp. D2]
 gi|262405972|ref|ZP_06082522.1| ribosome-binding factor A [Bacteroides sp. 2_1_22]
 gi|293372464|ref|ZP_06618848.1| ribosome-binding factor A [Bacteroides ovatus SD CMC 3f]
 gi|294647944|ref|ZP_06725496.1| ribosome-binding factor A [Bacteroides ovatus SD CC 2a]
 gi|294806342|ref|ZP_06765189.1| ribosome-binding factor A [Bacteroides xylanisolvens SD CC 1b]
 gi|298479976|ref|ZP_06998175.1| ribosome-binding factor A [Bacteroides sp. D22]
 gi|299144799|ref|ZP_07037867.1| ribosome-binding factor A [Bacteroides sp. 3_1_23]
 gi|315921350|ref|ZP_07917590.1| ribosome-binding factor A [Bacteroides sp. D2]
 gi|156110484|gb|EDO12229.1| hypothetical protein BACOVA_02119 [Bacteroides ovatus ATCC 8483]
 gi|229443187|gb|EEO48978.1| ribosome-binding factor A [Bacteroides sp. D1]
 gi|229448669|gb|EEO54460.1| ribosome-binding factor A [Bacteroides sp. 2_2_4]
 gi|262356847|gb|EEZ05937.1| ribosome-binding factor A [Bacteroides sp. 2_1_22]
 gi|292632647|gb|EFF51241.1| ribosome-binding factor A [Bacteroides ovatus SD CMC 3f]
 gi|292636852|gb|EFF55318.1| ribosome-binding factor A [Bacteroides ovatus SD CC 2a]
 gi|294446598|gb|EFG15218.1| ribosome-binding factor A [Bacteroides xylanisolvens SD CC 1b]
 gi|295085580|emb|CBK67103.1| ribosome-binding factor A [Bacteroides xylanisolvens XB1A]
 gi|298273785|gb|EFI15347.1| ribosome-binding factor A [Bacteroides sp. D22]
 gi|298515290|gb|EFI39171.1| ribosome-binding factor A [Bacteroides sp. 3_1_23]
 gi|313695225|gb|EFS32060.1| ribosome-binding factor A [Bacteroides sp. D2]
          Length = 110

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 61/113 (53%), Gaps = 4/113 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   ++S+S V +S D+ +A VY+S+    
Sbjct: 1   METTRQNKISRLLQKELSEIFL---LQTKSMPGTLVSVSAVRISPDMSIARVYLSVFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
             + ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL    K+++L+ 
Sbjct: 58  KAEEMVKNINNNMKSIRYELGTRVRHQLRIIPELKFFVDDSLDYIEKIDSLLK 110


>gi|317482181|ref|ZP_07941204.1| ribosome-binding factor A [Bifidobacterium sp. 12_1_47BFAA]
 gi|316916415|gb|EFV37814.1| ribosome-binding factor A [Bifidobacterium sp. 12_1_47BFAA]
          Length = 158

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 53/128 (41%), Gaps = 10/128 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
               + RA R+   ++  +   I   E  D+ +    I+++EV ++ DL++A VY +   
Sbjct: 1   MAGTNPRAARIAALIQRVVASSIER-ELHDKRL--ASITVTEVRVTNDLQIAKVYWTQLG 57

Query: 65  DV-----SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                     R   AL+     +R  +G     LR  P+L+F +D       ++  ++ +
Sbjct: 58  HEGHEEGERKRAQQALDQAKGHLRSLVGHK-AGLRLTPQLQFVFDEVPGEAHEIEDILAV 116

Query: 120 PKIPVALE 127
            K     E
Sbjct: 117 AK-KRDEE 123


>gi|302878490|ref|YP_003847054.1| ribosome-binding factor A [Gallionella capsiferriformans ES-2]
 gi|302581279|gb|ADL55290.1| ribosome-binding factor A [Gallionella capsiferriformans ES-2]
          Length = 121

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 58/120 (48%), Gaps = 6/120 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            N  R  RVG++++  +   ++  E  D  +   +++I+ V ++ D   A ++ +     
Sbjct: 2   ANFARTDRVGQQMQREIAQ-LVRLEINDPRVK--LVTITGVEVAGDYSHAKIFFTRLDGK 58

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             +     L+    F+R R+ RS++ LR +P+L F +D+S++    L+ L+    +    
Sbjct: 59  QAE-AQEGLDRAAGFLRSRLARSIK-LRIMPQLHFVFDSSVERGSHLSQLI-DKAVASDF 115


>gi|27365058|ref|NP_760586.1| ribosome-binding factor A [Vibrio vulnificus CMCP6]
 gi|161486605|ref|NP_935500.2| ribosome-binding factor A [Vibrio vulnificus YJ016]
 gi|320155442|ref|YP_004187821.1| ribosome-binding factor A [Vibrio vulnificus MO6-24/O]
 gi|29427705|sp|Q8DBV9|RBFA_VIBVU RecName: Full=Ribosome-binding factor A
 gi|39931703|sp|Q7MI10|RBFA_VIBVY RecName: Full=Ribosome-binding factor A
 gi|27361204|gb|AAO10113.1| ribosome-binding factor A [Vibrio vulnificus CMCP6]
 gi|319930754|gb|ADV85618.1| ribosome-binding factor A [Vibrio vulnificus MO6-24/O]
          Length = 131

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 65/123 (52%), Gaps = 7/123 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K+  R  RV ++++  L  ++   E +D  +   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKDFSRTQRVSQQLQKELAMILQR-EVRDSRLG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   IR  +G+ +R LR  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPESCLAALREHEVHIRMMLGKRIR-LRLTPEVRFYYDNTLVEGMRMSNLV-TEVV 115

Query: 123 PVA 125
              
Sbjct: 116 NKD 118


>gi|160932910|ref|ZP_02080299.1| hypothetical protein CLOLEP_01751 [Clostridium leptum DSM 753]
 gi|156867984|gb|EDO61356.1| hypothetical protein CLOLEP_01751 [Clostridium leptum DSM 753]
          Length = 113

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 53/116 (45%), Gaps = 4/116 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP-LD 65
             S R  R  E+++  L  ++   E +D  +   ++S+  V ++ DL    VY+S     
Sbjct: 1   MASHRIDRTTEDIKRELTAILR--ELKDPRVQETMLSVVRVEVTNDLSYCKVYVSSMEGM 58

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               R +  L     FIR  +G  + ++R+VP L+F+   S++    +  L+   K
Sbjct: 59  DHAKRAVEGLKSAAGFIRRELGARI-HIRHVPSLQFQATDSIEYSANIAKLLNDLK 113


>gi|332884608|gb|EGK04865.1| ribosome-binding factor A [Dysgonomonas mossii DSM 22836]
          Length = 118

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/115 (21%), Positives = 55/115 (47%), Gaps = 4/115 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ R  ++   ++  L  +        + +   ++++S V ++ DL +A VY+S+    
Sbjct: 1   MDTTRQQKINRLIQKELSEIFRKQT---QQMKGVLVTVSTVRVTPDLGLAKVYLSIFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSL-RNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
               ++  +  N+K IR  +G+ + + LR +PEL F  D SL     ++ L+   
Sbjct: 58  KGKELLENIRTNVKSIRFDLGQKVGKQLRVIPELAFYLDDSLDYLENIDRLLNKD 112


>gi|157803804|ref|YP_001492353.1| ribosome-binding factor A [Rickettsia canadensis str. McKiel]
 gi|157785067|gb|ABV73568.1| ribosome-binding factor A [Rickettsia canadensis str. McKiel]
          Length = 144

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/130 (21%), Positives = 60/130 (46%), Gaps = 3/130 (2%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     N+ R  ++   +   L+ ++   +  D  +    ++I++V ++ DL++A  Y 
Sbjct: 16  MKKLTKTNAHRQQKLASIINEVLIEILRRGKMLDIRLFNCPLAITKVIVTADLKIANCYF 75

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                  + D ++ ALN +   IR  +   + N+++ PE+RF YD    +  K+  L+  
Sbjct: 76  LPFNTKLTIDDIMDALNNSKNAIRNFVTNKI-NMKFSPEIRFHYDHGFDNAIKVEKLLKN 134

Query: 120 PKI-PVALEK 128
             +     +K
Sbjct: 135 ISLKRRDKDK 144


>gi|90581548|ref|ZP_01237341.1| ribosome-binding factor A [Vibrio angustum S14]
 gi|90437310|gb|EAS62508.1| ribosome-binding factor A [Vibrio angustum S14]
          Length = 132

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 6/118 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E ++  +   + +IS V +S D+  A VYI+   
Sbjct: 1   MAKEFSRTQRVAQQLQKELALILQR-ELKEPRL--AMTTISSVDVSRDMGYAKVYITFLT 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             D + +  ++ L     +IR  +G+ +R LR  PEL F +D SL    +++ L+   
Sbjct: 58  IGDQTEEESLAILREKAPYIRSLLGKQIR-LRVTPELNFIFDQSLTEGMRISNLVSKA 114


>gi|325860163|ref|ZP_08173288.1| ribosome-binding factor A [Prevotella denticola CRIS 18C-A]
 gi|327312736|ref|YP_004328173.1| ribosome-binding factor A [Prevotella denticola F0289]
 gi|325482250|gb|EGC85258.1| ribosome-binding factor A [Prevotella denticola CRIS 18C-A]
 gi|326944166|gb|AEA20051.1| ribosome-binding factor A [Prevotella denticola F0289]
          Length = 111

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +        R++   ++S++ V +S DL V T Y+S+      + 
Sbjct: 5   RQNRIARLLQKELASIFQTQT---RMMHGVLVSVTRVKISPDLSVCTAYLSIFPSEKGEE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +N N K IR  +G+ + N LR +PELRF  D SL    +++ L+  
Sbjct: 62  LLKNINANEKTIRYELGQRVHNQLRIIPELRFFIDDSLDYLDRIDELLKK 111


>gi|307564965|ref|ZP_07627482.1| ribosome-binding factor A [Prevotella amnii CRIS 21A-A]
 gi|307346278|gb|EFN91598.1| ribosome-binding factor A [Prevotella amnii CRIS 21A-A]
          Length = 113

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +  +     RL+   ++S++ V +S DL + T Y+S+      + 
Sbjct: 5   RQNRISRLLQKELASIFQSQT---RLLHGVLVSVTRVRISPDLSICTAYLSIFPSEKTEE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           +I  +N N K IR  +G+   N LR +PELRF  D SL     +  L+   K
Sbjct: 62  LIKNINTNEKTIRYELGKRTHNQLRIIPELRFFVDDSLDYLEHIEHLLKDKK 113


>gi|15924260|ref|NP_371794.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15926853|ref|NP_374386.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           N315]
 gi|21282882|ref|NP_645970.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus MW2]
 gi|49483433|ref|YP_040657.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|49486109|ref|YP_043330.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57651840|ref|YP_186146.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus COL]
 gi|82750871|ref|YP_416612.1| ribosome-binding factor A [Staphylococcus aureus RF122]
 gi|87161703|ref|YP_493860.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88194980|ref|YP_499780.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|150393819|ref|YP_001316494.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus JH1]
 gi|156979591|ref|YP_001441850.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus Mu3]
 gi|161509436|ref|YP_001575095.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221142504|ref|ZP_03566997.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus str.
           JKD6009]
 gi|253315626|ref|ZP_04838839.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus str.
           CF-Marseille]
 gi|255006057|ref|ZP_05144658.2| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|262048160|ref|ZP_06021047.1| ribosome-binding factor A [Staphylococcus aureus D30]
 gi|262051332|ref|ZP_06023555.1| ribosome-binding factor A [Staphylococcus aureus 930918-3]
 gi|269202887|ref|YP_003282156.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           ED98]
 gi|284024263|ref|ZP_06378661.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus 132]
 gi|294848266|ref|ZP_06789013.1| ribosome-binding factor A [Staphylococcus aureus A9754]
 gi|295406207|ref|ZP_06816014.1| ribosome-binding factor A [Staphylococcus aureus A8819]
 gi|295427757|ref|ZP_06820389.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|296274828|ref|ZP_06857335.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus MR1]
 gi|297244435|ref|ZP_06928318.1| ribosome-binding factor A [Staphylococcus aureus A8796]
 gi|54039026|sp|P65967|RBFA_STAAN RecName: Full=Ribosome-binding factor A
 gi|54039027|sp|P65968|RBFA_STAAW RecName: Full=Ribosome-binding factor A
 gi|54041787|sp|P65966|RBFA_STAAM RecName: Full=Ribosome-binding factor A
 gi|56749520|sp|Q6G9U3|RBFA_STAAS RecName: Full=Ribosome-binding factor A
 gi|56749567|sp|Q6GHG5|RBFA_STAAR RecName: Full=Ribosome-binding factor A
 gi|61214665|sp|Q5HGG1|RBFA_STAAC RecName: Full=Ribosome-binding factor A
 gi|122540682|sp|Q2G2Q4|RBFA_STAA8 RecName: Full=Ribosome-binding factor A
 gi|123486171|sp|Q2FHG8|RBFA_STAA3 RecName: Full=Ribosome-binding factor A
 gi|123549084|sp|Q2YXP6|RBFA_STAAB RecName: Full=Ribosome-binding factor A
 gi|166219410|sp|A7X1Q2|RBFA_STAA1 RecName: Full=Ribosome-binding factor A
 gi|172049025|sp|A6QGG9|RBFA_STAAE RecName: Full=Ribosome-binding factor A
 gi|182676603|sp|A5ISF4|RBFA_STAA9 RecName: Full=Ribosome-binding factor A
 gi|189039563|sp|A6U189|RBFA_STAA2 RecName: Full=Ribosome-binding factor A
 gi|189039564|sp|A8Z3V0|RBFA_STAAT RecName: Full=Ribosome-binding factor A
 gi|13701070|dbj|BAB42365.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           N315]
 gi|14247040|dbj|BAB57432.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21204321|dbj|BAB95018.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus MW2]
 gi|49241562|emb|CAG40248.1| putative ribosome-binding factor A [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|49244552|emb|CAG42981.1| putative ribosome-binding factor A [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57286026|gb|AAW38120.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus COL]
 gi|82656402|emb|CAI80821.1| ribosome-binding factor A [Staphylococcus aureus RF122]
 gi|87127677|gb|ABD22191.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87202538|gb|ABD30348.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|149946271|gb|ABR52207.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus JH1]
 gi|156721726|dbj|BAF78143.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus Mu3]
 gi|160368245|gb|ABX29216.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|259160707|gb|EEW45728.1| ribosome-binding factor A [Staphylococcus aureus 930918-3]
 gi|259163726|gb|EEW48281.1| ribosome-binding factor A [Staphylococcus aureus D30]
 gi|262075177|gb|ACY11150.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           ED98]
 gi|285816952|gb|ADC37439.1| Ribosome-binding factor A [Staphylococcus aureus 04-02981]
 gi|294825066|gb|EFG41488.1| ribosome-binding factor A [Staphylococcus aureus A9754]
 gi|294968795|gb|EFG44817.1| ribosome-binding factor A [Staphylococcus aureus A8819]
 gi|295128115|gb|EFG57749.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297178465|gb|EFH37711.1| ribosome-binding factor A [Staphylococcus aureus A8796]
 gi|298694562|gb|ADI97784.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           ED133]
 gi|302332876|gb|ADL23069.1| ribosome-binding factor A (P15B PROTEIN) [Staphylococcus aureus
           subsp. aureus JKD6159]
 gi|312829664|emb|CBX34506.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           ECT-R 2]
 gi|315131064|gb|EFT87048.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315194158|gb|EFU24551.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315198512|gb|EFU28841.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           CGS01]
          Length = 116

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 35/118 (29%), Positives = 65/118 (55%), Gaps = 5/118 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            +S RA RVGE+++  LM +I NN+ +D  +    I+I++V ++ DL  A V++++  + 
Sbjct: 1   MSSMRAERVGEQMKKELMDII-NNKVKDPRVG--FITITDVVLTNDLSQAKVFLTVLGND 57

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
              +    AL+    FI+  +G  +R LR +PEL + YD S++   K+  ++      
Sbjct: 58  KEVENTFKALDKAKGFIKSELGSRMR-LRIMPELMYEYDQSIEYGNKIERMIQDLHKQ 114


>gi|313115480|ref|ZP_07800945.1| ribosome-binding factor A [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310622190|gb|EFQ05680.1| ribosome-binding factor A [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 130

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 22/115 (19%), Positives = 52/115 (45%), Gaps = 4/115 (3%)

Query: 14  RVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PDRVI 72
           R+ ++++  ++ +I     +D  +   +++++ + ++ DL VA VY+S+      P   I
Sbjct: 8   RLAQDMKREIIAIIGR--LKDPRLEGGLLTVTRLDVTPDLDVAKVYVSVMGREDGPKPAI 65

Query: 73  SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
            ALN     +R  + + + ++R  P   F  D        +N L+    +    +
Sbjct: 66  EALNRAAGHVRTEVSKKM-HIRKAPRFIFVEDDGAAYAAHINELLRTLNVNGDAD 119


>gi|229820974|ref|YP_002882500.1| ribosome-binding factor A [Beutenbergia cavernae DSM 12333]
 gi|259551951|sp|C5BWS2|RBFA_BEUC1 RecName: Full=Ribosome-binding factor A
 gi|229566887|gb|ACQ80738.1| ribosome-binding factor A [Beutenbergia cavernae DSM 12333]
          Length = 159

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 23/116 (19%), Positives = 55/116 (47%), Gaps = 6/116 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
              NS RA R+G+ ++  +  ++     +D  +    +++++V ++ DL+ ATV+ ++  
Sbjct: 1   MSGNS-RATRLGDRIKEIVATMLERR-IKDPRLG--FVTVTDVELTGDLQHATVFYTVLG 56

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           D        +AL      +R  +G+    +++ P L F+ D + Q+   +   +  
Sbjct: 57  DAEELASSTAALESAKGLLRSEVGKQ-TGVKHTPTLTFQLDATPQNAAHVEEALRE 111


>gi|256819620|ref|YP_003140899.1| ribosome-binding factor A [Capnocytophaga ochracea DSM 7271]
 gi|315224986|ref|ZP_07866805.1| ribosome-binding factor A [Capnocytophaga ochracea F0287]
 gi|256581203|gb|ACU92338.1| ribosome-binding factor A [Capnocytophaga ochracea DSM 7271]
 gi|314945099|gb|EFS97129.1| ribosome-binding factor A [Capnocytophaga ochracea F0287]
          Length = 130

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 54/116 (46%), Gaps = 2/116 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  V+     +D      +IS+++V ++VDL VA VY+S+  + 
Sbjct: 1   MENNRQKKIAGIIQEELAKVLQQ-SIRDAGQQNLLISVTKVNVTVDLSVAKVYLSVFPEA 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               V+  +  N   I+  + +  ++  R +PEL F  D SLQ    +   +   +
Sbjct: 60  KAAEVLKGVTSNAPLIKHELSQITKHQFRRMPELYFYIDDSLQYIEGIEQSLKEEE 115


>gi|260424716|ref|ZP_05778979.1| ribosome-binding factor A [Dialister invisus DSM 15470]
 gi|260402930|gb|EEW96477.1| ribosome-binding factor A [Dialister invisus DSM 15470]
          Length = 119

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           R  ++ E ++  +  ++L  E +D  +    ++++ V ++ DLR ATVY+SL        
Sbjct: 5   RVRKMQEFIKQEVGNMLLR-ELKDPRLG--FVTVTGVKLTGDLREATVYVSLFGQEEERK 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  LN +  FIR  +G  L+   Y PE+ F  D SL     +  L+   
Sbjct: 62  ESLMVLNKSKGFIRKELGTRLKVY-YTPEISFEEDKSLDYGMHIEGLLKKI 111


>gi|332992819|gb|AEF02874.1| ribosome-binding factor A [Alteromonas sp. SN2]
          Length = 133

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 58/126 (46%), Gaps = 4/126 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV ++V   +  ++  NE++ R+    +I++S+V ++ DL  A +Y+++  
Sbjct: 1   MAREFSRTDRVSQQVHKEVASIL-QNEYKHRVGDMPLITVSDVDVTRDLAHAKIYVTIYN 59

Query: 65  DVSPDRVISA--LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
               +       L     FIR  + + LR +R VP L F  D S+    +++ L+     
Sbjct: 60  STEEEGKRQIKQLAEFQPFIRSILAKRLR-MRSVPHLHFFEDKSIIEGMRISNLVSQTVA 118

Query: 123 PVALEK 128
               ++
Sbjct: 119 ADDAKR 124


>gi|332638627|ref|ZP_08417490.1| ribosome-binding factor A [Weissella cibaria KACC 11862]
          Length = 118

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 57/118 (48%), Gaps = 6/118 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             + + R  R+ +E++  +  ++L    +D  +    ++++ V ++ DL+ A +Y S+  
Sbjct: 1   MAQQNFRVGRLEQEIQREVNDLLLKR-IRDPRVEG--VTVTGVEVTGDLQQAKIYYSVLS 57

Query: 65  DVSP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +++    +  + L      IR  +G  L   +  PEL+F  D S+Q   K++ L+   
Sbjct: 58  ELASVNQKAAAGLEAATGLIRKELGSRLAIYK-TPELKFVKDESVQYGNKIDDLIRQL 114


>gi|229829172|ref|ZP_04455241.1| hypothetical protein GCWU000342_01257 [Shuttleworthia satelles DSM
           14600]
 gi|229792335|gb|EEP28449.1| hypothetical protein GCWU000342_01257 [Shuttleworthia satelles DSM
           14600]
          Length = 125

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K S +  R+ EEV   L  +I   + +D  +   + S++ V ++ DL+ A VY+S+  
Sbjct: 1   MRKRSVKNNRINEEVLRELSKII-REDVKDPRV-SLMTSVTLVEVAPDLKTAKVYVSVLG 58

Query: 65  DVSPD-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           D       +  L  +  FIRG++  S+ NLR  PEL F  D S+    +++ L+  
Sbjct: 59  DKEAGINTVKGLKSSAGFIRGKLAHSV-NLRNTPELFFILDDSIAYGVRMSKLIDQ 113


>gi|300854502|ref|YP_003779486.1| ribosome-binding factor A [Clostridium ljungdahlii DSM 13528]
 gi|300434617|gb|ADK14384.1| ribosome-binding factor A [Clostridium ljungdahlii DSM 13528]
          Length = 121

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 61/119 (51%), Gaps = 4/119 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
             + R+ R+ EE++  +  +I  ++ +D  +   ++S+++V ++ D + A VY+S+  + 
Sbjct: 1   MTNYRSGRINEEMKKEISNII-RSDIKDPRV-TAMVSVTKVDVTKDQKYAKVYVSVYGEG 58

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
            S +    AL  +  FIR  +G  ++ LR  PE+    D +++    ++ ++   K   
Sbjct: 59  KSKEDTFEALRNSAGFIRREVGHRVK-LRNTPEIIIEQDNTIEYGMHIDKILQEIKENK 116


>gi|303271249|ref|XP_003054986.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226462960|gb|EEH60238.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 160

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 61/128 (47%), Gaps = 13/128 (10%)

Query: 10  RRALRVGEEVRSALMWVILNNE-----------FQDRLISRDVISISEVCMSVDLRVATV 58
           RR  +V +++R  +  ++  ++                +   + ++++V +S DL+V  V
Sbjct: 8   RRVAKVQQQMRREISNMLQTDKNLRNMISPEERMGVDNVISVMATVADVEVSNDLQVVKV 67

Query: 59  YISLPLDVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
           ++S+  D       I+ L     ++R  IG+ + +LR  PE+RF YD S +   K++AL+
Sbjct: 68  FVSILGDERGKKNAINGLKKMEGYVRRNIGKKV-SLRLTPEIRFVYDDSFERGQKVSALL 126

Query: 118 CLPKIPVA 125
              +    
Sbjct: 127 DELREERD 134


>gi|88797624|ref|ZP_01113213.1| ribosome-binding factor A [Reinekea sp. MED297]
 gi|88779796|gb|EAR10982.1| ribosome-binding factor A [Reinekea sp. MED297]
          Length = 137

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 30/134 (22%), Positives = 64/134 (47%), Gaps = 15/134 (11%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
              NS R  ++G++++  L  +I   E +D  +   +++I++V +S DL  A VY +   
Sbjct: 1   MASNSSRIRKIGDQIQKDLSVIIQR-EVKDPRVG--MVTINDVKVSSDLSYADVYFTCMA 57

Query: 64  ---------LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLN 114
                     +         LN    F+R ++ + L+ LR +P+LRF YD  +++  +++
Sbjct: 58  FGPQSEAEAQEQERKEQEKLLNRAAGFMRTQLAQGLK-LRVIPQLRFHYDVVIETGARVS 116

Query: 115 ALMCLPKIPVALEK 128
            L+   +     ++
Sbjct: 117 QLIDEAR-EQDQKR 129


>gi|186476486|ref|YP_001857956.1| ribosome-binding factor A [Burkholderia phymatum STM815]
 gi|184192945|gb|ACC70910.1| ribosome-binding factor A [Burkholderia phymatum STM815]
          Length = 143

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 55/127 (43%), Gaps = 7/127 (5%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  +I   E +D  I   +++   V ++ D   A VY 
Sbjct: 23  MPKKRTSP-NRNVQIADQIQRDLSELIR--EVKDPRIG--IVTFQSVELTPDYAHAKVYF 77

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +      P +   ALN     +   + + L ++  VP L F YD +++   +++ L+   
Sbjct: 78  TTL-TGDPHQTQDALNHAAGHLHNLLFKRL-HIHTVPTLHFHYDKTIERAVEMSRLIDEA 135

Query: 121 KIPVALE 127
               A +
Sbjct: 136 NASRAKD 142


>gi|213962361|ref|ZP_03390624.1| ribosome-binding factor A [Capnocytophaga sputigena Capno]
 gi|213955027|gb|EEB66346.1| ribosome-binding factor A [Capnocytophaga sputigena Capno]
          Length = 130

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 26/116 (22%), Positives = 54/116 (46%), Gaps = 2/116 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  V+     +D      ++S+++V ++VDL VA VY+S+  + 
Sbjct: 1   MENNRQKKIAGIIQEELAKVLQQ-SIRDAGQQNLLVSVTKVNVTVDLSVAKVYLSVFPEA 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               V+  +  N   I+  + +  ++  R +PEL F  D SLQ    +   +   +
Sbjct: 60  KAAEVLKGVTSNAPLIKHELSQITKHQFRRMPELFFYIDDSLQYIEGIEQSLKEEE 115


>gi|291546822|emb|CBL19930.1| ribosome-binding factor A [Ruminococcus sp. SR1/5]
          Length = 122

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 4/116 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV   V+  L  +I  +E +D  I   + S++ V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRVNGAVQKELSTIIH-SEIKDPRIH-PMTSVTAVEVAPDLKTCKAYISVLG 58

Query: 65  DVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           +    D  +  L     ++R  + R L NLR  PE+RF  D S++    ++  +  
Sbjct: 59  EKQAKDSTLRGLKNAEGYVRRELARRL-NLRNTPEIRFVLDESIEYGVNMSKKIND 113


>gi|331084716|ref|ZP_08333804.1| ribosome-binding factor A [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|330410810|gb|EGG90232.1| ribosome-binding factor A [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 119

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 58/124 (46%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV  EV+  L  ++  +  +D  +   + S+  V ++ DL+    Y+S+  
Sbjct: 1   MRKNSIKNTRVNMEVQRELSSIL-RDGIKDPRV-APMTSVVAVEVAPDLKTCKAYVSVLG 58

Query: 65  DVSPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D    +  ++ L     +IR  +   L N+R  PE++F  D S++    ++  +   ++ 
Sbjct: 59  DEKAQQDTVAGLQSAEGYIRRELAHRL-NMRNTPEVKFVLDQSIEYGVSMSKKID--EVT 115

Query: 124 VALE 127
             ++
Sbjct: 116 KDIK 119


>gi|261345160|ref|ZP_05972804.1| ribosome-binding factor A [Providencia rustigianii DSM 4541]
 gi|282566851|gb|EFB72386.1| ribosome-binding factor A [Providencia rustigianii DSM 4541]
          Length = 137

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 66/132 (50%), Gaps = 13/132 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R+ RV +E++  +  +IL  E +D  I   + ++S V +S DL    V+++   
Sbjct: 1   MAKEFSRSQRVAQEMQKEIA-IILQREIKDPRIG--MATVSGVELSRDLAYGKVFVTFFN 57

Query: 65  DVSPDRV--------ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
             + D+         I ALN    FIR  +G+++R LR +PEL F YD+SL    +++ L
Sbjct: 58  IANDDKSEAEMVAEGIKALNEASGFIRSLLGKAMR-LRIIPELTFEYDSSLVDGMRMSNL 116

Query: 117 MCLPKIPVALEK 128
           +    I    E+
Sbjct: 117 VSNV-IRNDEER 127


>gi|113969371|ref|YP_733164.1| ribosome-binding factor A [Shewanella sp. MR-4]
 gi|122944045|sp|Q0HLG0|RBFA_SHESM RecName: Full=Ribosome-binding factor A
 gi|113884055|gb|ABI38107.1| ribosome-binding factor A [Shewanella sp. MR-4]
          Length = 146

 Score = 98.3 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 61/126 (48%), Gaps = 10/126 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L  V+   + +D  I    +++++V +S DL  A V+++   
Sbjct: 1   MAKEFSRTRRIGQQLQQELAVVLQR-DMKDPRIG--FVTVNDVDVSRDLSYAKVFVTFFE 57

Query: 65  DVSP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL----MC 118
           +        ++AL     +IR  +   ++ LR +PE+RF YD+SL    +++ L    + 
Sbjct: 58  EDKEVVQEKLNALIAAAPYIRTLVAGRMK-LRVMPEIRFVYDSSLVEGMRMSNLVSQVIN 116

Query: 119 LPKIPV 124
             K   
Sbjct: 117 SDKAKQ 122


>gi|269926025|ref|YP_003322648.1| ribosome-binding factor A [Thermobaculum terrenum ATCC BAA-798]
 gi|269789685|gb|ACZ41826.1| ribosome-binding factor A [Thermobaculum terrenum ATCC BAA-798]
          Length = 121

 Score = 98.3 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/121 (25%), Positives = 61/121 (50%), Gaps = 5/121 (4%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVS 67
           SRR  +V +E++  +  +++  E +D  I    ++++ V +S DL  AT+++S+   +  
Sbjct: 2   SRRTEQVAQEIKRHISELLVQ-EVRDPRIG--FVTVTAVEVSPDLEHATIHVSVLGSEED 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
               + AL     F+R  + + +R LR + ELRF  D S     +++ L+     P   +
Sbjct: 59  EKETMKALRRASGFLRSELAKRIR-LRKMAELRFEPDRSAAEAIRISQLLNEVLPPDDRQ 117

Query: 128 K 128
           K
Sbjct: 118 K 118


>gi|223936319|ref|ZP_03628231.1| ribosome-binding factor A [bacterium Ellin514]
 gi|223894837|gb|EEF61286.1| ribosome-binding factor A [bacterium Ellin514]
          Length = 125

 Score = 98.3 bits (244), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 57/116 (49%), Gaps = 5/116 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S R  RV E ++  +  VI        +    +I+++EV +S DL  ATV+I +    
Sbjct: 1   MPSLRLQRVRELLKREIGEVIRRE---IPVGESGLITVNEVGVSSDLHSATVFIGILGTD 57

Query: 67  SPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
              +   A LN + K I+G +G+++  L+Y P LRF  D S+    K+  ++   +
Sbjct: 58  QQKKKGFAQLNHHRKRIQGLVGQAVI-LKYTPTLRFVLDESIAEGNKVLQIIDELE 112


>gi|163786898|ref|ZP_02181346.1| ribosome-binding factor A [Flavobacteriales bacterium ALC-1]
 gi|159878758|gb|EDP72814.1| ribosome-binding factor A [Flavobacteriales bacterium ALC-1]
          Length = 130

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 55/116 (47%), Gaps = 2/116 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S R  ++   ++  L+ V+      +  +   +IS+S+V ++VDL +A VY+S+  + 
Sbjct: 1   MESNRQKKIAGILQQDLVDVLQR-AASEGGLKGVIISVSKVSVTVDLSMAKVYLSIFPNK 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               ++  +  N   IR  + +  R+ LR +P+L F  D SL+    +   +    
Sbjct: 60  EAQPLLEGIRSNKPLIRHELSQRTRHQLRRMPQLEFFIDDSLEYIDGIERSLKGED 115


>gi|281421510|ref|ZP_06252509.1| ribosome-binding factor A [Prevotella copri DSM 18205]
 gi|281404582|gb|EFB35262.1| ribosome-binding factor A [Prevotella copri DSM 18205]
          Length = 111

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 58/110 (52%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +  +     R++   ++S+++V +S DL + T Y+S+      + 
Sbjct: 5   RQNRISRLLQKELSLIFQSQT---RMMHGVMVSVTKVRVSPDLSICTAYLSVFPSEKGEE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +N N K IR  +G+ +RN LR +PELRF  D SL     ++ L+  
Sbjct: 62  ILKNINANEKTIRFDLGKKVRNQLRIIPELRFFLDDSLDYLEHIDELLKK 111


>gi|284044676|ref|YP_003395016.1| ribosome-binding factor A [Conexibacter woesei DSM 14684]
 gi|283948897|gb|ADB51641.1| ribosome-binding factor A [Conexibacter woesei DSM 14684]
          Length = 121

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 53/110 (48%), Gaps = 5/110 (4%)

Query: 12  ALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD-R 70
             RV E VR+ L   I   + +D  +    ++++ V  S DLR A VY+S+  D      
Sbjct: 1   MRRVDEAVRAVLSDAITQ-DLKDPRVG--FVTVTAVRTSSDLRHARVYVSVLGDEETRAE 57

Query: 71  VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            ++ L     +++  + R +R ++Y PE+ F YD S+    ++  ++   
Sbjct: 58  CLAGLRSATGYLQRLVAREVR-MKYTPEIVFAYDDSIDRGMRITEILRDA 106


>gi|145589408|ref|YP_001156005.1| ribosome-binding factor A [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|182676542|sp|A4SY77|RBFA_POLSQ RecName: Full=Ribosome-binding factor A
 gi|145047814|gb|ABP34441.1| ribosome-binding factor A [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
          Length = 122

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 58/127 (45%), Gaps = 9/127 (7%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M   +P    R  R+ ++++  L  +I       R  S  +I++  + +S DL  A V+ 
Sbjct: 1   MHKTSP---HRNQRLADQIQRDLAELIPRE---LRSTSLGLITLQSIELSPDLAHAKVFF 54

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++     P+  + AL     ++   + + L ++  VP L F YD+S++   +++ L+   
Sbjct: 55  TVLGA-EPEHALKALQEKAGYLHSLLFKRL-HIHTVPTLHFHYDSSVEHGIEMSRLIDQ- 111

Query: 121 KIPVALE 127
            +    +
Sbjct: 112 AVESDQQ 118


>gi|291166368|gb|EFE28414.1| ribosome-binding factor A [Filifactor alocis ATCC 35896]
          Length = 121

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 65/119 (54%), Gaps = 4/119 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISR--DVISISEVCMSVDLRVATVYISLPLDVSP 68
           R  R+ EE+R  +  ++L  E +D  I     +IS++ V +  DL+ A +YIS+  D +P
Sbjct: 5   RTRRISEEIRKVVGNMLLEGEIKDTKIRNSKGLISVTSVEVVRDLKYAYIYISVLGD-NP 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           + ++  L     ++R  +GR + +LRY PE+ FR D S+++  +++ ++         E
Sbjct: 64  ETILDGLKRASGYVRKEVGRQV-DLRYTPEIIFRLDHSIENGVEMSKMISELNQNSTEE 121


>gi|309775441|ref|ZP_07670444.1| ribosome-binding factor A [Erysipelotrichaceae bacterium 3_1_53]
 gi|308916830|gb|EFP62567.1| ribosome-binding factor A [Erysipelotrichaceae bacterium 3_1_53]
          Length = 112

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/110 (22%), Positives = 54/110 (49%), Gaps = 5/110 (4%)

Query: 12  ALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRV 71
           A ++   ++  +  +I     +D  I    I+I++V ++ DL +A +Y+S       +  
Sbjct: 5   AEKIAGIIQKEISEII-QFSLKDPKIG--FITITDVTVTNDLSIAKIYVSFLGQKPREEA 61

Query: 72  -ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            + AL  +  ++R  + + +  +R VPEL F+ D SL+   K+  ++   
Sbjct: 62  GMKALERSKGYLRSELAKRM-TIRKVPELIFKLDDSLERGNKIERIISEI 110


>gi|331269627|ref|YP_004396119.1| ribosome-binding factor A [Clostridium botulinum BKT015925]
 gi|329126177|gb|AEB76122.1| ribosome-binding factor A [Clostridium botulinum BKT015925]
          Length = 121

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PD 69
           R  R+ EEVR  +  +I  ++  D  +   ++SI+ V ++ DLR A V+IS+    S   
Sbjct: 5   RLGRINEEVRKEISNII-RDDIHDPRL-TAMVSITRVEVTNDLRYAKVFISVFGSESSKK 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             + AL  ++ F+R  +G  ++ LR  PE+    D S++    +N L+   K
Sbjct: 63  ETLEALKSSVGFMRREVGHRVK-LRCTPEIILELDESIEHGMHINDLLSNLK 113


>gi|227514700|ref|ZP_03944749.1| ribosome-binding factor A [Lactobacillus fermentum ATCC 14931]
 gi|227086904|gb|EEI22216.1| ribosome-binding factor A [Lactobacillus fermentum ATCC 14931]
          Length = 120

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
                 R  R+ ++++  +  ++L    +D  ++   ++++ V ++ DL+ AT+Y ++  
Sbjct: 1   MSNKQFRVERLAQQIQREVDDILLKR-VRDPRVNG--VTVTGVDVTGDLQQATIYYTILS 57

Query: 65  D--VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                 ++  + L+     +R  +G  L   +  PE++F  D S++   +++ L+     
Sbjct: 58  KLASDAEKTQTGLDKATGLVRSELGSRLNIFK-APEIKFVRDPSIEYGSRIDELLNELHK 116

Query: 123 PVAL 126
              L
Sbjct: 117 NNEL 120


>gi|21224056|ref|NP_629835.1| ribosome-binding factor A [Streptomyces coelicolor A3(2)]
 gi|256784865|ref|ZP_05523296.1| ribosome-binding factor A [Streptomyces lividans TK24]
 gi|289768759|ref|ZP_06528137.1| ribosome-binding factor A [Streptomyces lividans TK24]
 gi|6225918|sp|Q9Z527|RBFA_STRCO RecName: Full=Ribosome-binding factor A
 gi|4464272|emb|CAB37475.1| putative ribosome-binding factor [Streptomyces coelicolor A3(2)]
 gi|289698958|gb|EFD66387.1| ribosome-binding factor A [Streptomyces lividans TK24]
          Length = 160

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 52/124 (41%), Gaps = 9/124 (7%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA R+ + +R  +   +     +D  +    ++I++  ++ DLR ATV+ ++  D 
Sbjct: 2   ADNARAKRLADLIREVVAQKLQRG-IKDPRLGSH-VTITDTRVTGDLREATVFYTVYGDD 59

Query: 67  SP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC-----LP 120
                  + L      +R  +G++   +++ P L F  D    +   +  L+        
Sbjct: 60  EERKAATAGLESAKGILRSEVGKA-AGVKFTPTLTFVMDALPDTARNIEDLLDKARQSDE 118

Query: 121 KIPV 124
           K+  
Sbjct: 119 KVRE 122


>gi|237746611|ref|ZP_04577091.1| ribosome-binding factor A [Oxalobacter formigenes HOxBLS]
 gi|229377962|gb|EEO28053.1| ribosome-binding factor A [Oxalobacter formigenes HOxBLS]
          Length = 129

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/129 (24%), Positives = 65/129 (50%), Gaps = 6/129 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M   +     R+LRV ++++  L  +I  +E +D  +   +++I+EV ++ D   A VY 
Sbjct: 1   MARHSKSIPGRSLRVADQIQRDLSDIIF-SELKDPNVG--MVTITEVKVTPDYANARVYF 57

Query: 61  SLPLDVSP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           ++  D      + + +L     FIR ++G+ L ++  +P+L F YD S+     L+ L+ 
Sbjct: 58  TMLDDKPETVKKTLDSLQHASGFIRMQLGKRL-HIHTLPQLAFIYDNSIAEGVALSHLID 116

Query: 119 LPKIPVALE 127
           +     A +
Sbjct: 117 VANAERAKD 125


>gi|225374834|ref|ZP_03752055.1| hypothetical protein ROSEINA2194_00455 [Roseburia inulinivorans DSM
           16841]
 gi|225213295|gb|EEG95649.1| hypothetical protein ROSEINA2194_00455 [Roseburia inulinivorans DSM
           16841]
          Length = 124

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 6/123 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I   E +D  I   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRINGEVQKELSNII-RGEIKDPRI-NPLTSVVAVEVAPDLKTCKAYISVLG 58

Query: 65  DVSPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D    +  I  L     +IR  + +S+ NLR  P++ F  D S++   K++ ++    + 
Sbjct: 59  DEKSQQDTIKGLKSAEGYIRTMLAKSI-NLRNTPQITFILDQSIEYGVKMSKMIDD--VT 115

Query: 124 VAL 126
             +
Sbjct: 116 KDI 118


>gi|116333940|ref|YP_795467.1| ribosome-binding factor A [Lactobacillus brevis ATCC 367]
 gi|122269376|sp|Q03QT6|RBFA_LACBA RecName: Full=Ribosome-binding factor A
 gi|116099287|gb|ABJ64436.1| ribosome-binding factor A [Lactobacillus brevis ATCC 367]
          Length = 116

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 55/112 (49%), Gaps = 6/112 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV--SP 68
           R  R+ +E++  +  ++L    +D  +    ++++ V ++ DL+ AT+Y S+  D   S 
Sbjct: 5   RVGRLEQEIQREVTDILLKR-VRDPRVEG--VTVTGVEVTGDLQQATIYYSILSDKASSA 61

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++  + L      IR  +G  L   +  PEL F  D S++   +++ L+   
Sbjct: 62  EKTAAGLKKATGLIRSELGSRLSIYK-TPELTFEQDGSVRYGSRIDELLNDL 112


>gi|159902668|ref|YP_001550012.1| ribosome-binding factor A [Prochlorococcus marinus str. MIT 9211]
 gi|238687122|sp|A9BCX0|RBFA_PROM4 RecName: Full=Ribosome-binding factor A
 gi|159887844|gb|ABX08058.1| Ribosome-binding factor A [Prochlorococcus marinus str. MIT 9211]
          Length = 130

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VSP 68
           RR  +V   +R  +  ++L+   +D  ++  +++I+EV +S DL+   +++S+       
Sbjct: 5   RRVEKVSALIRKEMSQLLLDG-IRDERVASSMVTITEVEVSGDLQHCKIFVSIFGQDPKR 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
           +   S L     F+RG +GR L  +R  PE+ F+ D  ++    +  L+   +   
Sbjct: 64  EEAFSGLQAASGFLRGELGRRL-QMRRAPEIVFKLDKGMEKGSSVLDLLGKLEEER 118


>gi|288803485|ref|ZP_06408917.1| ribosome-binding factor A [Prevotella melaninogenica D18]
 gi|302346037|ref|YP_003814390.1| ribosome-binding factor A [Prevotella melaninogenica ATCC 25845]
 gi|288334095|gb|EFC72538.1| ribosome-binding factor A [Prevotella melaninogenica D18]
 gi|302149916|gb|ADK96178.1| ribosome-binding factor A [Prevotella melaninogenica ATCC 25845]
          Length = 111

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +        R++   ++S++ V +S DL + T Y+S+      D 
Sbjct: 5   RQNRISRLLQKELASIFQTQT---RMMHGVLVSVTRVKVSPDLSICTAYLSIFPSEKGDE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +N N K IR  +G+ + N LR +PELRF  D SL    +++ L+  
Sbjct: 62  ILKNINANEKTIRYDLGQRVHNQLRIIPELRFFIDDSLDYLERIDELLKK 111


>gi|114046598|ref|YP_737148.1| ribosome-binding factor A [Shewanella sp. MR-7]
 gi|123326767|sp|Q0HXR4|RBFA_SHESR RecName: Full=Ribosome-binding factor A
 gi|113888040|gb|ABI42091.1| ribosome-binding factor A [Shewanella sp. MR-7]
          Length = 146

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 61/126 (48%), Gaps = 10/126 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L  V+   + +D  I    +++++V +S DL  A V+++   
Sbjct: 1   MAKEFSRTRRIGQQLQQELAVVLQR-DMKDPRIG--FVTVNDVDVSRDLSYAKVFVTFFE 57

Query: 65  DVSP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL----MC 118
           +        ++AL     +IR  +   ++ LR +PE+RF YD+SL    +++ L    + 
Sbjct: 58  EDKEVVQEKLNALIAAAPYIRTLVAGRMK-LRVMPEIRFVYDSSLVEGMRMSNLVSQVIN 116

Query: 119 LPKIPV 124
             K   
Sbjct: 117 SDKAKQ 122


>gi|23336295|ref|ZP_00121518.1| COG0858: Ribosome-binding factor A [Bifidobacterium longum DJO10A]
 gi|23466166|ref|NP_696769.1| ribosome-binding factor A [Bifidobacterium longum NCC2705]
 gi|189440606|ref|YP_001955687.1| ribosome-binding factor A [Bifidobacterium longum DJO10A]
 gi|227546513|ref|ZP_03976562.1| Ribosome-binding factor A [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239621509|ref|ZP_04664540.1| ribosome-binding factor A [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|312133910|ref|YP_004001249.1| rbfa [Bifidobacterium longum subsp. longum BBMN68]
 gi|322689893|ref|YP_004209627.1| ribosome-binding factor [Bifidobacterium longum subsp. infantis
           157F]
 gi|322691834|ref|YP_004221404.1| ribosome-binding factor [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|29427808|sp|Q8G3Y4|RBFA_BIFLO RecName: Full=Ribosome-binding factor A
 gi|238692043|sp|B3DQF1|RBFA_BIFLD RecName: Full=Ribosome-binding factor A
 gi|23326905|gb|AAN25405.1| ribosome-binding factor A [Bifidobacterium longum NCC2705]
 gi|189429041|gb|ACD99189.1| Ribosome-binding factor A [Bifidobacterium longum DJO10A]
 gi|227213062|gb|EEI80941.1| Ribosome-binding factor A [Bifidobacterium longum subsp. infantis
           ATCC 55813]
 gi|239515384|gb|EEQ55251.1| ribosome-binding factor A [Bifidobacterium longum subsp. infantis
           CCUG 52486]
 gi|291516438|emb|CBK70054.1| ribosome-binding factor A [Bifidobacterium longum subsp. longum F8]
 gi|311773204|gb|ADQ02692.1| RbfA [Bifidobacterium longum subsp. longum BBMN68]
 gi|320456690|dbj|BAJ67312.1| ribosome-binding factor [Bifidobacterium longum subsp. longum JCM
           1217]
 gi|320461229|dbj|BAJ71849.1| ribosome-binding factor [Bifidobacterium longum subsp. infantis
           157F]
          Length = 157

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 53/128 (41%), Gaps = 10/128 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
               + RA R+   ++  +   I   E  D+ +    I+++EV ++ DL++A VY +   
Sbjct: 1   MAGTNPRAARIAALIQRVVASSIER-ELHDKRL--ASITVTEVRVTNDLQIAKVYWTQLG 57

Query: 65  DV-----SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                     R   AL+     +R  +G     LR  P+L+F +D       ++  ++ +
Sbjct: 58  HEGHEEGERKRAQQALDQAKGHLRSLVGHK-AGLRLTPQLQFVFDEVPGEAHEIEDILAV 116

Query: 120 PKIPVALE 127
            K     E
Sbjct: 117 AK-KRDEE 123


>gi|282848831|ref|ZP_06258224.1| ribosome-binding factor A [Veillonella parvula ATCC 17745]
 gi|294793602|ref|ZP_06758739.1| ribosome-binding factor A [Veillonella sp. 3_1_44]
 gi|282581485|gb|EFB86875.1| ribosome-binding factor A [Veillonella parvula ATCC 17745]
 gi|294455172|gb|EFG23544.1| ribosome-binding factor A [Veillonella sp. 3_1_44]
          Length = 118

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 60/118 (50%), Gaps = 7/118 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R  ++ E ++  +  +++    +D  I     +I++V ++ DLR AT+Y+SL   D   +
Sbjct: 5   RVRKLQEFIKQEVSQMLMRG-LKDPRIG--FTTITDVHVTGDLREATIYVSLFGSDKEKE 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
             + AL      IR  +G+ L+ LR++P + F  DTSL     + +L+   +I    E
Sbjct: 62  DTLIALKHAAGHIRTELGKVLK-LRHIPSITFDKDTSLDYSMHIESLLN--EIKKDEE 116


>gi|121594898|ref|YP_986794.1| ribosome-binding factor A [Acidovorax sp. JS42]
 gi|171769419|sp|A1W8Z3|RBFA_ACISJ RecName: Full=Ribosome-binding factor A
 gi|120606978|gb|ABM42718.1| ribosome-binding factor A [Acidovorax sp. JS42]
          Length = 125

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 55/124 (44%), Gaps = 6/124 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K   +  R  +V ++++  L  +I   + +D  I   ++++  V ++ D   A V+ 
Sbjct: 1   MAAKKSSSPNRGFKVADQIQRDLTELIR--DLKDPRIG--MVTLQGVEVTPDYAHAKVFF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           S+      +    ALN    F+R  + + L ++  VP L F YD + +    +NAL+   
Sbjct: 57  SVL-IGDGEASEEALNQAAGFLRNGLFKRL-HIHTVPTLHFVYDRTTEKAADMNALIARA 114

Query: 121 KIPV 124
               
Sbjct: 115 VASR 118


>gi|300871728|ref|YP_003786601.1| ribosome-binding factor A [Brachyspira pilosicoli 95/1000]
 gi|300689429|gb|ADK32100.1| ribosome binding factor A [Brachyspira pilosicoli 95/1000]
          Length = 122

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 2/122 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            +S R LRV E ++  L  ++L  E +D  I  ++++I+ +  + DL+ A VY       
Sbjct: 1   MSSHRILRVNENIKQILSTILLR-EIEDPRIKNNLVTITRIDTAKDLKEAKVYFVCLDPS 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
             + V++ LN     I   + + L  +RYVP L F YD +L    K+ + +    I    
Sbjct: 60  KQNEVLNGLNSAKGVIFSYLRKQL-TIRYVPNLTFYYDKTLMETNKVLSEIRSLDIKEDS 118

Query: 127 EK 128
           ++
Sbjct: 119 QE 120


>gi|317133691|ref|YP_004093005.1| ribosome-binding factor A [Ethanoligenens harbinense YUAN-3]
 gi|315471670|gb|ADU28274.1| ribosome-binding factor A [Ethanoligenens harbinense YUAN-3]
          Length = 118

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 52/121 (42%), Gaps = 7/121 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
               R  R+ E+++  L  ++     +D  IS  ++SI  V +S DL  A VY+S     
Sbjct: 1   MPGYRLDRLTEDIKRELSDIVR--GLKDPRISG-LVSIVRVDVSNDLSYAKVYVSAVGGD 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVAL 126
           +   V   L     F R  +   L ++R  PELRF  D S++    +  L+   K     
Sbjct: 58  TAQAV-EGLKSAAGFARKTLSARL-HVRKTPELRFVADDSMEHSAHIAHLLQDIK--KDE 113

Query: 127 E 127
           E
Sbjct: 114 E 114


>gi|72161184|ref|YP_288841.1| ribosome-binding factor A [Thermobifida fusca YX]
 gi|123629956|sp|Q47RU9|RBFA_THEFY RecName: Full=Ribosome-binding factor A
 gi|71914916|gb|AAZ54818.1| ribosome-binding factor A [Thermobifida fusca YX]
          Length = 151

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           RA ++ + ++  +  ++     +D  +    +++++  ++ DLR ATVY ++   D    
Sbjct: 6   RASKLADRIQRIVAEMLERR-IKDPRLG--FVTVTDARLTNDLRDATVYYTVFGSDAEKA 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
              +AL      IR  +GR    LR+ P + F  D    +   +  L+   K
Sbjct: 63  ATAAALESAKGLIRSEVGRR-TGLRHTPTITFVIDEVPDNARHIEELLAKAK 113


>gi|312892434|ref|ZP_07751928.1| ribosome-binding factor A [Mucilaginibacter paludis DSM 18603]
 gi|311295068|gb|EFQ72243.1| ribosome-binding factor A [Mucilaginibacter paludis DSM 18603]
          Length = 125

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 51/120 (42%), Gaps = 3/120 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S+R  +    ++  L  +          +   +++I++V ++ DL +A V++S   + 
Sbjct: 1   MESKRQQKFAGVIQEDLAAIFQREGM--NFLPNTLVTITKVRVTPDLALARVFLSFFNNA 58

Query: 67  SPDRVISALNCNIKFIRGRIGRSLR-NLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
           +    +  +  +   IR ++G  ++  +R +P+L F  D +     +++ +         
Sbjct: 59  NTQLALQTIKLHASEIRYKLGSRIKDQVRIIPQLEFFVDDTSDYVERMDKIFDKIHKEEN 118


>gi|328944972|gb|EGG39129.1| ribosome-binding factor A [Streptococcus sanguinis SK1087]
          Length = 133

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 57/116 (49%), Gaps = 6/116 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
            N+ R  RVG E++  +  ++   + +D  +    ++I++V M  DL +A VY ++  + 
Sbjct: 2   ANNFRTDRVGMEIKREVNEILQK-KVRDPRVQG--VTITDVQMLGDLSMAKVYYTIMSNL 58

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                +  + L      I+  +G +L+  + +P+L F  D S++   K++ ++   
Sbjct: 59  ASDNQKAQTGLEKATGTIKRELGHNLKMYK-IPDLTFVKDESIEYGNKIDQMLRDL 113


>gi|209694191|ref|YP_002262119.1| ribosome-binding factor A [Aliivibrio salmonicida LFI1238]
 gi|226723591|sp|B6ENE3|RBFA_ALISL RecName: Full=Ribosome-binding factor A
 gi|208008142|emb|CAQ78284.1| ribosome-binding factor A [Aliivibrio salmonicida LFI1238]
          Length = 135

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 33/126 (26%), Positives = 66/126 (52%), Gaps = 7/126 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   RA RV ++++  L  ++   E +D  I   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRAQRVSQQLQKELAVILQR-EVRDSRIG--MVTISDVEVSRDLAYAKVFVTFFC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   +R  +G+ +R+ R  PE+RF YD +L    +++ L+    +
Sbjct: 58  VGEQTPETCLAALKEHEVPVRMMLGKRIRH-RLTPEVRFTYDNTLVEGMRMSNLVSDV-V 115

Query: 123 PVALEK 128
                K
Sbjct: 116 NTDKRK 121


>gi|117919480|ref|YP_868672.1| ribosome-binding factor A [Shewanella sp. ANA-3]
 gi|166219406|sp|A0KTZ7|RBFA_SHESA RecName: Full=Ribosome-binding factor A
 gi|117611812|gb|ABK47266.1| ribosome-binding factor A [Shewanella sp. ANA-3]
          Length = 146

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 60/126 (47%), Gaps = 10/126 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+ ++++  L  V+   + +D  I    +++++V +S DL  A V+++   
Sbjct: 1   MAKEFSRTRRIAQQLQQELAVVLQR-DMKDPRIG--FVTVNDVDVSRDLSYAKVFVTFFE 57

Query: 65  DVSP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL----MC 118
           +        ++AL     +IR  +   ++ LR +PE+RF YD+SL    +++ L    + 
Sbjct: 58  EDKELVQEKLNALITAAPYIRTLVAGRMK-LRVMPEIRFVYDSSLVEGMRMSNLVSQVIN 116

Query: 119 LPKIPV 124
             K   
Sbjct: 117 SDKAKQ 122


>gi|296454833|ref|YP_003661977.1| ribosome-binding factor A [Bifidobacterium longum subsp. longum
           JDM301]
 gi|296184265|gb|ADH01147.1| ribosome-binding factor A [Bifidobacterium longum subsp. longum
           JDM301]
          Length = 158

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 53/128 (41%), Gaps = 10/128 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
               + RA R+   ++  +   I   E  D+ +    I+++EV ++ DL++A VY +   
Sbjct: 1   MAGTNPRAARIAALIQRVVASSIER-ELHDKRL--ASITVTEVRVTNDLQIAKVYWTQLG 57

Query: 65  DV-----SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                     R   AL+     +R  +G     LR  P+L+F +D       ++  ++ +
Sbjct: 58  HEGHEEGERKRAQQALDQAKGHLRSLVGHK-AGLRLTPQLQFVFDEVPGEAHEIEDILAV 116

Query: 120 PKIPVALE 127
            K     E
Sbjct: 117 AK-KRDEE 123


>gi|239928607|ref|ZP_04685560.1| ribosome-binding factor A [Streptomyces ghanaensis ATCC 14672]
 gi|291436933|ref|ZP_06576323.1| ribosome-binding factor [Streptomyces ghanaensis ATCC 14672]
 gi|291339828|gb|EFE66784.1| ribosome-binding factor [Streptomyces ghanaensis ATCC 14672]
          Length = 149

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA R+ + +R  +   +     +D  +    ++I++  ++ DLR ATV+ ++  D 
Sbjct: 2   ADNARAKRLADLIREVVAQKLQRG-IKDPRLGTH-VTITDTRVTGDLREATVFYTVYGDD 59

Query: 67  SPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              +  +A L      +R  +GR+   +++ P L F  D    +   +  L+   +    
Sbjct: 60  EERKAAAAGLESAKGILRSEVGRA-AGVKFTPTLTFVMDALPDTARNIEDLLDKAR-QSD 117

Query: 126 LE 127
            +
Sbjct: 118 AK 119


>gi|153805797|ref|ZP_01958465.1| hypothetical protein BACCAC_00033 [Bacteroides caccae ATCC 43185]
 gi|149130474|gb|EDM21680.1| hypothetical protein BACCAC_00033 [Bacteroides caccae ATCC 43185]
          Length = 110

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 60/113 (53%), Gaps = 4/113 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   ++S+S V +S D+ +A VY+S+    
Sbjct: 1   METTRQNKISRLLQKELSEIFL---LQTKAMHGTLVSVSAVRISPDMSIARVYLSVFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLR-NLRYVPELRFRYDTSLQSYWKLNALMC 118
             + ++  +N N+K IR  +G  +R  LR +PEL+F  D SL    K+++L+ 
Sbjct: 58  KAEEMVKNINDNMKSIRYELGTRVRYQLRIIPELKFFVDDSLDYIEKIDSLLK 110


>gi|53804605|ref|YP_113776.1| ribosome-binding factor A [Methylococcus capsulatus str. Bath]
 gi|61214821|sp|Q609C1|RBFA_METCA RecName: Full=Ribosome-binding factor A
 gi|53758366|gb|AAU92657.1| ribosome-binding factor A [Methylococcus capsulatus str. Bath]
          Length = 119

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 56/123 (45%), Gaps = 5/123 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            P+   R+ RV  +++  +    L        +   ++++S+V +S DL VA V+++   
Sbjct: 1   MPREFSRSDRVSAQMQREIAE-FLRTGIDAPELG--MVTVSDVDVSRDLAVAKVFVTFLG 57

Query: 65  DV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                   +  L      +R  +GR +R +R +PE+RF YD SL+    ++ ++      
Sbjct: 58  ARLETRAAVKRLGEFAPQLRQVLGRRMR-MRIIPEIRFAYDDSLERGLHMDEVLRSLNKD 116

Query: 124 VAL 126
             L
Sbjct: 117 GDL 119


>gi|292669513|ref|ZP_06602939.1| ribosome-binding factor A [Selenomonas noxia ATCC 43541]
 gi|292648876|gb|EFF66848.1| ribosome-binding factor A [Selenomonas noxia ATCC 43541]
          Length = 133

 Score = 97.9 bits (243), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 58/115 (50%), Gaps = 5/115 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           R  ++ E ++  +  +I  +E +D  I    ++++ V  + DLR A +Y+S+  D     
Sbjct: 14  RVEKLQELMKQEISDIIF-HELKDPRIG--FVTVTSVACTEDLREAKIYVSVMGDEKKAR 70

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             ++ LN ++ F+R  IG+ +R LR+ PE+ F  DTSL     +  L+       
Sbjct: 71  DTLNGLNSSLGFVRREIGKRIR-LRFTPEISFALDTSLSYSDHIQRLLNEIHEDR 124


>gi|303232067|ref|ZP_07318770.1| ribosome-binding factor A [Veillonella atypica ACS-049-V-Sch6]
 gi|302513173|gb|EFL55212.1| ribosome-binding factor A [Veillonella atypica ACS-049-V-Sch6]
          Length = 118

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 60/118 (50%), Gaps = 7/118 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R  ++ E ++  +  +++    +D  I     ++++V ++ DLR AT+Y+SL   D   +
Sbjct: 5   RVRKLQEFIKQEVSQMLMRG-LKDPRIG--FTTVTDVHVTGDLREATIYVSLFGSDKEKE 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
             + AL      +R  +G+ L+ LR++P + F  D+SL     + +L+   +I    E
Sbjct: 62  DTLIALKHASGHVRTELGKVLK-LRHIPTITFDKDSSLDYSMHIESLLN--EIKKDEE 116


>gi|167836820|ref|ZP_02463703.1| ribosome-binding factor A [Burkholderia thailandensis MSMB43]
          Length = 138

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  +I+  E +D  I   +++I  V ++ D   A VY 
Sbjct: 17  MSKKRSSP-NRNVQIADQIQRDLSELIMR-EVKDPRIG--IVTIQSVELTPDYAHAKVYF 72

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +     +P     ALN     +   + + L ++  VP L F YD +++    ++ L+   
Sbjct: 73  TAL-TGNPADTQEALNHAAGHLHNLLFKRL-HIHTVPTLHFHYDQTIEKAVAMSRLIDEA 130

Query: 121 KIPVALE 127
               A +
Sbjct: 131 NATRAKD 137


>gi|149909279|ref|ZP_01897935.1| ribosome-binding factor A [Moritella sp. PE36]
 gi|149807596|gb|EDM67544.1| ribosome-binding factor A [Moritella sp. PE36]
          Length = 141

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 33/116 (28%), Positives = 62/116 (53%), Gaps = 8/116 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R+ RV ++++  +  ++   E +D  I   ++++S + +S DL  A VY++   
Sbjct: 1   MAKEFSRSRRVAQQLQQEVARILQR-EVKDPRIG--MVTVSSIDLSRDLSYAKVYVTFFN 57

Query: 65  DVSPDRV----ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
             + +      I+AL     +IR  +G +++ LR VPELRF YD +L    +L++L
Sbjct: 58  IDNDEDRVKEGIAALTAASGYIRSLVGSAMK-LRIVPELRFIYDNTLVEGMRLSSL 112


>gi|258545581|ref|ZP_05705815.1| ribosome-binding factor A [Cardiobacterium hominis ATCC 15826]
 gi|258519281|gb|EEV88140.1| ribosome-binding factor A [Cardiobacterium hominis ATCC 15826]
          Length = 128

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 57/118 (48%), Gaps = 6/118 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS--L 62
            PK   R  R+GE++R  L   +             ++SI+ V ++ DL  A VY++  +
Sbjct: 1   MPKGQDRTRRIGEQMRRDLAVAVPQ---ILDHPHASLLSITAVRVTRDLSFAKVYVTHVI 57

Query: 63  PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                   ++ ALN +   +R  + + L ++R +PEL F YD S++   +++ L+   
Sbjct: 58  NDADERQTLLRALNAHAGQLRHALAQKL-SIRKMPELHFVYDDSVEYGARMDHLLHDL 114


>gi|227486450|ref|ZP_03916766.1| ribosome-binding factor A [Anaerococcus lactolyticus ATCC 51172]
 gi|227235631|gb|EEI85646.1| ribosome-binding factor A [Anaerococcus lactolyticus ATCC 51172]
          Length = 127

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 67/122 (54%), Gaps = 3/122 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            N +R  R+  EV+  +  +I+++    RL +  ++S+++V ++ DL  A +YIS+  D 
Sbjct: 1   MNKKRTARISSEVKREISKIIMDDLNDPRLSAEAMVSVTDVEVTNDLSYADIYISVLGDN 60

Query: 67  S-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              D V+ ALN    +I+  IG  +R LR +PE RF++D S++    ++ L+    I   
Sbjct: 61  KTKDGVMEALNQAKGYIKILIGERMR-LRSMPEFRFKFDNSIEHGAYMDKLIAET-IAKD 118

Query: 126 LE 127
            +
Sbjct: 119 KK 120


>gi|329936652|ref|ZP_08286359.1| ribosome-binding factor A [Streptomyces griseoaurantiacus M045]
 gi|329303882|gb|EGG47765.1| ribosome-binding factor A [Streptomyces griseoaurantiacus M045]
          Length = 152

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 22/116 (18%), Positives = 53/116 (45%), Gaps = 4/116 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA R+ + +R  +   +     +D  +    ++I++  ++ DLR ATV+ ++  D 
Sbjct: 2   ADNARAKRLADLIREVVAQKLQRG-IKDPRLGSH-VTITDTRVTGDLREATVFYTVYGDE 59

Query: 67  SPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
              +  +A L      +R  +G++   +++ P L F  D    +   +  L+   +
Sbjct: 60  EERQAAAAGLESAKGILRSEVGKA-AGVKFTPTLAFVADALPDTARNIEDLLDKAR 114


>gi|326692684|ref|ZP_08229689.1| ribosome-binding factor A [Leuconostoc argentinum KCTC 3773]
          Length = 117

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/117 (24%), Positives = 54/117 (46%), Gaps = 6/117 (5%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD--VS 67
           +RA R+ +E++  +  ++L     D  +    ++++ V +S DL++AT+Y S+  D    
Sbjct: 5   QRAGRLAQEIQRDVTDLLLKR-INDPRVKD--VTVTSVELSGDLQIATIYYSILSDLASD 61

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
             +  + L      IR  +G  L   +  PELRF  D S+Q    +  L+       
Sbjct: 62  GQKAQAGLEAASGLIRKELGARLTVYK-TPELRFVRDQSVQYGNHIEDLIRKLHAEN 117


>gi|89095213|ref|ZP_01168136.1| Ribosome-binding factor A [Oceanospirillum sp. MED92]
 gi|89080510|gb|EAR59759.1| Ribosome-binding factor A [Oceanospirillum sp. MED92]
          Length = 135

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 62/120 (51%), Gaps = 10/120 (8%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             ++  R  R+ ++++  L   ++  E +D  +   ++++S V +S DL  A VYI++  
Sbjct: 1   MARDYSRTERIADQLQRELAQ-LIQFEIKDPRLG--MVTVSYVKVSKDLGFADVYITVLP 57

Query: 65  DVSPDRVISA------LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
               D   +       LN    F+RG + R+++ LR +P+LRF +D +++    L+ L+ 
Sbjct: 58  LNGKDEAEAIVDSLKVLNSAAGFLRGELARNIK-LRIMPQLRFHFDETIERGRHLHHLIE 116


>gi|262280760|ref|ZP_06058543.1| ribosome-binding factor A [Acinetobacter calcoaceticus RUH2202]
 gi|262257660|gb|EEY76395.1| ribosome-binding factor A [Acinetobacter calcoaceticus RUH2202]
          Length = 133

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 57/133 (42%), Gaps = 16/133 (12%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-- 66
           S+R  R+ + V+  L   ++  E +D  +   +++IS V +S D+  A VY+++      
Sbjct: 4   SQRLKRMADSVQRELSE-LIRQELKDPRLGG-LVTISAVKVSADMGYAEVYVTVMGRELG 61

Query: 67  ------SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL- 119
                 +    +  LN    F+R  + R ++  R  P LRF YD +      +  L+   
Sbjct: 62  DEQSEAANKETLDVLNKASGFLRHELSRRIKT-RITPRLRFHYDKTNAYGNYMFGLIEKA 120

Query: 120 ----PKIPVALEK 128
               PK     E+
Sbjct: 121 VNDLPKRESDDEQ 133


>gi|332828398|gb|EGK01107.1| ribosome-binding factor A [Dysgonomonas gadei ATCC BAA-286]
          Length = 117

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 26/112 (23%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ R  ++   ++  L  +        + +   ++S+S V +S DL +A VY+S+    
Sbjct: 1   MDTTRQQKINRLIQKELSEIFRKQT---QQMRGVLVSVSTVRVSPDLGLAKVYLSIFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSL-RNLRYVPELRFRYDTSLQSYWKLNALM 117
               ++  +  N+K +R  +G+ + + LR +PEL F  D SL     ++ L+
Sbjct: 58  QGKELLDNIKTNVKALRFDLGQKVGKQLRVIPELSFYLDDSLDYLDNIDKLL 109


>gi|83654922|gb|ABC38985.1| ribosome-binding factor A [Burkholderia thailandensis E264]
          Length = 138

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  +I+  E +D  I   +++I  V ++ D   A VY 
Sbjct: 17  MSKKRSSP-NRNVQIADQIQRDLSELIMR-EVKDPRIG--IVTIQSVELTPDYAHAKVYF 72

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +     +P     ALN     +   + + L ++  VP L F YD +++    ++ L+   
Sbjct: 73  TAL-TGNPADTQEALNHAAGHLHNLLFKRL-HIHTVPTLHFHYDQTIEKAVAMSRLIDEA 130

Query: 121 KIPVALE 127
               A +
Sbjct: 131 NATRAKD 137


>gi|310658993|ref|YP_003936714.1| 30S ribosome binding factor [Clostridium sticklandii DSM 519]
 gi|308825771|emb|CBH21809.1| 30s ribosome binding factor [Clostridium sticklandii]
          Length = 120

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 63/115 (54%), Gaps = 4/115 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLI--SRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           R  R+GEE++  +  ++ +   +D  I  SR +ISI+ V +  DL+ A +YIS+  +   
Sbjct: 5   RTRRIGEEIKKTITELLRDQRIKDIRIIDSRSLISITTVDVVRDLKYAYIYISVLGN-DS 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D+V+        FIR  +G+ ++ LRY PEL F+ D S++    ++ L+    I 
Sbjct: 64  DKVLEGFKSASGFIRKELGKDIK-LRYTPELVFKIDDSIERGVNMSKLINDLNIE 117


>gi|254482563|ref|ZP_05095802.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2148]
 gi|214037254|gb|EEB77922.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2148]
          Length = 132

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 55/120 (45%), Gaps = 7/120 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  RV + ++  L   ++ +E +D  +   ++SI+ V +S D+  A VY +   
Sbjct: 1   MAKEYARTQRVADFLQRELAA-LIQHEVRDPRVG--MVSITGVDVSRDMGHAKVYYTSMS 57

Query: 65  ---DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                       ALN    F+R ++ R   ++R VP+LRF +D+S+     +  L+    
Sbjct: 58  ANSTDESKECNEALNKAAGFLRSQLSRE-SSMRMVPQLRFYFDSSVGRGRDMEDLIRKAA 116


>gi|169634552|ref|YP_001708288.1| ribosome-binding factor A [Acinetobacter baumannii SDF]
 gi|169797406|ref|YP_001715199.1| ribosome-binding factor A [Acinetobacter baumannii AYE]
 gi|213155780|ref|YP_002317825.1| ribosome-binding factor A [Acinetobacter baumannii AB0057]
 gi|215484845|ref|YP_002327082.1| ribosome-binding factor A [Acinetobacter baumannii AB307-0294]
 gi|239500929|ref|ZP_04660239.1| ribosome-binding factor A [Acinetobacter baumannii AB900]
 gi|260556298|ref|ZP_05828517.1| ribosome-binding factor A [Acinetobacter baumannii ATCC 19606]
 gi|301345332|ref|ZP_07226073.1| ribosome-binding factor A [Acinetobacter baumannii AB056]
 gi|301513362|ref|ZP_07238599.1| ribosome-binding factor A [Acinetobacter baumannii AB058]
 gi|301594587|ref|ZP_07239595.1| ribosome-binding factor A [Acinetobacter baumannii AB059]
 gi|332855371|ref|ZP_08435836.1| ribosome-binding factor A [Acinetobacter baumannii 6013150]
 gi|332867633|ref|ZP_08437765.1| ribosome-binding factor A [Acinetobacter baumannii 6013113]
 gi|226736632|sp|B7H114|RBFA_ACIB3 RecName: Full=Ribosome-binding factor A
 gi|226736633|sp|B7I3S0|RBFA_ACIB5 RecName: Full=Ribosome-binding factor A
 gi|238685501|sp|A3M1K4|RBFA_ACIBT RecName: Full=Ribosome-binding factor A
 gi|238688105|sp|B0VE80|RBFA_ACIBY RecName: Full=Ribosome-binding factor A
 gi|238688130|sp|B0VLU1|RBFA_ACIBS RecName: Full=Ribosome-binding factor A
 gi|169150333|emb|CAM88230.1| ribosome-binding factor A [Acinetobacter baumannii AYE]
 gi|169153344|emb|CAP02457.1| ribosome-binding factor A [Acinetobacter baumannii]
 gi|193076183|gb|ABO10798.2| ribosome-binding factor A [Acinetobacter baumannii ATCC 17978]
 gi|213054940|gb|ACJ39842.1| ribosome-binding factor A [Acinetobacter baumannii AB0057]
 gi|213988968|gb|ACJ59267.1| ribosome-binding factor A [Acinetobacter baumannii AB307-0294]
 gi|260410353|gb|EEX03652.1| ribosome-binding factor A [Acinetobacter baumannii ATCC 19606]
 gi|332727503|gb|EGJ58929.1| ribosome-binding factor A [Acinetobacter baumannii 6013150]
 gi|332733827|gb|EGJ64974.1| ribosome-binding factor A [Acinetobacter baumannii 6013113]
          Length = 133

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/132 (23%), Positives = 56/132 (42%), Gaps = 16/132 (12%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV--- 66
           +R  R+ + V+  L   ++  E +D  +   +++IS V +S DL  A VY+++       
Sbjct: 5   QRLKRMADSVQRELSE-LIRQELKDPRLGG-LVTISGVKVSPDLGYADVYVTVMGRELSD 62

Query: 67  -----SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL-- 119
                +    +  LN    F+R  + R ++  R  P LRF YD +      +  L+    
Sbjct: 63  DQNEVAHRETLDILNKASGFLRQELSRRIKT-RITPRLRFHYDKTNAYGNYMFGLIEKAV 121

Query: 120 ---PKIPVALEK 128
              PK     E+
Sbjct: 122 QDLPKRESDDEE 133


>gi|221134840|ref|ZP_03561143.1| ribosome-binding factor A [Glaciecola sp. HTCC2999]
          Length = 144

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 56/125 (44%), Gaps = 6/125 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV ++V   +  ++   EF+ +     ++++S V +S DL  A VY++   
Sbjct: 1   MAREFSRTDRVSQQVHKEIASILNQ-EFKHQAPELCMVTVSGVEISRDLAHAKVYVTFLE 59

Query: 65  DVSP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                    ++ L     F+RG + R +R +R  P L+F  D S+    +++ ++    +
Sbjct: 60  MDEEKVKASMALLEEGKGFVRGLLSRRVR-MRNTPALKFIQDRSITEGMRISNIVSQ--V 116

Query: 123 PVALE 127
               E
Sbjct: 117 TRDEE 121


>gi|282879081|ref|ZP_06287841.1| ribosome-binding factor A [Prevotella buccalis ATCC 35310]
 gi|281298815|gb|EFA91224.1| ribosome-binding factor A [Prevotella buccalis ATCC 35310]
          Length = 111

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +  +     R     ++S++ V +S DL + T Y+S+      + 
Sbjct: 5   RQNRIARLLQKELAIIFQSQT---RATHGVMVSVTRVRVSPDLSICTAYLSIFPSEKAEE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           +I  +  N K IR  +G  +RN LR VPELRF  D SL     ++ L+  
Sbjct: 62  IIKNITANEKTIRYDLGTRVRNQLRIVPELRFFIDDSLDYIEHIDELLKK 111


>gi|50083630|ref|YP_045140.1| ribosome-binding factor A [Acinetobacter sp. ADP1]
 gi|61214998|sp|Q6FF39|RBFA_ACIAD RecName: Full=Ribosome-binding factor A
 gi|49529606|emb|CAG67318.1| ribosome-binding factor A [Acinetobacter sp. ADP1]
          Length = 133

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 13/128 (10%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-- 66
           S+R  R+ + V+  L   ++  E +D  +   +++IS V +S D+  A VY+++      
Sbjct: 4   SQRLKRMADSVQRELSE-LIRQELKDPRLGG-LVTISAVKVSADMGYAEVYVTVMGRELG 61

Query: 67  ------SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 +    +  LN    F+R  + R ++  R  P LRF YD +      +  L+   
Sbjct: 62  DEQSEAANKETLDVLNKASGFLRHELSRRIKT-RITPRLRFHYDKTNAYGNYMFGLI--E 118

Query: 121 KIPVALEK 128
           K    L +
Sbjct: 119 KAVQDLPE 126


>gi|325268521|ref|ZP_08135151.1| ribosome-binding factor A [Prevotella multiformis DSM 16608]
 gi|324989049|gb|EGC21002.1| ribosome-binding factor A [Prevotella multiformis DSM 16608]
          Length = 111

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 56/110 (50%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +        R++   ++S++ V +S DL + T Y+S+      + 
Sbjct: 5   RQNRIARLLQKELASIFQTQT---RMMHGVLVSVTRVKISPDLSICTAYLSIFPSEKGEE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +N N K +R  +G+ + N LR +PELRF  D SL    +++ L+  
Sbjct: 62  LLKNINANEKTVRYELGQRVHNQLRIIPELRFFIDDSLDYLDRIDELLKK 111


>gi|213693050|ref|YP_002323636.1| ribosome-binding factor A [Bifidobacterium longum subsp. infantis
           ATCC 15697]
 gi|254789734|sp|B7GNA2|RBFA_BIFLI RecName: Full=Ribosome-binding factor A
 gi|213524511|gb|ACJ53258.1| ribosome-binding factor A [Bifidobacterium longum subsp. infantis
           ATCC 15697]
 gi|320459227|dbj|BAJ69848.1| ribosome-binding factor [Bifidobacterium longum subsp. infantis
           ATCC 15697]
          Length = 158

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 53/128 (41%), Gaps = 10/128 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
               + RA R+   ++  +   I   E  D+ +    I+++EV ++ DL++A VY +   
Sbjct: 1   MAGTNPRAARIAALIQRVVASSIER-ELHDKRL--ASITVTEVRVTNDLQIAKVYWTQLG 57

Query: 65  DV-----SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                     R   AL+     +R  +G     LR  P+L+F +D       ++  ++ +
Sbjct: 58  HEGHEEGERKRAQQALDQAKGHLRSLVGHK-AGLRLTPQLQFVFDEVPGEAHEIEDILAV 116

Query: 120 PKIPVALE 127
            K     E
Sbjct: 117 AK-KRDEE 123


>gi|299771781|ref|YP_003733807.1| ribosome-binding factor A [Acinetobacter sp. DR1]
 gi|298701869|gb|ADI92434.1| ribosome-binding factor A [Acinetobacter sp. DR1]
          Length = 133

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 57/133 (42%), Gaps = 16/133 (12%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-- 66
           S+R  R+ + V+  L   ++  E +D  +   +++IS V +S D+  A VY+++      
Sbjct: 4   SQRLKRMADSVQRELSE-LIRQELKDPRLGG-LVTISAVKVSADMGYAEVYVTVMGRELG 61

Query: 67  ------SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL- 119
                 +    +  LN    F+R  + R ++  R  P LRF YD +      +  L+   
Sbjct: 62  DEQSEAANKETLDVLNKASGFLRHELSRRIKT-RITPRLRFHYDKTNAYGNYMFGLIEKA 120

Query: 120 ----PKIPVALEK 128
               PK     E+
Sbjct: 121 VNDLPKRDSDEEQ 133


>gi|323340007|ref|ZP_08080273.1| ribosome-binding factor A [Lactobacillus ruminis ATCC 25644]
 gi|323092513|gb|EFZ35119.1| ribosome-binding factor A [Lactobacillus ruminis ATCC 25644]
          Length = 118

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 24/112 (21%), Positives = 55/112 (49%), Gaps = 6/112 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD--VSP 68
           R  R+ +E++  +  +++    +D  +    ++I+ V ++ DL+ AT+Y S   +     
Sbjct: 6   RVGRLSQEIQREVNDILMKR-VRDPRVEG--VTITGVEVTGDLQNATIYYSTLSNLASDA 62

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++    L+     IR  +G+ L ++   PEL+F  D S++    ++ L+   
Sbjct: 63  EKTQKGLDKATGLIRRELGQRL-SIYVTPELKFVRDESVRYGDHIDELLNKL 113


>gi|84387284|ref|ZP_00990305.1| ribosome-binding factor A [Vibrio splendidus 12B01]
 gi|84377931|gb|EAP94793.1| ribosome-binding factor A [Vibrio splendidus 12B01]
          Length = 137

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 67/126 (53%), Gaps = 8/126 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  I   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVSQQLQKELALILQR-EVRDSRIG--MVTISDVEVSRDLAYAKVFVTFLC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
             + +P+  ++AL  +   +R  +G+ +R+ R  PE+RF YD +L    +++ L+   ++
Sbjct: 58  IGEQTPESCLAALKEHEVPVRMALGKRIRH-RLTPEVRFTYDNTLVEGMRMSNLVS--EV 114

Query: 123 PVALEK 128
               ++
Sbjct: 115 LNDDKR 120


>gi|226946306|ref|YP_002801379.1| ribosome-binding factor A [Azotobacter vinelandii DJ]
 gi|259551948|sp|C1DFK8|RBFA_AZOVD RecName: Full=Ribosome-binding factor A
 gi|226721233|gb|ACO80404.1| ribosome-binding factor A [Azotobacter vinelandii DJ]
          Length = 129

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 67/125 (53%), Gaps = 9/125 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K+  R  R+G++++  L   ++  E +D  +   +I+++ V ++ DL  A V+I++  
Sbjct: 1   MAKDYSRTQRIGDQMQRELS-FLIQREIKDPRLG--MITVTAVEVARDLSHAKVFITVMG 57

Query: 65  DVSP----DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                   +R +  L+    F+R ++G+S++ LR VP+L F YD S++   +L+AL+   
Sbjct: 58  KEDSADEIERNLEILHEAAGFLRMQLGKSMK-LRSVPQLHFSYDASVRRGVELSALIER- 115

Query: 121 KIPVA 125
            +   
Sbjct: 116 AVAED 120


>gi|326333607|ref|ZP_08199846.1| ribosome-binding factor A [Nocardioidaceae bacterium Broad-1]
 gi|325948623|gb|EGD40724.1| ribosome-binding factor A [Nocardioidaceae bacterium Broad-1]
          Length = 153

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 52/124 (41%), Gaps = 7/124 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
              +S R  R+ + ++  +  ++     +D  I    +++++V ++ D + AT++ ++  
Sbjct: 1   MNMSSPRVRRIADRIKVIVAQMLERR-IKDPRIG--FVTVTDVRVTGDSQQATIFYTVLG 57

Query: 65  DVSPDR---VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
             S        +AL      IR  + + L   R  P L F +D   ++   L+ ++   K
Sbjct: 58  ADSEAELAGTAAALESAKGLIRSEVAKQLGT-RTAPTLEFIHDALPETARHLDDVLARAK 116

Query: 122 IPVA 125
               
Sbjct: 117 AQDD 120


>gi|296135769|ref|YP_003643011.1| ribosome-binding factor A [Thiomonas intermedia K12]
 gi|294339932|emb|CAZ88295.1| ribosome-binding factor A [Thiomonas sp. 3As]
 gi|295795891|gb|ADG30681.1| ribosome-binding factor A [Thiomonas intermedia K12]
          Length = 120

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 55/120 (45%), Gaps = 8/120 (6%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK   P    R  R+ ++++  L  +I   E ++  +   ++++++V ++ D   A VY 
Sbjct: 1   MKRATP---NRTQRIADQIQRDLAELIQR-ELRNPQLG--LVTLTDVQLTPDYAHAKVYF 54

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           S+     PD     L+    ++   + + L  +  VP L F +D + +   +++ L+   
Sbjct: 55  SVIG-AEPDTARQILSDKAGYLHSLLFKRL-QIHTVPTLHFLFDPTTEKAAEMDGLIRQA 112


>gi|260583742|ref|ZP_05851490.1| ribosome-binding factor A [Granulicatella elegans ATCC 700633]
 gi|260158368|gb|EEW93436.1| ribosome-binding factor A [Granulicatella elegans ATCC 700633]
          Length = 119

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 56/124 (45%), Gaps = 7/124 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP--L 64
             + R  RV +E+   +  ++   + +D  +    I+I+EV ++ DL++ATVY +    L
Sbjct: 1   MANFRVGRVSQEILREVNDILSK-KVRDPRVQE--ITITEVDVTGDLQIATVYYTTLQTL 57

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                     L  +   IR  +G+ L +L   PEL F+ D S+     +  L+   +   
Sbjct: 58  ASERQATERGLEKSKGLIRRELGKRL-SLYKTPELIFKRDESVDYGNHIEELLKSIQ-QE 115

Query: 125 ALEK 128
             ++
Sbjct: 116 DEQR 119


>gi|160891600|ref|ZP_02072603.1| hypothetical protein BACUNI_04053 [Bacteroides uniformis ATCC 8492]
 gi|156859007|gb|EDO52438.1| hypothetical protein BACUNI_04053 [Bacteroides uniformis ATCC 8492]
          Length = 113

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 60/116 (51%), Gaps = 4/116 (3%)

Query: 4   KNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP 63
            N   + R  ++   ++  L  + L    Q + +   +IS+S V +S D+ VA  Y+S+ 
Sbjct: 1   MNSMETTRQNKIARLLQKELSDIFL---LQTKSMPGILISVSAVRISPDMSVARAYLSIF 57

Query: 64  LDVSPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
                + ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL    +++ L+ 
Sbjct: 58  PSEKSEEIVKNINGNMKSIRFELGTRVRHQLRIIPELKFFVDDSLDYLERIDELLK 113


>gi|120437657|ref|YP_863343.1| ribosome-binding factor A [Gramella forsetii KT0803]
 gi|171460864|sp|A0M6N1|RBFA_GRAFK RecName: Full=Ribosome-binding factor A
 gi|117579807|emb|CAL68276.1| ribosome-binding factor A [Gramella forsetii KT0803]
          Length = 131

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 27/115 (23%), Positives = 57/115 (49%), Gaps = 2/115 (1%)

Query: 8   NSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS 67
            + R  ++G  ++  L  ++  N  ++   +  +IS+S+V ++ DL +A  Y+S+     
Sbjct: 3   ETNRQKKIGGLLQKDLADIL-QNSLRESGRTGILISVSKVRVTTDLSIAKAYVSIFPSKH 61

Query: 68  PDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
            + VI  +N N   I+  + +  R+ LR +P+L F  D SL+    +   +   +
Sbjct: 62  QEEVIKEINENKSQIKHEMAQRTRHQLRKMPDLSFYVDDSLEYIDGIEKSIKGKE 116


>gi|313897482|ref|ZP_07831025.1| ribosome-binding factor A [Clostridium sp. HGF2]
 gi|312957852|gb|EFR39477.1| ribosome-binding factor A [Clostridium sp. HGF2]
          Length = 112

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 25/110 (22%), Positives = 55/110 (50%), Gaps = 5/110 (4%)

Query: 12  ALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRV 71
           A ++   ++  +  +I     +D  I    I+I++V ++ DL +A +Y+S       +  
Sbjct: 5   AEKIAGIIQKEISEII-QFSLKDPKIG--FITITDVTVTNDLSIAKIYVSFLGQKPREEA 61

Query: 72  -ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
            + AL+ +  ++R  + + +  +R VPEL F+ D SL+   K+  ++   
Sbjct: 62  GMKALDRSRGYLRSELAKRM-TIRKVPELIFKLDDSLERGNKIERIISEI 110


>gi|270158097|ref|ZP_06186754.1| ribosome-binding factor A [Legionella longbeachae D-4968]
 gi|269990122|gb|EEZ96376.1| ribosome-binding factor A [Legionella longbeachae D-4968]
          Length = 108

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 18  EVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDRVISALNC 77
            ++  L  +I   E +D  +    ++IS V ++ DL  A VY ++  D   + V S LN 
Sbjct: 1   MIQRKLAQIIPK-EVKDPRL-TGFVTISAVKVAADLGHAKVYFTVLND-DREMVASILNA 57

Query: 78  NIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
              ++R  + RS+  LR VP+L F YD S++   +L+ L+     P   E
Sbjct: 58  ASSYLRSVLARSI-TLRTVPQLHFVYDESIEYGQRLSRLIDKVAPPDDHE 106


>gi|224537525|ref|ZP_03678064.1| hypothetical protein BACCELL_02404 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224520838|gb|EEF89943.1| hypothetical protein BACCELL_02404 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 110

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 4/113 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   +IS+S V +S DL VA  Y+S+    
Sbjct: 1   METTRQNKIARLLQKELSDIFL---LQTKSMPGVLISVSAVRISPDLSVARAYLSIFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
             + +I  +N N+K IR  +G  +R+ LR +PEL+F  D SL    K++ L+ 
Sbjct: 58  KAEEIIKNVNDNMKSIRYELGTRVRHQLRIIPELKFFVDDSLDYLEKIDELLK 110


>gi|226951830|ref|ZP_03822294.1| ribosome-binding factor A [Acinetobacter sp. ATCC 27244]
 gi|294649084|ref|ZP_06726527.1| ribosome-binding factor A [Acinetobacter haemolyticus ATCC 19194]
 gi|226837370|gb|EEH69753.1| ribosome-binding factor A [Acinetobacter sp. ATCC 27244]
 gi|292825030|gb|EFF83790.1| ribosome-binding factor A [Acinetobacter haemolyticus ATCC 19194]
          Length = 132

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 30/132 (22%), Positives = 56/132 (42%), Gaps = 16/132 (12%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-- 66
           S+R  R+ + V+  L   ++  E +D  +   +++IS V +S D+  A VY+++      
Sbjct: 4   SQRLKRMADSVQRELSE-LIRQELKDPRLGG-LVTISAVKVSADMGYAEVYVTVMGRELG 61

Query: 67  ------SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL- 119
                 +    +  LN    F+R  + R ++  R  P LRF YD +      +  L+   
Sbjct: 62  DDQSEAANKETLDVLNKASGFLRHELSRRIKT-RITPRLRFHYDKTNAYGNYMFGLIAEA 120

Query: 120 ----PKIPVALE 127
               P+     E
Sbjct: 121 VKDLPEQEQDKE 132


>gi|222110451|ref|YP_002552715.1| ribosome-binding factor a [Acidovorax ebreus TPSY]
 gi|254789747|sp|B9MGP2|RBFA_DIAST RecName: Full=Ribosome-binding factor A
 gi|221729895|gb|ACM32715.1| ribosome-binding factor A [Acidovorax ebreus TPSY]
          Length = 125

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 55/124 (44%), Gaps = 6/124 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K   +  R  +V ++++  L  +I   + +D  I   ++++  V ++ D   A V+ 
Sbjct: 1   MAAKKSSSPNRGFKVADQIQRDLTELIR--DLKDPRIG--MVTLQGVEVTPDYAHAKVFF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           S+      +    ALN    F+R  + + L ++  VP L F YD + +    +NAL+   
Sbjct: 57  SVL-IGDGEASEEALNQAGGFLRNGLFKRL-HIHTVPTLHFVYDRTTEKAADMNALIARA 114

Query: 121 KIPV 124
               
Sbjct: 115 VASR 118


>gi|59711094|ref|YP_203870.1| ribosome-binding factor A [Vibrio fischeri ES114]
 gi|71648821|sp|Q5E7L4|RBFA_VIBF1 RecName: Full=Ribosome-binding factor A
 gi|59479195|gb|AAW84982.1| 30s ribosome binding factor [Vibrio fischeri ES114]
          Length = 135

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 32/114 (28%), Positives = 62/114 (54%), Gaps = 6/114 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  I   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVSQQLQKELAVMLQR-EVRDSRIG--MVTISDVEVSRDLAYAKVFVTFFC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
             + +P+  ++AL  +   +R  +G+ +R LR  PE+RF YD +L    +++ L
Sbjct: 58  VGEQTPESSLAALKEHEPSLRMMLGKRIR-LRLTPEIRFTYDNTLVEGMRMSNL 110


>gi|197334491|ref|YP_002155242.1| ribosome-binding factor A [Vibrio fischeri MJ11]
 gi|226723615|sp|B5FA80|RBFA_VIBFM RecName: Full=Ribosome-binding factor A
 gi|197315981|gb|ACH65428.1| ribosome-binding factor A [Vibrio fischeri MJ11]
          Length = 135

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 33/114 (28%), Positives = 62/114 (54%), Gaps = 6/114 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  RV ++++  L  ++   E +D  I   +++IS+V +S DL  A V+++   
Sbjct: 1   MSKEFSRTQRVSQQLQKELAVMLQR-EVRDSRIG--MVTISDVEVSRDLAYAKVFVTFFC 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
             D +P+  ++AL  +   +R  +G+ +R LR  PE+RF YD +L    +++ L
Sbjct: 58  VGDQTPESSLAALKEHEPSLRMMLGKRIR-LRLTPEIRFTYDNTLVEGMRMSNL 110


>gi|85712991|ref|ZP_01044029.1| ribosome-binding factor A [Idiomarina baltica OS145]
 gi|85693160|gb|EAQ31120.1| ribosome-binding factor A [Idiomarina baltica OS145]
          Length = 125

 Score = 97.1 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 60/123 (48%), Gaps = 7/123 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV  +++  +  ++   E +D  +S  ++++S+V +S DL  A V+++   
Sbjct: 1   MAQEFSRTERVRHQLQREIAMILQR-EVKDPRVS--MVTVSDVEVSRDLAYAKVFVTFLH 57

Query: 65  DVSPDRVI--SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
           D           LN    FIR  +G+ ++  R VPEL+F++D SL    +++ L+   + 
Sbjct: 58  DDDDQVKAGLKVLNQASGFIRSLLGKRIKA-RVVPELKFQHDGSLNEGIRMSRLVDEAR- 115

Query: 123 PVA 125
              
Sbjct: 116 KRD 118


>gi|332976698|gb|EGK13536.1| ribosome-binding factor A [Psychrobacter sp. 1501(2011)]
          Length = 141

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 55/120 (45%), Gaps = 11/120 (9%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD--- 65
           ++R  R+G++++  L  V++ +E  D  +    ++IS V +S DL  A +Y+++      
Sbjct: 2   NQRLQRLGDQIQRELA-VLIRDEINDPRL-TGFVTISSVKVSSDLGYADIYVTVMEPELN 59

Query: 66  -----VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 S +  +  LN    F+R  +  SL+  R  P LRF YD        +  L+   
Sbjct: 60  DAMSKHSHEESLQVLNKAAGFLRTELSHSLKT-RTTPRLRFHYDEVTAQGNYMMDLINKA 118


>gi|320103079|ref|YP_004178670.1| ribosome-binding factor A [Isosphaera pallida ATCC 43644]
 gi|319750361|gb|ADV62121.1| ribosome-binding factor A [Isosphaera pallida ATCC 43644]
          Length = 180

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 51/118 (43%), Gaps = 5/118 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             S R L+V E +R  +   IL  E  D  I    +++  V +  DLR A V++S+    
Sbjct: 1   MPSHRPLKVAEAIREVVAHSIL-FELSDPRIKN--VTVLRVEVPGDLRTAKVFVSVMGPP 57

Query: 67  SPDRVI-SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
               +    L     F++ ++   L  ++ VP L F  D SL+   ++ AL    +  
Sbjct: 58  KTQSLSLRGLQSARGFLQSKVAARL-QMKTVPILSFELDDSLRKAQEMAALFARAEAE 114


>gi|290581064|ref|YP_003485456.1| ribosome binding factor A [Streptococcus mutans NN2025]
 gi|254997963|dbj|BAH88564.1| ribosome binding factor A [Streptococcus mutans NN2025]
          Length = 117

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 59/119 (49%), Gaps = 6/119 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
            ++ R  RVG E++  +  ++   + +D  +    ++I++V MS DL +A VY ++  D 
Sbjct: 1   MSNHRIERVGMEIKREVNEILQK-KVRDPRVQG--VTITDVQMSGDLSLAKVYYTIMSDL 57

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                +V   L      I+  +G++L  +  +P+L F  D S++   K++ ++   +  
Sbjct: 58  ASDNQKVQIGLEKAKGTIKRELGKNL-TMYKIPDLTFIKDESIEYGNKIDQMLRDLEKR 115


>gi|53715758|ref|YP_101750.1| ribosome-binding factor A [Bacteroides fragilis YCH46]
 gi|60683689|ref|YP_213833.1| putative ribosome-binding factor A [Bacteroides fragilis NCTC 9343]
 gi|253566429|ref|ZP_04843882.1| ribosome-binding factor A [Bacteroides sp. 3_2_5]
 gi|265767300|ref|ZP_06094966.1| ribosome-binding factor A [Bacteroides sp. 2_1_16]
 gi|52218623|dbj|BAD51216.1| ribosome-binding factor A [Bacteroides fragilis YCH46]
 gi|60495123|emb|CAH09944.1| putative ribosome-binding factor A [Bacteroides fragilis NCTC 9343]
 gi|251944601|gb|EES85076.1| ribosome-binding factor A [Bacteroides sp. 3_2_5]
 gi|263252605|gb|EEZ24117.1| ribosome-binding factor A [Bacteroides sp. 2_1_16]
 gi|301165202|emb|CBW24773.1| putative ribosome-binding factor A [Bacteroides fragilis 638R]
          Length = 110

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 61/113 (53%), Gaps = 4/113 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   ++S+S V +S D+ +A VY+S+    
Sbjct: 1   METTRQNKISRLLQKELSEIFL---LQTKAMPGVLVSVSAVRISPDMSIARVYLSIFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
             + ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL    K++AL+ 
Sbjct: 58  KSEEMVKNINNNMKSIRFELGTRVRHQLRIIPELKFFVDDSLDYIEKIDALLK 110


>gi|153004010|ref|YP_001378335.1| ribosome-binding factor A [Anaeromyxobacter sp. Fw109-5]
 gi|166218417|sp|A7H9F5|RBFA_ANADF RecName: Full=Ribosome-binding factor A
 gi|152027583|gb|ABS25351.1| ribosome-binding factor A [Anaeromyxobacter sp. Fw109-5]
          Length = 122

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 55/115 (47%), Gaps = 4/115 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP-LDVSP 68
            R  RV EE R  L  VI     +D  +    I+++   MS DL+  T Y+S+   D   
Sbjct: 5   SRPARVAEEFRHGLADVIARG-LKDPRV-TGFITVTGAKMSPDLKEVTAYVSIHAEDAER 62

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           +R +  L     F++  + RSLR LR+ P LRF YD S+    ++  L+   +  
Sbjct: 63  ERTLEGLKAASTFLQREVARSLR-LRHTPHLRFVYDESVARGDRIERLLKEAREK 116


>gi|91782990|ref|YP_558196.1| ribosome-binding factor A [Burkholderia xenovorans LB400]
 gi|123168609|sp|Q140U5|RBFA_BURXL RecName: Full=Ribosome-binding factor A
 gi|91686944|gb|ABE30144.1| ribosome-binding factor A [Burkholderia xenovorans LB400]
          Length = 121

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 57/127 (44%), Gaps = 7/127 (5%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  ++   E +D  I   +++I  V ++ D   A VY 
Sbjct: 1   MPKKRSSP-NRNVQIADQIQRDLSELLR--EVKDPRIG--LVTIQSVELTPDYAHAKVYF 55

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +      P + + AL      +  ++ + L ++  VP L F YD +++   +++ L+   
Sbjct: 56  TTL-TGDPQQTLEALTHAAGHLHNQLFKRL-HIHTVPTLHFHYDKTIERAVEMSRLIDEA 113

Query: 121 KIPVALE 127
               A E
Sbjct: 114 NANRAKE 120


>gi|329962338|ref|ZP_08300343.1| ribosome-binding factor A [Bacteroides fluxus YIT 12057]
 gi|328530199|gb|EGF57080.1| ribosome-binding factor A [Bacteroides fluxus YIT 12057]
          Length = 110

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 59/113 (52%), Gaps = 4/113 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   ++S+S V +S D+ VA  Y+S+    
Sbjct: 1   METTRQNKIARLLQKELSEIFL---LQAKSMPGVLVSVSAVRISPDMSVARAYLSIFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
             + +I  +N N+K +R  +G  +R+ LR VPEL+F  D SL    K++ L+ 
Sbjct: 58  KGEEMIKNINANMKSVRYELGTRVRHQLRIVPELKFFVDDSLDYLEKIDELLK 110


>gi|303236415|ref|ZP_07323004.1| ribosome-binding factor A [Prevotella disiens FB035-09AN]
 gi|302483387|gb|EFL46393.1| ribosome-binding factor A [Prevotella disiens FB035-09AN]
          Length = 111

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +  +     R +   ++S++   +S DL + T Y+S+      + 
Sbjct: 5   RQNRIARLLQKELASIFQSQT---RAMHGVLVSVTRAKVSPDLGICTAYLSIFPSEKSEE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +N N K IR  +G+ + N LR +PELRF  D SL    +++ L+  
Sbjct: 62  LLENINKNEKSIRFELGQRVHNQLRIIPELRFFIDDSLDYIERIDELLKK 111


>gi|325661691|ref|ZP_08150314.1| ribosome-binding factor A [Lachnospiraceae bacterium 4_1_37FAA]
 gi|325471944|gb|EGC75159.1| ribosome-binding factor A [Lachnospiraceae bacterium 4_1_37FAA]
          Length = 119

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 58/124 (46%), Gaps = 6/124 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV  EV+  L  ++  +  +D  +   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRVNMEVQRELSSIL-RDGIKDPRV-APMTSVVAVEVAPDLKTCKAYISVLG 58

Query: 65  DVSPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D    +  ++ L     +IR  +   L N+R  PE++F  D S++    ++  +   ++ 
Sbjct: 59  DEKAQQDTVAGLQSAEGYIRRELAHRL-NMRNTPEVKFVLDQSIEYGVSMSKKID--EVT 115

Query: 124 VALE 127
             ++
Sbjct: 116 KDIK 119


>gi|332879858|ref|ZP_08447547.1| ribosome-binding factor A [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332682235|gb|EGJ55143.1| ribosome-binding factor A [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 130

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 54/116 (46%), Gaps = 2/116 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  V+     +D      ++S+++V +++DL VA VY+S+  + 
Sbjct: 1   MENNRQKKIAGIIQEELAKVLQQ-SIRDAGQQNLLVSVTKVTVTIDLSVAKVYLSVFPEA 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               V+  +  N   I+  + +  ++  R +PEL F  D SLQ    +   +   +
Sbjct: 60  KAAEVLKGVTSNSPLIKHELSQITKHQFRRMPELLFYIDDSLQYIEGIEQSLKEEE 115


>gi|71064651|ref|YP_263378.1| ribosome-binding factor A [Psychrobacter arcticus 273-4]
 gi|123649860|sp|Q4FVL4|RBFA_PSYA2 RecName: Full=Ribosome-binding factor A
 gi|71037636|gb|AAZ17944.1| ribosome-binding factor A [Psychrobacter arcticus 273-4]
          Length = 134

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 55/128 (42%), Gaps = 11/128 (8%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL---- 64
           ++R  R+ ++++  L  V++ +   D  +    ++IS V +S DL  A VY+++      
Sbjct: 2   NQRLQRLADQIQRELA-VLIRDAVNDPRL-TGFVTISSVKVSPDLGYADVYVTIMEPELN 59

Query: 65  ----DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 + +  I  LN    F+R  +  SL+  R  P LRF YD        +  L+   
Sbjct: 60  DAMTMSNHEESIKVLNKAAGFLRTELSHSLKT-RTTPRLRFHYDEVTARGNYMMDLISKA 118

Query: 121 KIPVALEK 128
            I     +
Sbjct: 119 VIKTEENE 126


>gi|296113975|ref|YP_003627913.1| ribosome-binding factor A [Moraxella catarrhalis RH4]
 gi|295921669|gb|ADG62020.1| ribosome-binding factor A [Moraxella catarrhalis RH4]
 gi|326559312|gb|EGE09739.1| ribosome-binding factor A [Moraxella catarrhalis 7169]
 gi|326564312|gb|EGE14542.1| ribosome-binding factor A [Moraxella catarrhalis 103P14B1]
 gi|326565078|gb|EGE15271.1| ribosome-binding factor A [Moraxella catarrhalis 46P47B1]
 gi|326567246|gb|EGE17366.1| ribosome-binding factor A [Moraxella catarrhalis 12P80B1]
 gi|326568249|gb|EGE18331.1| ribosome-binding factor A [Moraxella catarrhalis BC8]
 gi|326569950|gb|EGE19997.1| ribosome-binding factor A [Moraxella catarrhalis BC1]
 gi|326570028|gb|EGE20074.1| ribosome-binding factor A [Moraxella catarrhalis BC7]
 gi|326572885|gb|EGE22870.1| ribosome-binding factor A [Moraxella catarrhalis CO72]
 gi|326573667|gb|EGE23625.1| ribosome-binding factor A [Moraxella catarrhalis O35E]
 gi|326574711|gb|EGE24647.1| ribosome-binding factor A [Moraxella catarrhalis 101P30B1]
          Length = 141

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 55/116 (47%), Gaps = 11/116 (9%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS- 67
           ++R  R+ ++++  L  +++ +E  D  +    ++IS V +S DL  A VY+++      
Sbjct: 2   NQRLQRLADQIQRTLA-ILIRDEINDPRL-TGFVTISSVKVSPDLGYADVYVTILEPSQD 59

Query: 68  -------PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
                    + +  LN    F+R  + R+++  R  P LRF YD       ++ +L
Sbjct: 60  GGMNSEAHAQSLKVLNTAAGFLRTELARTMKT-RTTPRLRFHYDEVTAHGNRMMSL 114


>gi|227510257|ref|ZP_03940306.1| ribosome-binding factor A [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227524401|ref|ZP_03954450.1| ribosome-binding factor A [Lactobacillus hilgardii ATCC 8290]
 gi|227088632|gb|EEI23944.1| ribosome-binding factor A [Lactobacillus hilgardii ATCC 8290]
 gi|227189909|gb|EEI69976.1| ribosome-binding factor A [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 116

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 55/117 (47%), Gaps = 7/117 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP--LDVSP 68
           R  R+ +E++  +  ++L    +D  +    ++++ V ++ DL+ AT+Y S+        
Sbjct: 5   RVGRLEQEIQREVNDILLKR-VRDPRVQG--VTLTGVEVTGDLQQATIYYSILSDDKADE 61

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
           +     L      IRG +G  L   +  PE++F  DTS+Q   K++ L+   K    
Sbjct: 62  ETTAKGLEKATGLIRGELGSRLSIYK-TPEIKFELDTSVQYGDKIDRLINKLK-RED 116


>gi|116618449|ref|YP_818820.1| ribosome-binding factor A [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|227431855|ref|ZP_03913879.1| ribosome-binding factor A [Leuconostoc mesenteroides subsp.
           cremoris ATCC 19254]
 gi|122271351|sp|Q03WH5|RBFA_LEUMM RecName: Full=Ribosome-binding factor A
 gi|116097296|gb|ABJ62447.1| ribosome-binding factor A [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|227352397|gb|EEJ42599.1| ribosome-binding factor A [Leuconostoc mesenteroides subsp.
           cremoris ATCC 19254]
          Length = 117

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 55/113 (48%), Gaps = 6/113 (5%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD--VS 67
           +RA R+ +EV+  +  ++L     D  +    ++++ V +S DL++AT+Y S+  D    
Sbjct: 5   QRAGRLAQEVQRDVTDLLLKR-INDPRVKE--VTVTSVELSGDLQIATIYYSILSDLASD 61

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  + L      IR  +G  L   +  PEL+F  DTS+Q    +  L+   
Sbjct: 62  AKKTQAGLEAASGLIRKELGSRLTVYK-TPELKFVRDTSVQYGNHIEDLIRKL 113


>gi|331701350|ref|YP_004398309.1| ribosome-binding factor A [Lactobacillus buchneri NRRL B-30929]
 gi|329128693|gb|AEB73246.1| Ribosome-binding factor A [Lactobacillus buchneri NRRL B-30929]
          Length = 117

 Score = 97.1 bits (241), Expect = 7e-19,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 58/119 (48%), Gaps = 8/119 (6%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV--SP 68
           R  R+ +E++  +  ++L    +D  +    ++++ V ++ DL+ AT+Y S+  D     
Sbjct: 5   RVGRLEQEIQKEVNDILLKR-VRDPRVQG--VTLTGVEVTGDLQQATIYYSILSDKKEDE 61

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           +     L      IRG +G  L   +  PE++F  DTS+Q   K++ L+   K+    E
Sbjct: 62  ETTAKGLEKASGLIRGELGHRLSIYK-TPEIKFELDTSVQYGDKIDRLIN--KLNQDGE 117


>gi|171058385|ref|YP_001790734.1| ribosome-binding factor A [Leptothrix cholodnii SP-6]
 gi|238689092|sp|B1XY68|RBFA_LEPCP RecName: Full=Ribosome-binding factor A
 gi|170775830|gb|ACB33969.1| ribosome-binding factor A [Leptothrix cholodnii SP-6]
          Length = 123

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 7/127 (5%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M+NK      R  RV ++++  +  +I   + +D  I   +++I+ V ++ D   A VY 
Sbjct: 1   MRNKRVIP-NRTFRVSDQIQRDVAELIR--DLKDPRIG--MVTINSVDITPDYAHAKVYF 55

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           S+           ALN    F+R  + + L  +  VP L F +D + +   +L+AL+   
Sbjct: 56  SVL-IGDAADSELALNEAAGFLRNGLFKRL-QIHTVPTLHFHFDRTTERAAELSALITQA 113

Query: 121 KIPVALE 127
               AL+
Sbjct: 114 NARRALD 120


>gi|167766531|ref|ZP_02438584.1| hypothetical protein CLOSS21_01037 [Clostridium sp. SS2/1]
 gi|317498931|ref|ZP_07957214.1| ribosome-binding factor A [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167711654|gb|EDS22233.1| hypothetical protein CLOSS21_01037 [Clostridium sp. SS2/1]
 gi|291558570|emb|CBL37370.1| ribosome-binding factor A [butyrate-producing bacterium SSC/2]
 gi|316893764|gb|EFV15963.1| ribosome-binding factor A [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 123

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 30/117 (25%), Positives = 55/117 (47%), Gaps = 4/117 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV+  L  +I   E +D  I   + S+ +  ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRINGEVQRELSRIISR-EIKDPRI-APMTSVVDAVVTSDLKQCKAYISVLG 58

Query: 65  DVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +    +  +  LN  + +IR  +  S+ NLR  PE+ F  D S++    ++  +   
Sbjct: 59  NDEEKEETMKGLNSAVGYIRRELAHSI-NLRNTPEITFILDDSIEYGVNMSKKIDEL 114


>gi|69246866|ref|ZP_00604158.1| Ribosome-binding factor A [Enterococcus faecium DO]
 gi|257882940|ref|ZP_05662593.1| ribosome-binding factor A [Enterococcus faecium 1,231,502]
 gi|257889281|ref|ZP_05668934.1| ribosome-binding factor A [Enterococcus faecium 1,231,410]
 gi|258615954|ref|ZP_05713724.1| ribosome-binding factor A [Enterococcus faecium DO]
 gi|260560107|ref|ZP_05832285.1| ribosome-binding factor A [Enterococcus faecium C68]
 gi|293560196|ref|ZP_06676698.1| ribosome-binding factor A [Enterococcus faecium E1162]
 gi|294620767|ref|ZP_06699974.1| ribosome-binding factor A [Enterococcus faecium U0317]
 gi|314937509|ref|ZP_07844842.1| ribosome-binding factor A [Enterococcus faecium TX0133a04]
 gi|314942168|ref|ZP_07849022.1| ribosome-binding factor A [Enterococcus faecium TX0133C]
 gi|314947492|ref|ZP_07850907.1| ribosome-binding factor A [Enterococcus faecium TX0082]
 gi|314951479|ref|ZP_07854528.1| ribosome-binding factor A [Enterococcus faecium TX0133A]
 gi|314992569|ref|ZP_07857987.1| ribosome-binding factor A [Enterococcus faecium TX0133B]
 gi|314995496|ref|ZP_07860596.1| ribosome-binding factor A [Enterococcus faecium TX0133a01]
 gi|68195047|gb|EAN09510.1| Ribosome-binding factor A [Enterococcus faecium DO]
 gi|257818598|gb|EEV45926.1| ribosome-binding factor A [Enterococcus faecium 1,231,502]
 gi|257825641|gb|EEV52267.1| ribosome-binding factor A [Enterococcus faecium 1,231,410]
 gi|260073942|gb|EEW62266.1| ribosome-binding factor A [Enterococcus faecium C68]
 gi|291599747|gb|EFF30757.1| ribosome-binding factor A [Enterococcus faecium U0317]
 gi|291605868|gb|EFF35300.1| ribosome-binding factor A [Enterococcus faecium E1162]
 gi|313590330|gb|EFR69175.1| ribosome-binding factor A [Enterococcus faecium TX0133a01]
 gi|313592861|gb|EFR71706.1| ribosome-binding factor A [Enterococcus faecium TX0133B]
 gi|313596319|gb|EFR75164.1| ribosome-binding factor A [Enterococcus faecium TX0133A]
 gi|313599091|gb|EFR77936.1| ribosome-binding factor A [Enterococcus faecium TX0133C]
 gi|313643150|gb|EFS07730.1| ribosome-binding factor A [Enterococcus faecium TX0133a04]
 gi|313646042|gb|EFS10622.1| ribosome-binding factor A [Enterococcus faecium TX0082]
          Length = 115

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 53/116 (45%), Gaps = 6/116 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
             + R  RVG+E+   +  ++   + +D  +    ++I++V ++ DL+ AT+Y S+  D 
Sbjct: 1   MANYRDRRVGQEILKEVNDIL-RKKVRDPRVEN--VTITDVKVTGDLQQATIYYSILSDL 57

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                     LN     IR  +G +L   +  PEL F  D S+     ++ L+   
Sbjct: 58  ASDKKTAQDGLNKASGLIRRELGHNLSIYK-TPELFFELDESVVYGNHIDELLRDL 112


>gi|289550938|ref|YP_003471842.1| Ribosome-binding factor A [Staphylococcus lugdunensis HKU09-01]
 gi|315658440|ref|ZP_07911312.1| ribosome-binding factor A [Staphylococcus lugdunensis M23590]
 gi|289180470|gb|ADC87715.1| Ribosome-binding factor A [Staphylococcus lugdunensis HKU09-01]
 gi|315496769|gb|EFU85092.1| ribosome-binding factor A [Staphylococcus lugdunensis M23590]
          Length = 115

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 60/111 (54%), Gaps = 5/111 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           RA RVGE+++  +M + +NN+ +D  +    I+I++V ++ DL  A V++++       D
Sbjct: 5   RAERVGEQMKKEIMDI-VNNKVKDPRVG--FITITDVDLTNDLSQAKVFLTVLGSDKEID 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
               AL+    FI+  +   +R LR +PEL F YD S+    K+  ++   
Sbjct: 62  DTFKALDKAKGFIKSELATRMR-LRIIPELSFEYDKSIDYGNKIEKMIRDL 111


>gi|331090934|ref|ZP_08339776.1| ribosome-binding factor A [Lachnospiraceae bacterium 2_1_46FAA]
 gi|330405156|gb|EGG84692.1| ribosome-binding factor A [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 123

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 56/125 (44%), Gaps = 6/125 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  RV  EV+  L  + +    +D  +   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSIKNTRVNMEVQRELSNI-VRGGIKDPRV-APMTSVVAVEVAPDLKTCKAYISVFG 58

Query: 65  DVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D    +  +  L     +IR  +  +L N+R  PE++F  D S+     ++  +    + 
Sbjct: 59  DEMAQEDTLKGLQSAEGYIRRELAHNL-NMRNTPEIKFVLDQSIAYGVAMSKKIDD--VT 115

Query: 124 VALEK 128
             +++
Sbjct: 116 KDIKE 120


>gi|172045663|sp|A8EYY5|RBFA_RICCK RecName: Full=Ribosome-binding factor A
          Length = 129

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 28/130 (21%), Positives = 60/130 (46%), Gaps = 3/130 (2%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           MK     N+ R  ++   +   L+ ++   +  D  +    ++I++V ++ DL++A  Y 
Sbjct: 1   MKKLTKTNAHRQQKLASIINEVLIEILRRGKMLDIRLFNCPLAITKVIVTADLKIANCYF 60

Query: 61  SLPLDV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                  + D ++ ALN +   IR  +   + N+++ PE+RF YD    +  K+  L+  
Sbjct: 61  LPFNTKLTIDDIMDALNNSKNAIRNFVTNKI-NMKFSPEIRFHYDHGFDNAIKVEKLLKN 119

Query: 120 PKI-PVALEK 128
             +     +K
Sbjct: 120 ISLKRRDKDK 129


>gi|29348248|ref|NP_811751.1| ribosome-binding factor A [Bacteroides thetaiotaomicron VPI-5482]
 gi|253569386|ref|ZP_04846796.1| ribosome-binding factor A [Bacteroides sp. 1_1_6]
 gi|298386059|ref|ZP_06995616.1| ribosome-binding factor A [Bacteroides sp. 1_1_14]
 gi|29340151|gb|AAO77945.1| ribosome-binding factor A [Bacteroides thetaiotaomicron VPI-5482]
 gi|251841405|gb|EES69486.1| ribosome-binding factor A [Bacteroides sp. 1_1_6]
 gi|298261287|gb|EFI04154.1| ribosome-binding factor A [Bacteroides sp. 1_1_14]
          Length = 110

 Score = 97.1 bits (241), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 61/113 (53%), Gaps = 4/113 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   +IS+S V +S D+ +A VY+S+    
Sbjct: 1   METTRQNKISRLLQKELSEIFL---LQTKAMPGILISVSAVRISPDMSIARVYLSVFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
             + ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL    K+++L+ 
Sbjct: 58  KAEEMVKNINENMKSIRFELGTRVRHQLRIIPELKFFVDDSLDYIEKIDSLLK 110


>gi|150024347|ref|YP_001295173.1| ribosome-binding factor A [Flavobacterium psychrophilum JIP02/86]
 gi|172048600|sp|A6GW80|RBFA_FLAPJ RecName: Full=Ribosome-binding factor A
 gi|149770888|emb|CAL42353.1| Ribosome-binding factor A [Flavobacterium psychrophilum JIP02/86]
          Length = 130

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 2/116 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++G  ++  L+ ++   E +   IS  VIS+S+V ++ DL VA VY+S+    
Sbjct: 1   METNRQKKIGGVIQKDLVDIL-QGEIRKNGISNLVISVSKVSVTTDLGVARVYLSVFPQE 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLR-NLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               ++ ++  N+  I+  + + +R  LR VP L F  D SL    K++  +   +
Sbjct: 60  KAPEILESIKSNMYLIKHDLSQRVRLQLRKVPNLAFYIDDSLDYIEKIDNALAGKE 115


>gi|89101191|ref|ZP_01174022.1| ribosome-binding factor A [Bacillus sp. NRRL B-14911]
 gi|89084100|gb|EAR63270.1| ribosome-binding factor A [Bacillus sp. NRRL B-14911]
          Length = 112

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/103 (28%), Positives = 54/103 (52%), Gaps = 5/103 (4%)

Query: 19  VRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-DRVISALNC 77
           ++  L  +I   + +D  I    +++++V ++ DL+ ATVYIS+  D    +  +  L  
Sbjct: 1   MKKELGEIIGR-KIKDPRIG--FVTVTDVAVTGDLQQATVYISVLGDEEKRENTLKGLAK 57

Query: 78  NIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              FIR  IG+ +R LR  PE+ F +D S+    +++ L+   
Sbjct: 58  AKGFIRSEIGQRIR-LRKTPEIIFEFDESIDYGNRIDTLLHKI 99


>gi|271963650|ref|YP_003337846.1| ribosome-binding factor A-like protein [Streptosporangium roseum
           DSM 43021]
 gi|270506825|gb|ACZ85103.1| Ribosome-binding factor A-like protein [Streptosporangium roseum
           DSM 43021]
          Length = 160

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 51/118 (43%), Gaps = 6/118 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-SPD 69
           RA ++ + ++  +  ++     +D  +    +++++  ++ DL  ATV+ ++        
Sbjct: 5   RARKIADRIQQVVAEMLERR-IKDPRLG--FVTVTDTRITNDLSEATVFYTVFGSEAERA 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
              +AL      IR  +GR    LR+ P L F +D    S   L+ L+   K     E
Sbjct: 62  DSATALESAKGLIRSEVGRQ-TGLRHTPTLTFTHDPLPDSARHLDGLLAEAK-ARDAE 117


>gi|256821532|ref|YP_003145495.1| ribosome-binding factor A [Kangiella koreensis DSM 16069]
 gi|256795071|gb|ACV25727.1| ribosome-binding factor A [Kangiella koreensis DSM 16069]
          Length = 122

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 62/121 (51%), Gaps = 8/121 (6%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           RA RV ++++  L  V+L  E +D  +   ++++S V ++ DL+ A V+++         
Sbjct: 5   RAKRVADQIQRDLA-VLLQREMKDPRLG--IVTVSGVEVTSDLQNAKVFVTFLGKDEEQE 61

Query: 71  VISALN---CNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           +  AL        F+R ++ +S+R +R VP LRF +D S+    K+ +L+    I     
Sbjct: 62  IKQALEVLTGAAGFLRSQLAKSIR-MRSVPSLRFLFDKSIVEGQKMTSLI-DKAISEDES 119

Query: 128 K 128
           K
Sbjct: 120 K 120


>gi|71280573|ref|YP_268929.1| ribosome-binding factor A [Colwellia psychrerythraea 34H]
 gi|123632666|sp|Q482T8|RBFA_COLP3 RecName: Full=Ribosome-binding factor A
 gi|71146313|gb|AAZ26786.1| ribosome-binding factor A [Colwellia psychrerythraea 34H]
          Length = 142

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RVG++++  +  +++  E +D  +S  + ++S V ++ DL  A ++++   
Sbjct: 1   MAREYARTDRVGQQIQKEIATILMR-EIKDPRLS--MTTVSAVEVTRDLAYAKIFVTFFN 57

Query: 65  DVSPDR--VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
           D   +    +  L     +IR  +G+ LR  R +P LRF YD+S+    +++AL+    +
Sbjct: 58  DNQDEIKASLEVLAEAEGYIRSLLGKRLRA-RIMPHLRFVYDSSMSEGVRMSALVDQ-AV 115

Query: 123 PVA 125
              
Sbjct: 116 ASD 118


>gi|304310508|ref|YP_003810106.1| Ribosome-binding factor A [gamma proteobacterium HdN1]
 gi|301796241|emb|CBL44449.1| Ribosome-binding factor A [gamma proteobacterium HdN1]
          Length = 145

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 66/131 (50%), Gaps = 9/131 (6%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M++ +P+  +R  R+ ++++  L  V+L  E  D  +   ++++S V ++ DL  A VY+
Sbjct: 1   MRH-SPRGYKRTDRIADQIQRELA-VLLQREISDPRVG--MVTVSGVKVARDLSFADVYV 56

Query: 61  SLPLDVSPDRVISAL---NCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
           S       + V  AL        F+R  + ++++ LR +P LRF +D  + +   +++L+
Sbjct: 57  SFMTLEKAEEVKQALAVLEHASGFLRSMLAKNIK-LRVIPRLRFHFDQVIVTGPHISSLI 115

Query: 118 CLPKIPVALEK 128
               I     +
Sbjct: 116 -TKAIREDESR 125


>gi|282859948|ref|ZP_06269036.1| ribosome-binding factor A [Prevotella bivia JCVIHMP010]
 gi|282587351|gb|EFB92568.1| ribosome-binding factor A [Prevotella bivia JCVIHMP010]
          Length = 111

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +  +     R++   ++S++ V +S DL + T Y+S+      + 
Sbjct: 5   RQNRISRLLQKELASIFQSQT---RMLHGVLVSVTRVKVSPDLSICTAYLSIFPSDKAEE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           +++ +N N K IR  +G+   N LR +PELRF  D SL    +++ L+  
Sbjct: 62  LLNNINANDKTIRYELGQRTHNQLRIIPELRFFIDDSLDYLDRIDHLLKK 111


>gi|168207529|ref|ZP_02633534.1| ribosome-binding factor A [Clostridium perfringens E str. JGS1987]
 gi|170661132|gb|EDT13815.1| ribosome-binding factor A [Clostridium perfringens E str. JGS1987]
          Length = 116

 Score = 96.7 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 35/119 (29%), Positives = 63/119 (52%), Gaps = 5/119 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP--L 64
             + R  R+ EEVR  +  +I  N+ +D  +   ++S+++V ++ DLR A V++SL    
Sbjct: 1   MANFRGKRINEEVRKEVSDII-RNQIKDPRL-TAMVSVTQVEVTKDLRYAKVFVSLFAKN 58

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D   +  + AL  +  FIR  +G  ++ LR  PE+ F  DTS+ +   + +L+   K  
Sbjct: 59  DEEKEESLKALKSSAGFIRREVGNRVK-LRSTPEILFEEDTSIDNAMYIESLLNKIKEK 116


>gi|228473890|ref|ZP_04058632.1| ribosome-binding factor A [Capnocytophaga gingivalis ATCC 33624]
 gi|228274731|gb|EEK13565.1| ribosome-binding factor A [Capnocytophaga gingivalis ATCC 33624]
          Length = 130

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 59/116 (50%), Gaps = 2/116 (1%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  ++     Q+  ++  ++S+++V ++VDL +A VYIS+    
Sbjct: 1   METNRQKKIAGLLQQDLGDILGR-AVQNGGLTNLILSVTKVAITVDLTLAKVYISVFPSE 59

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
               ++ A+  N   I+  + + +R+ LR +P+L F  D SL+   ++   +   +
Sbjct: 60  QGKEILKAIQSNSFQIKHEVAQRVRHQLRKMPDLSFFLDDSLEYLSQIEHSLKGEE 115


>gi|257894719|ref|ZP_05674372.1| ribosome-binding factor A [Enterococcus faecium 1,231,408]
 gi|257831098|gb|EEV57705.1| ribosome-binding factor A [Enterococcus faecium 1,231,408]
          Length = 113

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 54/116 (46%), Gaps = 6/116 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
             + R  RVG+E+   +  ++   + +D  +    ++I++V ++ DL+ AT+Y S+  D 
Sbjct: 1   MANYRDRRVGQEILKEVNDIL-RKKVRDPRVEN--VTITDVKVTGDLQQATIYYSILSDL 57

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                +    LN     IR  +G +L   +  PEL F  D S+     ++ L+   
Sbjct: 58  ASDKKKAQDGLNKASGLIRRELGHNLSIYK-TPELFFELDESVVYGNHIDELLRDL 112


>gi|268592824|ref|ZP_06127045.1| ribosome-binding factor A [Providencia rettgeri DSM 1131]
 gi|291311609|gb|EFE52062.1| ribosome-binding factor A [Providencia rettgeri DSM 1131]
          Length = 136

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 40/131 (30%), Positives = 63/131 (48%), Gaps = 13/131 (9%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   RA RV +E++  +  +IL  E +D  I   + ++S V +S DL    V+++   
Sbjct: 1   MAKEFSRAQRVAQEMQKEIA-IILQREIKDPRIG--MATVSGVELSRDLAYGKVFVTFFN 57

Query: 65  DVSPDRV-------ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
             +           I ALN    FIR  IG+++R LR +PEL F YD SL    +++ L+
Sbjct: 58  IANDKSEEEMVADGIKALNEASGFIRSLIGKAMR-LRIIPELTFEYDNSLVDGMRMSNLV 116

Query: 118 CLPKIPVALEK 128
               +    EK
Sbjct: 117 SN--VIRDDEK 125


>gi|269837287|ref|YP_003319515.1| ribosome-binding factor A [Sphaerobacter thermophilus DSM 20745]
 gi|269786550|gb|ACZ38693.1| ribosome-binding factor A [Sphaerobacter thermophilus DSM 20745]
          Length = 135

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 31/115 (26%), Positives = 60/115 (52%), Gaps = 5/115 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-D 65
             SRR +++ + +R  +  ++   E +D  +   + SI+ V +S DLR A VY+S+   +
Sbjct: 1   MTSRRQVQLADFLRDEISEILQR-EMKDPRLG--LASITRVELSPDLRYAKVYVSVLGSE 57

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
              +  ++AL     F+R  +   +R +R+VPE+RFR D S++    +   +   
Sbjct: 58  EDREATMAALTGAAGFVRHLLKPRMR-VRHVPEIRFRLDRSMEHAEVIQRTLREL 111


>gi|313676696|ref|YP_004054692.1| ribosome-binding factor a [Marivirga tractuosa DSM 4126]
 gi|312943394|gb|ADR22584.1| ribosome-binding factor A [Marivirga tractuosa DSM 4126]
          Length = 130

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 26/115 (22%), Positives = 52/115 (45%), Gaps = 3/115 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R  +    ++  L  +            +  I+I++V +S DL  A +Y+SL L  +P 
Sbjct: 5   SRQKKYSSLLQKDLSEIFQKQMA--NAFGKAFITITDVEVSPDLSFAKIYLSLMLSDNPS 62

Query: 70  RVISALNCNIKFIRGRIGRSL-RNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
             +  +      IR  +G  + + +R VPE+ F  D +L+   +++ ++    IP
Sbjct: 63  ETLEMIRERKSEIRKHLGNRIGKQVRIVPEIAFFMDDTLERANRIDDILSKLDIP 117


>gi|295105172|emb|CBL02716.1| ribosome-binding factor A [Faecalibacterium prausnitzii SL3/3]
          Length = 130

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 23/115 (20%), Positives = 52/115 (45%), Gaps = 4/115 (3%)

Query: 14  RVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS-PDRVI 72
           R+ ++++  ++ +I     +D  +   +++++ + ++ DL VA VY+S+      P   I
Sbjct: 8   RLAQDMKREVIAIIGR--LKDPRLEGGLLTVTRLDVTPDLDVAKVYVSVMGRADGPKPAI 65

Query: 73  SALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
            ALN     +R  + + + ++R  P   F  D        +N L+    +    E
Sbjct: 66  EALNRAAGHVRTEVSKKM-HIRKAPRFIFVEDDGAAYAAHINELLRSLNVNGEEE 119


>gi|171463766|ref|YP_001797879.1| ribosome-binding factor A [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|238689065|sp|B1XV88|RBFA_POLNS RecName: Full=Ribosome-binding factor A
 gi|171193304|gb|ACB44265.1| ribosome-binding factor A [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 122

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 58/127 (45%), Gaps = 9/127 (7%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M   +P    R  R+ ++++  L  +I       R  S  +I++  + ++ DL  A V+ 
Sbjct: 1   MHKTSP---HRNQRLADQIQRDLAELIPRE---LRSSSLGLITLQSIELTPDLAHAKVFF 54

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           ++     P+  + AL     ++   + + L ++  VP L F YD+S++   +++ L+   
Sbjct: 55  TVLGA-EPEHALKALQEKAGYLYSLLFKRL-HIHTVPTLHFHYDSSVEHGIEMSKLIDQ- 111

Query: 121 KIPVALE 127
            +    +
Sbjct: 112 AVESDQK 118


>gi|331006258|ref|ZP_08329578.1| Ribosome-binding factor A [gamma proteobacterium IMCC1989]
 gi|330419947|gb|EGG94293.1| Ribosome-binding factor A [gamma proteobacterium IMCC1989]
          Length = 130

 Score = 96.7 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 58/125 (46%), Gaps = 8/125 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R+ RV + ++  L   I   E +D  +   ++++++V ++ D+  A VY++   
Sbjct: 1   MAKEFSRSDRVADAIQRILATTI-RQEVRDPRVG--MVNVNDVTVTRDMAYAKVYVTFVG 57

Query: 65  DV---SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                       ALN    F+RG + + L ++R  P+LRF YD +     KL+ L+    
Sbjct: 58  RDSDTESREAADALNHAAGFLRGIVAKEL-DIRITPKLRFIYDKTSVEGQKLSNLI-DKA 115

Query: 122 IPVAL 126
           I   +
Sbjct: 116 IAEDV 120


>gi|170696664|ref|ZP_02887782.1| ribosome-binding factor A [Burkholderia graminis C4D1M]
 gi|170138446|gb|EDT06656.1| ribosome-binding factor A [Burkholderia graminis C4D1M]
          Length = 121

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 58/127 (45%), Gaps = 7/127 (5%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  ++   E +D  I   +++I  V ++ D   A VY 
Sbjct: 1   MPKKRSSP-NRNVQIADQIQRDLSELLR--EVKDPRIG--IVTIQSVELTPDYAHAKVYF 55

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +      P + ++AL      +  ++ + L ++  VP L F YD +++   +++ L+   
Sbjct: 56  TTL-TGDPQQTLAALTHAAGHLHNQLFKRL-HIHTVPTLHFHYDKTIERAVEMSRLIDEA 113

Query: 121 KIPVALE 127
               A E
Sbjct: 114 NASRAKE 120


>gi|167758069|ref|ZP_02430196.1| hypothetical protein CLOSCI_00407 [Clostridium scindens ATCC 35704]
 gi|167663966|gb|EDS08096.1| hypothetical protein CLOSCI_00407 [Clostridium scindens ATCC 35704]
          Length = 127

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 4/116 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K S +  RV  EV+  L  +I     +D  +     S+    ++ DL+    YIS+  
Sbjct: 1   MRKRSIKNTRVSTEVQRELSNII-RGGIKDPRV-APWTSVVTAEVAPDLKTCKAYISVLG 58

Query: 65  D-VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           D    +  I  L     +IR  + R+L NLR  PE+RF  D S++    ++  +  
Sbjct: 59  DAHEQEETIKGLQSAEGYIRRELARTL-NLRNTPEIRFVLDQSIEYGVNMSKKIDE 113


>gi|221197758|ref|ZP_03570804.1| ribosome-binding factor A [Burkholderia multivorans CGD2M]
 gi|221204684|ref|ZP_03577701.1| ribosome-binding factor A [Burkholderia multivorans CGD2]
 gi|221175541|gb|EEE07971.1| ribosome-binding factor A [Burkholderia multivorans CGD2]
 gi|221181690|gb|EEE14091.1| ribosome-binding factor A [Burkholderia multivorans CGD2M]
          Length = 161

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  +I+  E +D  I   +++I  V ++ D   A +Y 
Sbjct: 30  MSRKRTSP-NRNVQIADQIQRDLSELIMR-EVKDPRIG--IVTIQSVELTPDYAHAKIYF 85

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +      P     ALN     +   + + L ++  VP L F YD +++    ++ L+   
Sbjct: 86  TTL-TGDPAATQQALNHASGHLHNLLFKRL-HIHTVPTLHFHYDQTIEKAVAMSRLIDEA 143

Query: 121 KIPVALE 127
               A +
Sbjct: 144 NATRAKD 150


>gi|217423463|ref|ZP_03454964.1| ribosome-binding factor A [Burkholderia pseudomallei 576]
 gi|217393321|gb|EEC33342.1| ribosome-binding factor A [Burkholderia pseudomallei 576]
          Length = 138

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  +I+  E +D  I   +++I  V ++ D   A VY 
Sbjct: 17  MSKKRSSP-NRNVQIADQIQRDLSELIMR-EAKDPRIG--IVTIQSVELTPDYAHAKVYF 72

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +       D    ALN     +   + + L ++  VP L F YD +++    ++ L+   
Sbjct: 73  TALTGTPAD-TQEALNHAAGHLHNLLFKRL-HIHTVPTLHFHYDQAIEKAVAMSRLIDEA 130

Query: 121 KIPVALE 127
               A +
Sbjct: 131 NATRAKD 137


>gi|170017450|ref|YP_001728369.1| ribosome-binding factor A [Leuconostoc citreum KM20]
 gi|238688972|sp|B1MZH3|RBFA_LEUCK RecName: Full=Ribosome-binding factor A
 gi|169804307|gb|ACA82925.1| Ribosome-binding factor A [Leuconostoc citreum KM20]
          Length = 117

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 6/113 (5%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD--VS 67
           +RA R+ +EV+  +  ++L     D  +    ++++ V +S DL++AT+Y S+  D    
Sbjct: 5   QRAGRLAQEVQRDVTDLLLKR-INDPRVQD--VTVTSVELSGDLQIATIYYSILSDLASD 61

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  + L      IR  +G  L   +  PEL+F  D S+Q    +  L+   
Sbjct: 62  GQKAQAGLEAASGLIRKELGARLTVYK-TPELKFVRDQSVQYGNHIEDLIRKL 113


>gi|146319499|ref|YP_001199211.1| ribosome-binding factor A [Streptococcus suis 05ZYH33]
 gi|146321694|ref|YP_001201405.1| ribosome-binding factor A [Streptococcus suis 98HAH33]
 gi|145690305|gb|ABP90811.1| Ribosome-binding factor A [Streptococcus suis 05ZYH33]
 gi|145692500|gb|ABP93005.1| Ribosome-binding factor A [Streptococcus suis 98HAH33]
 gi|292559117|gb|ADE32118.1| ribosome-binding factor A [Streptococcus suis GZ1]
          Length = 136

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 57/119 (47%), Gaps = 6/119 (5%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K KN  N  R  RVG E++  +  ++   + +D  +    ++I++V M  DL  A VY +
Sbjct: 16  KGKNMANHFRTDRVGMEIKREVNEILQK-KVRDPRVQG--VTITDVQMVGDLSTAKVYYT 72

Query: 62  LPLD--VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           +  +      +  + L      I+  +GR L  L  +P+L F  D S++   K++ ++ 
Sbjct: 73  IMSNLASDNQKAQTGLEKATGTIKRELGRKL-TLYKIPDLVFEKDQSIEYGNKIDQMLR 130


>gi|158523043|ref|YP_001530913.1| ribosome-binding factor A [Desulfococcus oleovorans Hxd3]
 gi|238686917|sp|A8ZZ63|RBFA_DESOH RecName: Full=Ribosome-binding factor A
 gi|158511869|gb|ABW68836.1| ribosome-binding factor A [Desulfococcus oleovorans Hxd3]
          Length = 129

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 55/120 (45%), Gaps = 5/120 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
           K+  RA R+G  ++  +  ++      D  +   + +I+ V +S DL VA VY  +P D 
Sbjct: 2   KSFPRADRIGSSIQRGVSEILRKG-LGDPRLD--MATITGVKVSRDLGVAYVYYVIPGDT 58

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
                  +       FI+  +   L+ ++Y+P++RFRYD S      ++ ++   +    
Sbjct: 59  AGRAAAAAGFKSAEGFIKRSLAGMLK-MKYMPDIRFRYDESFAYGQSIDTVLRELQTEKD 117


>gi|184156671|ref|YP_001845010.1| ribosome-binding factor A [Acinetobacter baumannii ACICU]
 gi|332873079|ref|ZP_08441036.1| ribosome-binding factor A [Acinetobacter baumannii 6014059]
 gi|238691022|sp|B2I2M8|RBFA_ACIBC RecName: Full=Ribosome-binding factor A
 gi|183208265|gb|ACC55663.1| Ribosome-binding factor A [Acinetobacter baumannii ACICU]
 gi|322506558|gb|ADX02012.1| rbfA [Acinetobacter baumannii 1656-2]
 gi|323516437|gb|ADX90818.1| ribosome-binding factor A [Acinetobacter baumannii TCDC-AB0715]
 gi|332738591|gb|EGJ69461.1| ribosome-binding factor A [Acinetobacter baumannii 6014059]
          Length = 133

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 55/127 (43%), Gaps = 13/127 (10%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV--- 66
           +R  R+ + V+  L   ++  E +D  +   +++IS V +S DL  A VY+++       
Sbjct: 5   QRLKRMADSVQRELSE-LIRQELKDPRLGG-LVTISGVKVSPDLGYADVYVTVMGRELSD 62

Query: 67  -----SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                +    +  LN    F+R  + R ++  R  P LRF YD +      +  L+   K
Sbjct: 63  DQNEVAHRETLDILNKASGFLRQELSRRIKT-RITPRLRFHYDKTNAYGNYMFGLI--EK 119

Query: 122 IPVALEK 128
               L K
Sbjct: 120 AVQDLPK 126


>gi|293610136|ref|ZP_06692437.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827368|gb|EFF85732.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325124309|gb|ADY83832.1| ribosome-binding factor A [Acinetobacter calcoaceticus PHEA-2]
          Length = 133

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 56/128 (43%), Gaps = 13/128 (10%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-- 66
           S+R  R+ + V+  L   ++  E +D  +   +++IS V +S D+  A VY+++      
Sbjct: 4   SQRLKRMADSVQRELSE-LIRQELKDPRLGG-LVTISAVKVSADMGYAEVYVTVMGRELG 61

Query: 67  ------SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                 +    +  LN    F+R  + R ++  R  P LRF YD +      +  L+   
Sbjct: 62  DEQSEAANKETLDVLNKASGFLRHELSRRIKT-RITPRLRFHYDKTNAYGNYMFGLI--E 118

Query: 121 KIPVALEK 128
           K    L +
Sbjct: 119 KAVQDLPE 126


>gi|24372788|ref|NP_716830.1| ribosome-binding factor A [Shewanella oneidensis MR-1]
 gi|29427753|sp|Q8EHL4|RBFA_SHEON RecName: Full=Ribosome-binding factor A
 gi|24346873|gb|AAN54275.1|AE015564_6 ribosome-binding factor A [Shewanella oneidensis MR-1]
          Length = 147

 Score = 96.7 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 61/126 (48%), Gaps = 10/126 (7%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K   R  R+G++++  L  V+   + +D  I    +++++V +S DL  A V+++   
Sbjct: 1   MAKEFSRTRRIGQQLQQELAVVLQR-DMKDPRIG--FVTVNDVDVSRDLSYAKVFVTFFE 57

Query: 65  DVSP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL----MC 118
           +        ++AL     +IR  +   ++ LR +PE+RF YD+SL    +++ L    + 
Sbjct: 58  EDKDVVQEKLNALIAAAPYIRTLVAGRMK-LRVMPEIRFVYDSSLVEGMRMSNLVSQVIN 116

Query: 119 LPKIPV 124
             K   
Sbjct: 117 SDKAKQ 122


>gi|319762635|ref|YP_004126572.1| ribosome-binding factor a [Alicycliphilus denitrificans BC]
 gi|330824725|ref|YP_004388028.1| ribosome-binding factor A [Alicycliphilus denitrificans K601]
 gi|317117196|gb|ADU99684.1| ribosome-binding factor A [Alicycliphilus denitrificans BC]
 gi|329310097|gb|AEB84512.1| ribosome-binding factor A [Alicycliphilus denitrificans K601]
          Length = 126

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 52/124 (41%), Gaps = 6/124 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R  +V ++++  L  +I   + +D  I   + ++  V ++ D   A V+ 
Sbjct: 1   MAAKKSSTPNRGFKVADQIQRDLAELIR--DLKDPRIG--MCTLQAVEVTPDYAHAKVFF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           S+           ALN    F+R  + + L ++  VP L F +D + +    +NAL+   
Sbjct: 57  SVL-VGDGQATQEALNQAAGFLRNGLFKRL-SIHTVPTLHFVFDRTTERASDMNALIARA 114

Query: 121 KIPV 124
               
Sbjct: 115 VASR 118


>gi|258591352|emb|CBE67651.1| Ribosome-binding factor A [NC10 bacterium 'Dutch sediment']
          Length = 119

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/120 (30%), Positives = 55/120 (45%), Gaps = 6/120 (5%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP- 68
           RRA RVG  ++  +  +IL    +D  +     +++ V +S DL+ A VYI+        
Sbjct: 4   RRADRVGTLIQEEISRLILQ-SVKDPRVRCA--TVTRVRVSDDLQHAKVYIASMGGDKER 60

Query: 69  -DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
               +  L     F+RG +GR L  LRY+PEL F  D SL+    L  L    +     E
Sbjct: 61  CQEALIGLKSAAGFLRGELGRRL-CLRYIPELLFSLDDSLEQELHLAELFRQIEATETRE 119


>gi|239997160|ref|ZP_04717684.1| ribosome-binding factor A [Alteromonas macleodii ATCC 27126]
          Length = 133

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 61/129 (47%), Gaps = 8/129 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV ++V   +  ++  NE++ R+    +I++S+V +S DL  A +++++  
Sbjct: 1   MAREFSRTDRVAQQVHKEVASIL-QNEYKHRVGDMPLITVSDVDVSRDLAHAKIFVTIYN 59

Query: 65  DVSPD--RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL----MC 118
               +    I  L    KFIR  + + +R +R VP+L F  D S+    +++ L    + 
Sbjct: 60  STEEEGKAQIKQLAEYKKFIRSILAKRIR-MRSVPDLHFFEDKSIVEGMRISNLVSQTIA 118

Query: 119 LPKIPVALE 127
             +     +
Sbjct: 119 KDESKRDKD 127


>gi|237748743|ref|ZP_04579223.1| ribosome-binding factor A [Oxalobacter formigenes OXCC13]
 gi|229380105|gb|EEO30196.1| ribosome-binding factor A [Oxalobacter formigenes OXCC13]
          Length = 129

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/132 (21%), Positives = 63/132 (47%), Gaps = 9/132 (6%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M   +     R++RV ++++  L  +I  +E +D  +   +I+I++V ++ D   A V+ 
Sbjct: 1   MARHSKSIPGRSVRVADQIQRDLSDIIF-SELKDPHVG--MITITDVKVTPDYAHAKVFF 57

Query: 61  SLPL--DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM- 117
           ++           + +L+    F+R ++G+ L ++  +P+L F YD S+     L+ L+ 
Sbjct: 58  TMLDDSPDKVKTTLDSLHRASGFLRMQLGKRL-HIHTLPQLSFVYDNSIAQGMALSHLID 116

Query: 118 --CLPKIPVALE 127
                +     E
Sbjct: 117 VANSERAKDDGE 128


>gi|161723141|ref|YP_443080.2| ribosome-binding factor A [Burkholderia thailandensis E264]
 gi|167582085|ref|ZP_02374959.1| ribosome-binding factor A [Burkholderia thailandensis TXDOH]
 gi|167620246|ref|ZP_02388877.1| ribosome-binding factor A [Burkholderia thailandensis Bt4]
 gi|257139310|ref|ZP_05587572.1| ribosome-binding factor A [Burkholderia thailandensis E264]
 gi|172046091|sp|Q2SVG9|RBFA_BURTA RecName: Full=Ribosome-binding factor A
          Length = 122

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  +I+  E +D  I   +++I  V ++ D   A VY 
Sbjct: 1   MSKKRSSP-NRNVQIADQIQRDLSELIMR-EVKDPRIG--IVTIQSVELTPDYAHAKVYF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +     +P     ALN     +   + + L ++  VP L F YD +++    ++ L+   
Sbjct: 57  TAL-TGNPADTQEALNHAAGHLHNLLFKRL-HIHTVPTLHFHYDQTIEKAVAMSRLIDEA 114

Query: 121 KIPVALE 127
               A +
Sbjct: 115 NATRAKD 121


>gi|167562937|ref|ZP_02355853.1| ribosome-binding factor A [Burkholderia oklahomensis EO147]
 gi|167570127|ref|ZP_02363001.1| ribosome-binding factor A [Burkholderia oklahomensis C6786]
          Length = 122

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  +I+  E +D  I   +++I  V ++ D   A VY 
Sbjct: 1   MSKKRSSP-NRNVQIADQIQRDLSELIMR-EVKDPRIG--IVTIQSVELTPDYAHAKVYF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +     +P     ALN     +   + + L ++  VP L F YD +++    ++ L+   
Sbjct: 57  TAL-TGNPADTQDALNHAAGHLHNLLFKRL-HIHTVPTLHFHYDQTIEKAVAMSRLIDEA 114

Query: 121 KIPVALE 127
               A +
Sbjct: 115 NATRAKD 121


>gi|89889706|ref|ZP_01201217.1| ribosome-binding factor A [Flavobacteria bacterium BBFL7]
 gi|89517979|gb|EAS20635.1| ribosome-binding factor A [Flavobacteria bacterium BBFL7]
          Length = 131

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 23/112 (20%), Positives = 54/112 (48%), Gaps = 2/112 (1%)

Query: 8   NSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS 67
            S R  ++   ++  +  VI  +  +   +   ++S+++V ++ DL  A  Y+S+     
Sbjct: 3   ESNRQKKISGILQEDISSVI-QDYLRKNTVKNLLVSVTKVTVTPDLGYAKAYLSVFPADK 61

Query: 68  PDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
              V+  +      +R ++   +R+ LR +PEL+F  D SL+   +++  + 
Sbjct: 62  AAAVVQEIVEIGPELRHQVAAKVRHQLRRMPELQFFNDDSLEYMDQIDKELK 113


>gi|313892629|ref|ZP_07826216.1| ribosome-binding factor A [Dialister microaerophilus UPII 345-E]
 gi|329121251|ref|ZP_08249878.1| ribosome-binding factor A [Dialister micraerophilus DSM 19965]
 gi|313119026|gb|EFR42231.1| ribosome-binding factor A [Dialister microaerophilus UPII 345-E]
 gi|327470185|gb|EGF15648.1| ribosome-binding factor A [Dialister micraerophilus DSM 19965]
          Length = 117

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 36/119 (30%), Positives = 63/119 (52%), Gaps = 7/119 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPD 69
           R  ++ E ++  +  ++LN   +D  +     ++++V ++ DLR ATVY+SL   +    
Sbjct: 5   RVRKIQEFIKQEVGKLLLNG-IKDPRLG--FTTVTDVKVTGDLREATVYVSLFGSEKEKK 61

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
             ++ LN    FIR  +G+SL N+ Y PE+ F  D SL+   K+  L+   KI    +K
Sbjct: 62  DSLNVLNKAKGFIRKEVGKSL-NIFYSPEISFEEDKSLEYGMKIEKLLN--KIHEDDKK 117


>gi|260550523|ref|ZP_05824733.1| ribosome-binding factor A [Acinetobacter sp. RUH2624]
 gi|260406438|gb|EEW99920.1| ribosome-binding factor A [Acinetobacter sp. RUH2624]
          Length = 133

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 57/133 (42%), Gaps = 16/133 (12%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV-- 66
           S+R  R+ + V+  L   ++  E +D  +   +++IS V +S D+  A VY+++      
Sbjct: 4   SQRLKRMADSVQRELSD-LIRQELKDPRLGG-LVTISAVKVSADMGYAEVYVTVMGRELG 61

Query: 67  ------SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL- 119
                 +    +  LN    F+R  + R ++  R  P LRF YD +      +  L+   
Sbjct: 62  DEQSEAANKETLDVLNKASGFLRHELSRRIKT-RITPRLRFHYDKTNAYGNYMFGLIEKA 120

Query: 120 ----PKIPVALEK 128
               P+     E+
Sbjct: 121 VQDLPERKSDDEE 133


>gi|18310667|ref|NP_562601.1| ribosome-binding factor A [Clostridium perfringens str. 13]
 gi|110800717|ref|YP_696372.1| ribosome-binding factor A [Clostridium perfringens ATCC 13124]
 gi|110802728|ref|YP_698972.1| ribosome-binding factor A [Clostridium perfringens SM101]
 gi|168211427|ref|ZP_02637052.1| ribosome-binding factor A [Clostridium perfringens B str. ATCC
           3626]
 gi|168214482|ref|ZP_02640107.1| ribosome-binding factor A [Clostridium perfringens CPE str. F4969]
 gi|168216972|ref|ZP_02642597.1| ribosome-binding factor A [Clostridium perfringens NCTC 8239]
 gi|169342675|ref|ZP_02863716.1| ribosome-binding factor A [Clostridium perfringens C str. JGS1495]
 gi|182626365|ref|ZP_02954119.1| ribosome-binding factor A [Clostridium perfringens D str. JGS1721]
 gi|20978576|sp|Q8XJR9|RBFA_CLOPE RecName: Full=Ribosome-binding factor A
 gi|123049758|sp|Q0TPR8|RBFA_CLOP1 RecName: Full=Ribosome-binding factor A
 gi|123146056|sp|Q0SSD5|RBFA_CLOPS RecName: Full=Ribosome-binding factor A
 gi|18145348|dbj|BAB81391.1| ribosome-binding factor A [Clostridium perfringens str. 13]
 gi|110675364|gb|ABG84351.1| ribosome-binding factor A [Clostridium perfringens ATCC 13124]
 gi|110683229|gb|ABG86599.1| ribosome-binding factor A [Clostridium perfringens SM101]
 gi|169299181|gb|EDS81251.1| ribosome-binding factor A [Clostridium perfringens C str. JGS1495]
 gi|170710576|gb|EDT22758.1| ribosome-binding factor A [Clostridium perfringens B str. ATCC
           3626]
 gi|170714032|gb|EDT26214.1| ribosome-binding factor A [Clostridium perfringens CPE str. F4969]
 gi|177908316|gb|EDT70864.1| ribosome-binding factor A [Clostridium perfringens D str. JGS1721]
 gi|182380987|gb|EDT78466.1| ribosome-binding factor A [Clostridium perfringens NCTC 8239]
          Length = 116

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 34/119 (28%), Positives = 62/119 (52%), Gaps = 5/119 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP--L 64
             + R  R+ EEVR  +  +I  N+ +D  +   ++S+++V ++ DLR A V++SL    
Sbjct: 1   MANFRGKRINEEVRKEVSDII-RNQIKDPRL-TAMVSVTQVEVTKDLRYAKVFVSLFAKN 58

Query: 65  DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D   +  + AL  +  FIR  +G  ++ LR  PE+ F  D S+ +   + +L+   K  
Sbjct: 59  DEEKEESLKALKSSAGFIRREVGNRVK-LRSTPEILFEEDNSIDNAMYIESLLNKIKEK 116


>gi|148543932|ref|YP_001271302.1| ribosome-binding factor A [Lactobacillus reuteri DSM 20016]
 gi|184153328|ref|YP_001841669.1| ribosome-binding factor A [Lactobacillus reuteri JCM 1112]
 gi|194467749|ref|ZP_03073735.1| ribosome-binding factor A [Lactobacillus reuteri 100-23]
 gi|227364841|ref|ZP_03848888.1| ribosome-binding factor A [Lactobacillus reuteri MM2-3]
 gi|325682533|ref|ZP_08162050.1| ribosome-binding factor A [Lactobacillus reuteri MM4-1A]
 gi|172048236|sp|A5VJE1|RBFA_LACRD RecName: Full=Ribosome-binding factor A
 gi|229568640|sp|B2G6V7|RBFA_LACRJ RecName: Full=Ribosome-binding factor A
 gi|148530966|gb|ABQ82965.1| ribosome-binding factor A [Lactobacillus reuteri DSM 20016]
 gi|183224672|dbj|BAG25189.1| ribosome-binding factor A [Lactobacillus reuteri JCM 1112]
 gi|194452602|gb|EDX41500.1| ribosome-binding factor A [Lactobacillus reuteri 100-23]
 gi|227070104|gb|EEI08480.1| ribosome-binding factor A [Lactobacillus reuteri MM2-3]
 gi|324978372|gb|EGC15322.1| ribosome-binding factor A [Lactobacillus reuteri MM4-1A]
          Length = 119

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 56/122 (45%), Gaps = 6/122 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            P    R  R+ +E++  +  ++L    +D  +    ++I+ V ++ DL+ AT+Y S+  
Sbjct: 1   MPSKQYRVDRLAQEIQKDVDEILLKR-VRDPRVQN--VTITGVDVTGDLQQATIYYSILS 57

Query: 65  D--VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
           D     ++  + L+     IR  +G  L   +  PE++F  D S+    +++ L+     
Sbjct: 58  DLASDAEKAQAGLDKATGLIRSELGARLNIFK-TPEIKFVRDPSVAYGSRIDQLINDLHK 116

Query: 123 PV 124
             
Sbjct: 117 KE 118


>gi|325479406|gb|EGC82502.1| ribosome-binding factor A [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 128

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/128 (27%), Positives = 65/128 (50%), Gaps = 9/128 (7%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLIS-RDVISISEVCMSVDLRVATVYISLPLD 65
            N RR  R+  EV+  L  ++  ++  D  +S   ++SI++V ++ DL  A  Y+S+  D
Sbjct: 1   MNKRRTERISSEVKKELSKIL-RDDLNDPRLSMEAMVSITDVEVTNDLSYADCYVSVLGD 59

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM-----CL 119
             + + V+ AL+    +I+  IG  +R LR +PE RF+ D S++    ++ L+       
Sbjct: 60  SHNKEDVLEALDQAKGYIKILIGERMR-LRSMPEFRFKLDESIERGAYMDKLIEETIAKD 118

Query: 120 PKIPVALE 127
            K     +
Sbjct: 119 KKANEDRK 126


>gi|288928933|ref|ZP_06422779.1| ribosome-binding factor A [Prevotella sp. oral taxon 317 str.
           F0108]
 gi|288329917|gb|EFC68502.1| ribosome-binding factor A [Prevotella sp. oral taxon 317 str.
           F0108]
          Length = 111

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/110 (25%), Positives = 54/110 (49%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +  +     R++   ++S++   +S DL + T Y+S+      + 
Sbjct: 5   RQNRIARLLQKELSLIFQSQT---RMMHGVMVSVTRTRVSPDLSICTAYLSVFPSEKGEE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +  N K IR  +G  + N LR +PELRF  D SL    +++ L+  
Sbjct: 62  LLKNIESNTKTIRYELGTRVHNQLRIIPELRFFIDDSLDYIERIDELLKK 111


>gi|227872006|ref|ZP_03990391.1| ribosome-binding factor A [Oribacterium sinus F0268]
 gi|227842149|gb|EEJ52394.1| ribosome-binding factor A [Oribacterium sinus F0268]
          Length = 138

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 5/125 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K S +  R  E+VR  L  +++  E +D  +      ++ V ++ DL+   V++S   
Sbjct: 1   MKKLSFKNQRRNEDVRRCLS-LLIREEVKDSRV-SPFCDVTGVDLTPDLQYCKVFVSCLG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                 + I  L     F+R  +  SL NLR+ PEL+F  D S++   +++AL+      
Sbjct: 59  SEEELGKTIEGLKAAGGFLRRELAGSL-NLRHTPELQFIADHSVEYGSRMDALISQVS-K 116

Query: 124 VALEK 128
              E+
Sbjct: 117 EDKER 121


>gi|291287259|ref|YP_003504075.1| ribosome-binding factor A [Denitrovibrio acetiphilus DSM 12809]
 gi|290884419|gb|ADD68119.1| ribosome-binding factor A [Denitrovibrio acetiphilus DSM 12809]
          Length = 110

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 58/110 (52%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  RVGE +RS +M VI+  E  D  I   V++  ++ ++ DL +A VY S     + + 
Sbjct: 2   RDRRVGELLRSEIMDVIIK-EVNDPKIKDVVLT--KIDVTKDLSIAKVYFSTYNKSAKEG 58

Query: 71  VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +   LN +  FIR  I + LR L+ VP LRF YD S     K++ L+   
Sbjct: 59  IERGLNRSAGFIRHCILKGLR-LKKVPTLRFIYDDSGDYGQKIDGLLKDI 107


>gi|33239584|ref|NP_874526.1| ribosome-binding factor A [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
 gi|39931797|sp|Q7VE81|RBFA_PROMA RecName: Full=Ribosome-binding factor A
 gi|33237109|gb|AAP99178.1| Ribosome-binding factor A [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
          Length = 130

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/122 (24%), Positives = 63/122 (51%), Gaps = 3/122 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             SRR  +V   +R  +  ++ N   +D+ ++  +I+I+EV +S DL+   +++S+  + 
Sbjct: 2   AQSRRVEKVAALIRKEMSELLSNG-IRDQRVNTTMITITEVEVSGDLQHCKIFVSIYGNE 60

Query: 67  -SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              D V S L  +  F++G +GR L  +R  PE+ F+ D  ++    +  L+   +    
Sbjct: 61  IQKDEVFSGLEASQSFLKGELGRRL-QMRRAPEVVFKLDRGMEKGISVLNLLEKLEAERN 119

Query: 126 LE 127
           ++
Sbjct: 120 IK 121


>gi|256544699|ref|ZP_05472071.1| ribosome-binding factor A [Anaerococcus vaginalis ATCC 51170]
 gi|256399588|gb|EEU13193.1| ribosome-binding factor A [Anaerococcus vaginalis ATCC 51170]
          Length = 127

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP- 68
           RR L++  +++  L  ++  +    RL    ++SI+EV ++ DL  A +++S+  D +  
Sbjct: 4   RRTLKISSQMQKELSKILAEDINDPRLSDNVIVSITEVEVTNDLSYADIFVSVLGDENKK 63

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           + VI AL+    +++  IG  +R LR +PE RF+YD S++    ++ L+    I    +
Sbjct: 64  ESVIEALDQAKGYMKKLIGERMR-LRSMPEFRFKYDNSIEHGVYMDKLIAET-IKRDEK 120


>gi|53719531|ref|YP_108517.1| ribosome-binding factor A [Burkholderia pseudomallei K96243]
 gi|53724826|ref|YP_102759.1| ribosome-binding factor A [Burkholderia mallei ATCC 23344]
 gi|162210047|ref|YP_333315.2| ribosome-binding factor A [Burkholderia pseudomallei 1710b]
 gi|167719816|ref|ZP_02403052.1| ribosome-binding factor A [Burkholderia pseudomallei DM98]
 gi|167738817|ref|ZP_02411591.1| ribosome-binding factor A [Burkholderia pseudomallei 14]
 gi|167816039|ref|ZP_02447719.1| ribosome-binding factor A [Burkholderia pseudomallei 91]
 gi|167845946|ref|ZP_02471454.1| ribosome-binding factor A [Burkholderia pseudomallei B7210]
 gi|167894523|ref|ZP_02481925.1| ribosome-binding factor A [Burkholderia pseudomallei 7894]
 gi|167902928|ref|ZP_02490133.1| ribosome-binding factor A [Burkholderia pseudomallei NCTC 13177]
 gi|167919188|ref|ZP_02506279.1| ribosome-binding factor A [Burkholderia pseudomallei BCC215]
 gi|254199708|ref|ZP_04906074.1| ribosome-binding factor A [Burkholderia mallei FMH]
 gi|254358403|ref|ZP_04974676.1| ribosome-binding factor A [Burkholderia mallei 2002721280]
 gi|61214833|sp|Q62KL0|RBFA_BURMA RecName: Full=Ribosome-binding factor A
 gi|61214850|sp|Q63TP9|RBFA_BURPS RecName: Full=Ribosome-binding factor A
 gi|171769479|sp|A1V3N3|RBFA_BURMS RecName: Full=Ribosome-binding factor A
 gi|171769872|sp|A2S2L0|RBFA_BURM9 RecName: Full=Ribosome-binding factor A
 gi|171855124|sp|A3NUL1|RBFA_BURP0 RecName: Full=Ribosome-binding factor A
 gi|171855126|sp|A3N8V9|RBFA_BURP6 RecName: Full=Ribosome-binding factor A
 gi|171855141|sp|A3MJW5|RBFA_BURM7 RecName: Full=Ribosome-binding factor A
 gi|172046646|sp|Q3JSY8|RBFA_BURP1 RecName: Full=Ribosome-binding factor A
 gi|52209945|emb|CAH35917.1| putative ribosome-binding factor [Burkholderia pseudomallei K96243]
 gi|52428249|gb|AAU48842.1| ribosome-binding factor A [Burkholderia mallei ATCC 23344]
 gi|147749304|gb|EDK56378.1| ribosome-binding factor A [Burkholderia mallei FMH]
 gi|148027530|gb|EDK85551.1| ribosome-binding factor A [Burkholderia mallei 2002721280]
          Length = 122

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  +I+  E +D  I   +++I  V ++ D   A VY 
Sbjct: 1   MSKKRSSP-NRNVQIADQIQRDLSELIMR-EVKDPRIG--IVTIQSVELTPDYAHAKVYF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +       D    ALN     +   + + L ++  VP L F YD +++    ++ L+   
Sbjct: 57  TALTGTPAD-TQEALNHAAGHLHNLLFKRL-HIHTVPTLHFHYDQTIEKAVAMSRLIDEA 114

Query: 121 KIPVALE 127
               A +
Sbjct: 115 NATRAKD 121


>gi|15675570|ref|NP_269744.1| ribosome-binding factor A [Streptococcus pyogenes M1 GAS]
 gi|28895285|ref|NP_801635.1| ribosome-binding factor A [Streptococcus pyogenes SSI-1]
 gi|161936121|ref|YP_282771.2| ribosome-binding factor A [Streptococcus pyogenes MGAS5005]
 gi|13622774|gb|AAK34465.1| putative ribosome binding factor A [Streptococcus pyogenes M1 GAS]
 gi|28810531|dbj|BAC63468.1| putative ribosome binding factor A [Streptococcus pyogenes SSI-1]
          Length = 118

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 54/119 (45%), Gaps = 6/119 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
               + R  RVG E++  +  ++   + +D  +    ++I+EV M  DL +A VY ++  
Sbjct: 1   MAMANHRIDRVGMEIKREVNDILQK-KVRDPRVQG--VTITEVQMQGDLSLAKVYYTIMS 57

Query: 65  D--VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D      +  + L      I+  +G+ L  +  +P+L F  D S+    K++ L+    
Sbjct: 58  DLASDNQKAQTGLEKATGTIKRELGKQL-TMYKIPDLVFEKDNSIAYGNKIDQLLRDLD 115


>gi|288800321|ref|ZP_06405779.1| ribosome-binding factor A [Prevotella sp. oral taxon 299 str.
           F0039]
 gi|288332534|gb|EFC71014.1| ribosome-binding factor A [Prevotella sp. oral taxon 299 str.
           F0039]
          Length = 111

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  +V    +  L  +  N     R +   ++S++   +S DL V T Y+S+      D 
Sbjct: 5   RQNKVARLFQKELSLIFQNQT---RAMMGMMVSVTRCKVSPDLGVCTAYLSVFPSEKGDE 61

Query: 71  VISALNCNIKFIRGRIGRSL-RNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +  N K IR  +G+ + + +R VPELRF  D SL    +++ L+  
Sbjct: 62  ILENIRANYKSIRFELGKKIGKQVRIVPELRFFIDDSLDYLERIDELLAK 111


>gi|169350442|ref|ZP_02867380.1| hypothetical protein CLOSPI_01210 [Clostridium spiroforme DSM 1552]
 gi|169292762|gb|EDS74895.1| hypothetical protein CLOSPI_01210 [Clostridium spiroforme DSM 1552]
          Length = 114

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 5/109 (4%)

Query: 13  LRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL-DVSPDRV 71
            +V   ++  L  ++   E +D  I     +I+ V ++ DL +A +Y++    D    + 
Sbjct: 6   EKVSGIIQRELSQIL-QMEVRDPKIG--FCTITAVDLTNDLSIAKIYVTFLGKDFDTRKG 62

Query: 72  ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           + AL  +  FIR  + + L  +R VPEL F  DTSLQ   K+  ++   
Sbjct: 63  MQALERSKGFIRSLLAKRL-TIRKVPELHFVNDTSLQYGNKIEKIIDDL 110


>gi|91792368|ref|YP_562019.1| ribosome-binding factor A [Shewanella denitrificans OS217]
 gi|123061155|sp|Q12QI0|RBFA_SHEDO RecName: Full=Ribosome-binding factor A
 gi|91714370|gb|ABE54296.1| ribosome-binding factor A [Shewanella denitrificans OS217]
          Length = 142

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 60/117 (51%), Gaps = 6/117 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             K   R  R+ ++++  L  ++   + +D  I    +++++V +S DL  A V+++   
Sbjct: 1   MAKEFSRTRRIAQQLQQELAVILQR-DMKDPRIG--FVTVNDVDVSRDLSYAKVFVTFYE 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                 ++ I+AL     ++R  +   ++ LR +PELRF YD+SL    +++ L+  
Sbjct: 58  EDLTLVEQKIAALTAAAPYVRTLVAGRMK-LRVMPELRFIYDSSLVEGMRMSNLVSQ 113


>gi|88860549|ref|ZP_01135187.1| ribosome-binding factor A, role in processing of 16S rRNA
           [Pseudoalteromonas tunicata D2]
 gi|88817747|gb|EAR27564.1| ribosome-binding factor A, role in processing of 16S rRNA
           [Pseudoalteromonas tunicata D2]
          Length = 132

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 59/125 (47%), Gaps = 11/125 (8%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           ++  R  RVG++++  +  ++   E +D  +   + ++S V +S DL  A +++++    
Sbjct: 2   RDFSRTDRVGQQIQKEIAVILQR-EIKDPRLG--MATVSAVEVSRDLAYAKIFVTILNTQ 58

Query: 67  SPDRVIS---ALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL----MCL 119
             D+       LN    FIR  +G+ +R  R +P L+F  D SL     ++ L    +  
Sbjct: 59  DEDKSNESIAILNEATGFIRSLLGKRIRA-RIMPNLKFVLDRSLLEGMHMSNLVDKVIRE 117

Query: 120 PKIPV 124
            K+  
Sbjct: 118 DKLKR 122


>gi|317504480|ref|ZP_07962458.1| ribosome-binding factor A [Prevotella salivae DSM 15606]
 gi|315664423|gb|EFV04112.1| ribosome-binding factor A [Prevotella salivae DSM 15606]
          Length = 111

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 4/110 (3%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  R+   ++  L  +        R +   ++S++ V +S DL + T Y+S+      + 
Sbjct: 5   RQNRISRLLQKELATIFQEQT---RQMHGVMVSVTRVKISPDLSICTAYLSIFPSEKSEE 61

Query: 71  VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCL 119
           ++  +  N K IR  +G  +RN LR +PELRF  D SL    +++ L+  
Sbjct: 62  ILKNVTANTKTIRYDLGCRVRNQLRIIPELRFFIDDSLDYIERIDELLKK 111


>gi|167587337|ref|ZP_02379725.1| ribosome-binding factor A [Burkholderia ubonensis Bu]
          Length = 132

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 57/118 (48%), Gaps = 5/118 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPD 69
            R +++ ++++  L  +I+  E +D  I   +++I  V ++ D   A VY +      P+
Sbjct: 9   NRNVQIADQIQRDLSELIMR-EVKDPRIG--IVTIQSVELTPDYAHAKVYFTAL-TGDPE 64

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           +   ALN     +   + + L ++  VP L F YD +++   +++ L+       AL+
Sbjct: 65  KTQEALNHASGHLHNLLFKRL-HIHTVPTLHFHYDQTIEKAVEMSRLIKEANSTRALD 121


>gi|161524927|ref|YP_001579939.1| ribosome-binding factor A [Burkholderia multivorans ATCC 17616]
 gi|189350323|ref|YP_001945951.1| ribosome-binding factor A [Burkholderia multivorans ATCC 17616]
 gi|238687003|sp|A9ABD4|RBFA_BURM1 RecName: Full=Ribosome-binding factor A
 gi|160342356|gb|ABX15442.1| ribosome-binding factor A [Burkholderia multivorans ATCC 17616]
 gi|189334345|dbj|BAG43415.1| ribosome-binding factor A [Burkholderia multivorans ATCC 17616]
          Length = 132

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  +I+  E +D  I   +++I  V ++ D   A VY 
Sbjct: 1   MSRKRTSP-NRNVQIADQIQRDLSELIMR-EVKDPRIG--IVTIQSVELTPDYAHAKVYF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +      P     ALN     +   + + L ++  VP L F YD +++    ++ L+   
Sbjct: 57  TTL-TGDPAATQQALNHASGHLHNLLFKRL-HIHTVPTLHFHYDQTIEKAVAMSRLIDEA 114

Query: 121 KIPVALE 127
               A +
Sbjct: 115 NATRAKD 121


>gi|78189422|ref|YP_379760.1| ribosome-binding factor A [Chlorobium chlorochromatii CaD3]
 gi|123579528|sp|Q3AQK8|RBFA_CHLCH RecName: Full=Ribosome-binding factor A
 gi|78171621|gb|ABB28717.1| ribosome-binding factor A [Chlorobium chlorochromatii CaD3]
          Length = 123

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 7/115 (6%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           SRR  RV   ++  L  +      +       +++I EV ++VDL +A VYIS       
Sbjct: 2   SRRTERVASLLQHELGAIFQLELPRTP-----IVTIVEVKVTVDLGIARVYISTIGTPEE 56

Query: 69  DR-VISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMCLPK 121
              +++ L    K+IR  + + +R+  R +PEL F  D   +    +  L+   +
Sbjct: 57  QAAIMAHLQEQNKYIRKLLSQRIRHQFRRIPELEFYEDHLYEHARHIEQLLSQVR 111


>gi|119504360|ref|ZP_01626440.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2080]
 gi|119459868|gb|EAW40963.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2080]
          Length = 134

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 7/120 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
           K+  R  R+G+ ++  L   +L     D  +   ++S++ V +S DL  A V+ +     
Sbjct: 5   KDYSRTQRIGDSLQQELAR-LLQFTLSDPRLK--MVSVTGVDVSRDLSHAKVFFTQMGVD 61

Query: 67  SPD---RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                    SAL+    F+R  I      LR VP+LRF +D S+     +  L+   +  
Sbjct: 62  DAQAAAETTSALDRASGFLRSEIA-RTATLRTVPKLRFCFDESVGRGRDMETLIRKVRAA 120


>gi|329956560|ref|ZP_08297157.1| ribosome-binding factor A [Bacteroides clarus YIT 12056]
 gi|328524457|gb|EGF51527.1| ribosome-binding factor A [Bacteroides clarus YIT 12056]
          Length = 112

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 32/112 (28%), Positives = 59/112 (52%), Gaps = 4/112 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   +IS+S V +S D+ VA  Y+S+    
Sbjct: 1   METTRQNKIARLLQKELSDIFL---LQTKSMPGILISVSAVRISPDMSVARAYLSVFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALM 117
             + +I  +N N+K IR  +G  +R+ LR +PEL+F  D SL    +++ L+
Sbjct: 58  KSEEIIKNVNANMKSIRFELGTRVRHQLRIIPELKFFVDDSLDYLERIDELL 109


>gi|163848558|ref|YP_001636602.1| ribosome-binding factor A [Chloroflexus aurantiacus J-10-fl]
 gi|222526493|ref|YP_002570964.1| ribosome-binding factor A [Chloroflexus sp. Y-400-fl]
 gi|182676538|sp|A9WGP7|RBFA_CHLAA RecName: Full=Ribosome-binding factor A
 gi|254789741|sp|B9LBJ3|RBFA_CHLSY RecName: Full=Ribosome-binding factor A
 gi|163669847|gb|ABY36213.1| ribosome-binding factor A [Chloroflexus aurantiacus J-10-fl]
 gi|222450372|gb|ACM54638.1| ribosome-binding factor A [Chloroflexus sp. Y-400-fl]
          Length = 127

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 52/110 (47%), Gaps = 4/110 (3%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP- 68
            R  +V + ++  L  VI   E +D  +     +++ V +S DL+ A V IS+       
Sbjct: 4   HRLQQVADTMQRVLGDVIQK-ELKDPRVG--FATVTGVEVSADLQHAKVRISVMGSPEER 60

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           +  ++AL     F+R R+   +  +R+VPEL    DTSL     ++ +  
Sbjct: 61  EAAMAALQRARGFLRKRVAEEMSYMRFVPELHLIQDTSLDYTMHMDEVFR 110


>gi|293526627|ref|ZP_06671312.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           M1015]
 gi|290920699|gb|EFD97762.1| ribosome-binding factor A [Staphylococcus aureus subsp. aureus
           M1015]
          Length = 130

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/123 (28%), Positives = 65/123 (52%), Gaps = 5/123 (4%)

Query: 2   KNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS 61
           K     +S RA RVGE+++  LM +I NN+ +D  +    I+I++V ++ DL    V+++
Sbjct: 10  KEVTRMSSMRAERVGEQMKKELMDII-NNKVKDPRVG--FITITDVVLTNDLSQVKVFLT 66

Query: 62  LPLDVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +  +    +    AL+    FI+  +G  +R LR +PEL + YD S++   K+  ++   
Sbjct: 67  VLGNDKEVENTFKALDKAKGFIKSELGSRMR-LRIMPELMYEYDQSIEYGNKIERMIQDL 125

Query: 121 KIP 123
              
Sbjct: 126 HKQ 128


>gi|284928793|ref|YP_003421315.1| ribosome-binding factor A [cyanobacterium UCYN-A]
 gi|284809252|gb|ADB94957.1| ribosome-binding factor A [cyanobacterium UCYN-A]
          Length = 128

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            NSRR  R+   ++  +  ++L  + +D  +   +ISI+ V +S DL+   +++S+    
Sbjct: 2   ANSRRVSRISSLIKREISNMLL-FDIKDDRVGAGMISITNVDLSGDLQHVKIFVSIYGTE 60

Query: 67  SPDR-VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                 +  L  +  ++R  + + +R LR  P+++F  D  ++   ++  L+   K
Sbjct: 61  EVQFETMQGLKSSEGYVRKELAQRIR-LRRAPDVKFFQDYGIEKGNEMLYLLSELK 115


>gi|257878522|ref|ZP_05658175.1| ribosome-binding factor A [Enterococcus faecium 1,230,933]
 gi|257884346|ref|ZP_05663999.1| ribosome-binding factor A [Enterococcus faecium 1,231,501]
 gi|261207405|ref|ZP_05922091.1| ribosome-binding factor A [Enterococcus faecium TC 6]
 gi|289566672|ref|ZP_06447089.1| ribosome-binding factor A [Enterococcus faecium D344SRF]
 gi|293556653|ref|ZP_06675218.1| ribosome-binding factor A [Enterococcus faecium E1039]
 gi|293567727|ref|ZP_06679069.1| ribosome-binding factor A [Enterococcus faecium E1071]
 gi|294613933|ref|ZP_06693868.1| ribosome-binding factor A [Enterococcus faecium E1636]
 gi|294618719|ref|ZP_06698251.1| ribosome-binding factor A [Enterococcus faecium E1679]
 gi|257812750|gb|EEV41508.1| ribosome-binding factor A [Enterococcus faecium 1,230,933]
 gi|257820184|gb|EEV47332.1| ribosome-binding factor A [Enterococcus faecium 1,231,501]
 gi|260078296|gb|EEW66001.1| ribosome-binding factor A [Enterococcus faecium TC 6]
 gi|289161531|gb|EFD09414.1| ribosome-binding factor A [Enterococcus faecium D344SRF]
 gi|291589570|gb|EFF21376.1| ribosome-binding factor A [Enterococcus faecium E1071]
 gi|291593208|gb|EFF24782.1| ribosome-binding factor A [Enterococcus faecium E1636]
 gi|291595032|gb|EFF26377.1| ribosome-binding factor A [Enterococcus faecium E1679]
 gi|291601188|gb|EFF31475.1| ribosome-binding factor A [Enterococcus faecium E1039]
          Length = 115

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 54/116 (46%), Gaps = 6/116 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
             + R  RVG+E+   +  ++   + +D  +    ++I++V ++ DL+ AT+Y S+  D 
Sbjct: 1   MANYRDRRVGQEILKEVNDIL-RKKVRDPRVEN--VTITDVKVTGDLQQATIYYSILSDL 57

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
                +    LN     IR  +G +L   +  PEL F  D S+     ++ L+   
Sbjct: 58  ASDKKKAQDGLNKASGLIRRELGHNLSIYK-TPELFFELDESVVYGNHIDELLRDL 112


>gi|167627173|ref|YP_001677673.1| ribosome-binding factor A [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|189039542|sp|B0TWR4|RBFA_FRAP2 RecName: Full=Ribosome-binding factor A
 gi|167597174|gb|ABZ87172.1| ribosome-binding factor A [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 143

 Score = 96.0 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 37/117 (31%), Positives = 56/117 (47%), Gaps = 9/117 (7%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSPDR 70
           R  RV  E++  +  ++L  + +D  ++    +I+EV +S DL  A VY +         
Sbjct: 6   RVQRVASELQKVIS-LLLRTKIKDSKLATA--TITEVELSKDLSYAKVYYTCLDIQEAQY 62

Query: 71  VISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
           +  A   +  F R  I +SL NLR VP L+F YD SL    ++       KI  ALE
Sbjct: 63  ISKAFEKSKGFFRSSIAKSL-NLRIVPNLKFVYDKSLDYGMEMEG-----KIQQALE 113


>gi|56460075|ref|YP_155356.1| ribosome-binding factor A [Idiomarina loihiensis L2TR]
 gi|61214736|sp|Q5QTY9|RBFA_IDILO RecName: Full=Ribosome-binding factor A
 gi|56179085|gb|AAV81807.1| Ribosome-binding factor A [Idiomarina loihiensis L2TR]
          Length = 128

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 61/125 (48%), Gaps = 7/125 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLP- 63
             +   R  RV  +++  +  ++   E +D  +S  ++++S+V +S DL  A V+++   
Sbjct: 1   MAQEFSRTERVRHQLQREIAMILQR-EIKDPRVS--MVTVSDVEVSRDLAYAKVFVTFFQ 57

Query: 64  -LDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
                  + +  LN    FIR  +G+ ++  R VP+LRF++D SL    ++  L+   + 
Sbjct: 58  DDPEQTKQALKVLNEASGFIRSLLGKRIKA-RIVPQLRFQHDASLNEGIRMGKLVAEAR- 115

Query: 123 PVALE 127
               +
Sbjct: 116 ERDKK 120


>gi|332141183|ref|YP_004426921.1| ribosome-binding factor A [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|238693266|sp|B4RXT9|RBFA_ALTMD RecName: Full=Ribosome-binding factor A
 gi|327551205|gb|AEA97923.1| ribosome-binding factor A [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 133

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 61/129 (47%), Gaps = 8/129 (6%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             +   R  RV ++V   +  ++  NE++ R+    +I++S+V +S DL  A +++++  
Sbjct: 1   MAREFSRTDRVAQQVHKEVASIL-QNEYKHRVGDMPLITVSDVDVSRDLAHAKIFVTIYN 59

Query: 65  DVSPDRVISA--LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL----MC 118
               +  +    L    KFIR  + + LR +R VP+L F  D S+    +++ L    + 
Sbjct: 60  STEEEGKVQIKQLAEYKKFIRSILAKRLR-MRSVPDLHFFEDKSIIEGMRISNLVSQTIA 118

Query: 119 LPKIPVALE 127
             +     +
Sbjct: 119 KDESKRDQD 127


>gi|125718689|ref|YP_001035822.1| ribosome-binding factor A [Streptococcus sanguinis SK36]
 gi|323350350|ref|ZP_08086014.1| ribosome-binding factor A [Streptococcus sanguinis VMC66]
 gi|166219412|sp|A3CQ17|RBFA_STRSV RecName: Full=Ribosome-binding factor A
 gi|125498606|gb|ABN45272.1| Ribosome-binding factor A, putative [Streptococcus sanguinis SK36]
 gi|322123423|gb|EFX95099.1| ribosome-binding factor A [Streptococcus sanguinis VMC66]
 gi|324991729|gb|EGC23661.1| ribosome-binding factor A [Streptococcus sanguinis SK353]
 gi|324992024|gb|EGC23946.1| ribosome-binding factor A [Streptococcus sanguinis SK405]
 gi|324994117|gb|EGC26031.1| ribosome-binding factor A [Streptococcus sanguinis SK678]
 gi|325686961|gb|EGD28985.1| ribosome-binding factor A [Streptococcus sanguinis SK72]
 gi|325697664|gb|EGD39549.1| ribosome-binding factor A [Streptococcus sanguinis SK160]
 gi|327459326|gb|EGF05672.1| ribosome-binding factor A [Streptococcus sanguinis SK1]
 gi|327462406|gb|EGF08731.1| ribosome-binding factor A [Streptococcus sanguinis SK1057]
 gi|327467108|gb|EGF12618.1| ribosome-binding factor A [Streptococcus sanguinis SK330]
 gi|327472750|gb|EGF18177.1| ribosome-binding factor A [Streptococcus sanguinis SK408]
 gi|332358016|gb|EGJ35849.1| ribosome-binding factor A [Streptococcus sanguinis SK1056]
 gi|332362941|gb|EGJ40730.1| ribosome-binding factor A [Streptococcus sanguinis SK49]
 gi|332364624|gb|EGJ42393.1| ribosome-binding factor A [Streptococcus sanguinis SK1059]
          Length = 116

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 58/119 (48%), Gaps = 6/119 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
            N+ R  RVG E++  +  ++   + +D  +    ++I++V M  DL +A VY ++  + 
Sbjct: 2   ANNFRTDRVGMEIKREVNEILQK-KVRDPRVQG--VTITDVQMLGDLSMAKVYYTIMSNL 58

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
                +  + L      I+  +G +L+  + +P+L F  D S++   K++ ++   +  
Sbjct: 59  ASDNQKAQTGLEKATGTIKRELGHNLKMYK-IPDLTFVKDESIEYGNKIDQMLRDLEKK 116


>gi|90416136|ref|ZP_01224068.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2207]
 gi|90331861|gb|EAS47075.1| ribosome-binding factor A [marine gamma proteobacterium HTCC2207]
          Length = 142

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/117 (27%), Positives = 64/117 (54%), Gaps = 7/117 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            P+   RA RV + V+  L   ++ +E +D  +   +++++EV +S DL    V+++   
Sbjct: 1   MPREFTRAERVSDSVQQELA-TLIRSEVRDPRVG--MVNVTEVQISRDLAYGKVFVNFVG 57

Query: 65  DVSPDRV---ISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMC 118
           D   +++   ++ALN    ++R  +G S+  LR VP+L F +D + +    L+AL+ 
Sbjct: 58  DREQEQIDEAMAALNGASGYLRKLLGASI-QLRIVPKLNFIFDETGRRGQHLSALID 113


>gi|241895998|ref|ZP_04783294.1| ribosome-binding factor A [Weissella paramesenteroides ATCC 33313]
 gi|241870729|gb|EER74480.1| ribosome-binding factor A [Weissella paramesenteroides ATCC 33313]
          Length = 117

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/118 (22%), Positives = 58/118 (49%), Gaps = 6/118 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             + + R  R+ +E++  +  ++L    +D  I    ++++ V ++ DL+ A ++ S+  
Sbjct: 1   MAQQNFRVGRLEQEIQREINDLLLKR-IRDPRIEG--VTVTGVEVTGDLQQAKIFYSVLS 57

Query: 65  DVSP--DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +++    +    L+     IR  +G  LR  +  PEL+F  D S+Q   K++ L+   
Sbjct: 58  ELASVNKKAAEGLDAATGLIRKELGSRLRIYK-TPELKFVKDESVQYGNKIDDLIRQL 114


>gi|227544947|ref|ZP_03974996.1| ribosome-binding factor A [Lactobacillus reuteri CF48-3A]
 gi|300910022|ref|ZP_07127482.1| ribosome-binding factor A [Lactobacillus reuteri SD2112]
 gi|227185058|gb|EEI65129.1| ribosome-binding factor A [Lactobacillus reuteri CF48-3A]
 gi|300892670|gb|EFK86030.1| ribosome-binding factor A [Lactobacillus reuteri SD2112]
          Length = 119

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 56/122 (45%), Gaps = 6/122 (4%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            P    R  R+ +E++  +  ++L    +D  +    ++I+ V ++ DL+ AT+Y S+  
Sbjct: 1   MPSKHYRVDRLAQEIQKDVDEILLKR-VRDPRVQN--VTITGVDVTGDLQQATIYYSILS 57

Query: 65  D--VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKI 122
           D     ++  + L+     IR  +G  L   +  PE++F  D S+    +++ L+     
Sbjct: 58  DLASDAEKAQAGLDKATGLIRSELGARLNIFK-TPEIKFVRDPSVAYGSRIDQLINDLHK 116

Query: 123 PV 124
             
Sbjct: 117 KE 118


>gi|227495150|ref|ZP_03925466.1| ribosome-binding factor A [Actinomyces coleocanis DSM 15436]
 gi|226831602|gb|EEH63985.1| ribosome-binding factor A [Actinomyces coleocanis DSM 15436]
          Length = 156

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/115 (20%), Positives = 53/115 (46%), Gaps = 5/115 (4%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VSP 68
            R  +V + ++  +  ++     +D  +    ++I++V ++ DL+ AT++ ++       
Sbjct: 5   NRQRKVADRIQQTVARLLERR-IKDPRLG--FVTITDVSVTGDLQHATIFYTVFGKASDA 61

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           +R   ALN     IR  +G++L  +R  P + F  D   QS  +L   +   +  
Sbjct: 62  ERTQKALNSAKGMIRSEVGKAL-GIRLTPTIEFVADALPQSAARLEDALARAQAA 115


>gi|134295575|ref|YP_001119310.1| ribosome-binding factor A [Burkholderia vietnamiensis G4]
 gi|166218426|sp|A4JDX2|RBFA_BURVG RecName: Full=Ribosome-binding factor A
 gi|134138732|gb|ABO54475.1| ribosome-binding factor A [Burkholderia vietnamiensis G4]
          Length = 132

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 58/127 (45%), Gaps = 6/127 (4%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  +I+  E +D  I   +++I  V ++ D   A VY 
Sbjct: 1   MSRKRTSP-NRNVQIADQIQRDLSELIMR-EVKDPRIG--IVTIQSVELTPDYAHAKVYF 56

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +      P++   ALN     +   + + L ++  VP L F YD +++   +++ L+   
Sbjct: 57  TAL-TGDPEKTQEALNHASGHLHNLLFKRL-HIHTVPTLHFHYDQTIEKAVEMSRLIKEA 114

Query: 121 KIPVALE 127
               A +
Sbjct: 115 NSTRAKD 121


>gi|330718228|ref|ZP_08312828.1| ribosome-binding factor A [Leuconostoc fallax KCTC 3537]
          Length = 117

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 55/113 (48%), Gaps = 6/113 (5%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD--VS 67
           +RA R+ +E++  +  ++L    +D  +    ++I+ V ++ DL+ AT+Y S+  D    
Sbjct: 5   QRAGRLSQEIQRDVTDLLLKR-VRDPRVQD--VTITSVDVTGDLQGATIYYSILSDLASD 61

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +    L      IR  +G  L   + +PEL+F  DTS+Q    +  L+   
Sbjct: 62  AKKAQDGLEAATGLIRKELGSRLTVYK-IPELKFVRDTSVQYGNHIEELIKKL 113


>gi|116490514|ref|YP_810058.1| ribosome-binding factor A [Oenococcus oeni PSU-1]
 gi|290889914|ref|ZP_06553001.1| hypothetical protein AWRIB429_0391 [Oenococcus oeni AWRIB429]
 gi|122277299|sp|Q04GM9|RBFA_OENOB RecName: Full=Ribosome-binding factor A
 gi|116091239|gb|ABJ56393.1| ribosome-binding factor A [Oenococcus oeni PSU-1]
 gi|290480524|gb|EFD89161.1| hypothetical protein AWRIB429_0391 [Oenococcus oeni AWRIB429]
          Length = 121

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 24/116 (20%), Positives = 55/116 (47%), Gaps = 6/116 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
             S R LRV   ++  +  +++  E  D  +    ++I+ + M+ D  +A VY ++  D 
Sbjct: 5   AKSARLLRVEGTIQREISEILVK-EVSDPRLKD--VTITGIDMTPDFSIAYVYWTIYSDL 61

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             S ++  + L      I+ ++ R +   + +P+L F+ DT+++    +  L+   
Sbjct: 62  ASSGEKADAGLQAAKGLIKRQLARKMTTFK-IPDLIFKRDTAIEYGDHIEQLIAKL 116


>gi|311744148|ref|ZP_07717953.1| ribosome-binding factor A [Aeromicrobium marinum DSM 15272]
 gi|311312503|gb|EFQ82415.1| ribosome-binding factor A [Aeromicrobium marinum DSM 15272]
          Length = 157

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 55/120 (45%), Gaps = 7/120 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
            P    R  ++ + ++  +  ++     +D  +    ++I++V ++ D + A+++ ++  
Sbjct: 1   MPGP--RHHQIADRIKVVVAEMLERR-IKDPRLG--FVTITDVRLTGDNQHASIFYTVLG 55

Query: 65  DV-SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           D    DR  +AL      +R  +G+ L  +R+ P L F  D   ++  ++  L+   +  
Sbjct: 56  DQADIDRTAAALASANGVLRKEVGKQL-GIRHTPSLEFFLDAVPETARQIEDLLNRAREQ 114


>gi|239917230|ref|YP_002956788.1| ribosome-binding factor A [Micrococcus luteus NCTC 2665]
 gi|281414295|ref|ZP_06246037.1| ribosome-binding factor A [Micrococcus luteus NCTC 2665]
 gi|259552035|sp|C5C9T2|RBFA_MICLC RecName: Full=Ribosome-binding factor A
 gi|239838437|gb|ACS30234.1| ribosome-binding factor A [Micrococcus luteus NCTC 2665]
          Length = 148

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 54/118 (45%), Gaps = 6/118 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP-D 69
           RA R+ + ++  +   +     +D  +    ++++EV ++ DL+ ATVY ++  D +   
Sbjct: 6   RAGRLAQRIKVLVAEALRRG-VKDDRVE--PVTVTEVRVTNDLQHATVYYTVLGDEATVA 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALE 127
                +  N   +R  +GR L  +R VP L F  DT  ++   L  ++   K     E
Sbjct: 63  AAHEGIQDNRGILRREVGRGL-TIRLVPTLEFVADTVPEAAAHLEDVLRAAK-ERDAE 118


>gi|291460008|ref|ZP_06599398.1| ribosome-binding factor A [Oribacterium sp. oral taxon 078 str.
           F0262]
 gi|291417349|gb|EFE91068.1| ribosome-binding factor A [Oribacterium sp. oral taxon 078 str.
           F0262]
          Length = 139

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 59/116 (50%), Gaps = 4/116 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             K S +  R  E+VR  L  +++ +E +D  +   + +I+ V ++ DL+   VY+S   
Sbjct: 1   MRKQSFKYQRRNEDVRRQLS-LLVRDELKDARV-SPMTNITGVDLTPDLQYCKVYVSALG 58

Query: 65  DVSP-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
                D+ +  L     F+R  + RSL NLR+ PEL F  D S +   +++AL+  
Sbjct: 59  GEEVLDKTMEGLRAASGFLRRELARSL-NLRHTPELSFVADRSAEYGSRMDALIRR 113


>gi|42526615|ref|NP_971713.1| ribosome-binding factor A [Treponema denticola ATCC 35405]
 gi|61215109|sp|Q73NP7|RBFA_TREDE RecName: Full=Ribosome-binding factor A
 gi|41816808|gb|AAS11594.1| ribosome-binding factor A [Treponema denticola ATCC 35405]
 gi|325473157|gb|EGC76353.1| ribosome-binding factor A [Treponema denticola F0402]
          Length = 132

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 59/119 (49%), Gaps = 3/119 (2%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS-LPLDVSPD 69
           R  R+GE++R  +  +I + + +D  +S  ++SI+ V +S DL  A VY+S    +    
Sbjct: 5   RLARLGEQIREEISALICSGKIKDPRVSS-LLSINRVIVSGDLAYAKVYVSSFLDEHKTK 63

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVALEK 128
           + +  L     FIR  + + L ++R  PEL F +D S++    +   +   +     ++
Sbjct: 64  QGVRGLENASGFIRTSLAKKL-HVRQCPELTFIFDKSIKEGIDMVNKLESLEYFTDPDE 121


>gi|294815434|ref|ZP_06774077.1| Ribosome-binding factor A [Streptomyces clavuligerus ATCC 27064]
 gi|326443786|ref|ZP_08218520.1| ribosome-binding factor A [Streptomyces clavuligerus ATCC 27064]
 gi|294328033|gb|EFG09676.1| Ribosome-binding factor A [Streptomyces clavuligerus ATCC 27064]
          Length = 147

 Score = 96.0 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 20/116 (17%), Positives = 50/116 (43%), Gaps = 4/116 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA ++ + +R  +   +     +D  +    ++I++  ++ DLR ATV+ ++  D 
Sbjct: 2   ADNARAKKLADLIREVVAEKLQRG-IKDPRLGTH-VTITDTRVTGDLREATVFYTVYGDD 59

Query: 67  SPD-RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
                  + L      +R  +G +    ++ P L F  D   ++   +  L+   +
Sbjct: 60  EARASAAAGLQSAKGVLRSAVGAAAGT-KFTPTLTFVADALPENARNIEDLLDQAR 114


>gi|187923625|ref|YP_001895267.1| ribosome-binding factor A [Burkholderia phytofirmans PsJN]
 gi|238689603|sp|B2T382|RBFA_BURPP RecName: Full=Ribosome-binding factor A
 gi|187714819|gb|ACD16043.1| ribosome-binding factor A [Burkholderia phytofirmans PsJN]
          Length = 121

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 57/127 (44%), Gaps = 7/127 (5%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  ++   E +D  I   +++I  V ++ D   A VY 
Sbjct: 1   MPKKRSSP-NRNVQIADQIQRDLSDLLR--EVKDPRIG--IVTIQSVELTPDYAHAKVYF 55

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +      P + + AL      +  ++ + L ++  VP L F YD +++   +++ L+   
Sbjct: 56  TTL-TGDPQQTLEALTHAAGHLHNQLFKRL-HIHTVPTLHFHYDKTIERAVEMSRLIDEA 113

Query: 121 KIPVALE 127
               A E
Sbjct: 114 NANRAKE 120


>gi|254556870|ref|YP_003063287.1| ribosome-binding factor A [Lactobacillus plantarum JDM1]
 gi|300768183|ref|ZP_07078088.1| ribosome-binding factor A [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308180811|ref|YP_003924939.1| ribosome-binding factor A [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|254045797|gb|ACT62590.1| ribosome-binding factor A [Lactobacillus plantarum JDM1]
 gi|300494247|gb|EFK29410.1| ribosome-binding factor A [Lactobacillus plantarum subsp. plantarum
           ATCC 14917]
 gi|308046302|gb|ADN98845.1| ribosome-binding factor A [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 117

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 55/115 (47%), Gaps = 6/115 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV--SP 68
           R  R+ +E+   +  ++L    +D  ++   ++I+ V ++ DL+ AT+Y S+  D     
Sbjct: 6   RVGRLEQEIEREVNDILLKR-VRDPRVAG--VTITGVTVTGDLQQATIYYSILSDKASDG 62

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           ++  + L      IR  +G  L   +  PEL F  D S+Q   +++ L+   K  
Sbjct: 63  EKTAAGLTKATGLIRSELGSRLSIYK-TPELTFERDNSVQYGSRIDELINNLKRQ 116


>gi|302558067|ref|ZP_07310409.1| ribosome-binding factor A [Streptomyces griseoflavus Tu4000]
 gi|302475685|gb|EFL38778.1| ribosome-binding factor A [Streptomyces griseoflavus Tu4000]
          Length = 149

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
            ++ RA R+ + +R  +   +     +D  +    ++I++  ++ DLR ATV+ ++  D 
Sbjct: 2   ADNARAKRLADLIREVVAQKLQRG-IKDPRLGTH-VTITDTRVTGDLREATVFYTVYGDD 59

Query: 67  SPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPVA 125
              +  +A L      +R  +GR+   +++ P L F  D    +   +  L+   +    
Sbjct: 60  EERKAAAAGLESAKGILRSEVGRA-AGVKFTPTLTFVMDALPDTARNIEDLLDRAR-QSD 117

Query: 126 LE 127
            +
Sbjct: 118 EK 119


>gi|300173101|ref|YP_003772267.1| ribosome-binding factor A [Leuconostoc gasicomitatum LMG 18811]
 gi|299887480|emb|CBL91448.1| ribosome-binding factor A [Leuconostoc gasicomitatum LMG 18811]
          Length = 117

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 6/113 (5%)

Query: 10  RRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD--VS 67
           +RA R+ +EV+  +  ++L     D  +    ++++ V +S DL++AT+Y S+  D    
Sbjct: 5   QRAGRLAQEVQRDVTSLLLKR-INDPRVQD--VTVTSVELSGDLQIATIYYSILSDLASD 61

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
             +  + L      IR  +G  L   +  PEL+F  D S+Q    +  L+   
Sbjct: 62  GKKAQAGLEAASGLIRKELGSRLTVYK-TPELKFVRDQSVQYGNHIEDLIRKL 113


>gi|260905189|ref|ZP_05913511.1| ribosome-binding factor A [Brevibacterium linens BL2]
          Length = 142

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 23/108 (21%), Positives = 53/108 (49%), Gaps = 5/108 (4%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD-VSPD 69
           RA ++ ++++  +   I     +D  +    +++++V ++ DL+ A+++ ++  D    +
Sbjct: 6   RARKIADQIKVIVASTIERR-LKDPRLG--FVTVTDVRVTGDLQHASIFYTVFGDGQDLE 62

Query: 70  RVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
               AL     FIR  +G+ L  +R  P L F  D   ++   L+ L+
Sbjct: 63  ATGKALESAKGFIRSEVGKGL-TIRLTPSLEFIADAVPEAAAHLDGLL 109


>gi|238916827|ref|YP_002930344.1| ribosome-binding factor A [Eubacterium eligens ATCC 27750]
 gi|259551983|sp|C4Z5N8|RBFA_EUBE2 RecName: Full=Ribosome-binding factor A
 gi|238872187|gb|ACR71897.1| ribosome-binding factor A [Eubacterium eligens ATCC 27750]
          Length = 130

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 34/116 (29%), Positives = 57/116 (49%), Gaps = 4/116 (3%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
             KNS +  R+  EV   L  +I  +E +D  I   + S+  V ++ DL+    YIS+  
Sbjct: 1   MRKNSVKNTRINGEVLKELSNII-RSEIKDPRI-NPMTSVVAVEVAPDLKTCKAYISVLG 58

Query: 65  DVS-PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCL 119
           D       I+ L     +IR ++ R++ NLR  PE+RF  D S++    ++ L+  
Sbjct: 59  DEKSQKDTITGLKSAEGYIRRQLARTV-NLRNTPEIRFILDQSIEYGINMSKLIDE 113


>gi|163791147|ref|ZP_02185566.1| ribosome-binding factor A [Carnobacterium sp. AT7]
 gi|159873619|gb|EDP67704.1| ribosome-binding factor A [Carnobacterium sp. AT7]
          Length = 115

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 55/116 (47%), Gaps = 6/116 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  RV +E++  +  ++     +D  ++   I+  +V ++ DL+ ATV+ S+  D 
Sbjct: 1   MANHRIGRVSQEIQREVNDIL-KKRVKDPRVADVNIT--DVRVTGDLQQATVFYSILSDK 57

Query: 67  --SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
               ++    L+     +R  +G+ L +L   PE+ F  D S++    ++ L+   
Sbjct: 58  ASEREKTQLGLDKASGLVRSELGKRL-SLYKTPEISFERDESVEYGNHIDELLRNL 112


>gi|19746622|ref|NP_607758.1| ribosome-binding factor A [Streptococcus pyogenes MGAS8232]
 gi|50914802|ref|YP_060774.1| ribosome-binding factor A [Streptococcus pyogenes MGAS10394]
 gi|94989040|ref|YP_597141.1| ribosome-binding factor A [Streptococcus pyogenes MGAS9429]
 gi|94991038|ref|YP_599138.1| ribosome-binding factor A [Streptococcus pyogenes MGAS10270]
 gi|94992931|ref|YP_601030.1| ribosome-binding factor A [Streptococcus pyogenes MGAS2096]
 gi|306826869|ref|ZP_07460169.1| ribosome-binding factor A [Streptococcus pyogenes ATCC 10782]
 gi|19748841|gb|AAL98257.1| putative ribosome binding factor A [Streptococcus pyogenes
           MGAS8232]
 gi|50903876|gb|AAT87591.1| Ribosome-binding factor A [Streptococcus pyogenes MGAS10394]
 gi|94542548|gb|ABF32597.1| ribosome-binding factor A [Streptococcus pyogenes MGAS9429]
 gi|94544546|gb|ABF34594.1| Ribosome-binding factor A [Streptococcus pyogenes MGAS10270]
 gi|94546439|gb|ABF36486.1| Ribosome-binding factor A [Streptococcus pyogenes MGAS2096]
 gi|304430887|gb|EFM33896.1| ribosome-binding factor A [Streptococcus pyogenes ATCC 10782]
          Length = 118

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 54/119 (45%), Gaps = 6/119 (5%)

Query: 5   NPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPL 64
               + R  RVG E++  +  ++   + +D  +    ++I+EV M  DL +A VY ++  
Sbjct: 1   MAMANHRIDRVGMEIKREVNDILQK-KVRDPRVQG--VTITEVQMQGDLSLAKVYYTIMS 57

Query: 65  D--VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPK 121
           D      +  + L      I+  +G+ L  +  +P+L F  D S+    K++ L+    
Sbjct: 58  DLASDNQKAQTGLEKATGTIKRELGKQL-TMYKIPDLVFEKDNSIAYGNKIDQLLRELD 115


>gi|328957412|ref|YP_004374798.1| ribosome-binding factor A [Carnobacterium sp. 17-4]
 gi|328673736|gb|AEB29782.1| ribosome-binding factor A [Carnobacterium sp. 17-4]
          Length = 115

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/116 (21%), Positives = 56/116 (48%), Gaps = 6/116 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  RV +E++  +  ++     +D  ++   I+  +V ++ DL+ ATV+ S+  D 
Sbjct: 1   MANHRIGRVSQEIQREVNDIL-KKRVKDPRVADVNIT--DVRVTGDLQQATVFYSILSDK 57

Query: 67  --SPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
               ++    L+     +R  +G+ L +L   PE++F  D S++    ++ L+   
Sbjct: 58  ASDREKTQLGLDKASGLVRSELGQRL-SLYKTPEIKFERDESVEYGNHIDELLRNL 112


>gi|307730027|ref|YP_003907251.1| ribosome-binding factor A [Burkholderia sp. CCGE1003]
 gi|323525726|ref|YP_004227879.1| ribosome-binding factor A [Burkholderia sp. CCGE1001]
 gi|307584562|gb|ADN57960.1| ribosome-binding factor A [Burkholderia sp. CCGE1003]
 gi|323382728|gb|ADX54819.1| ribosome-binding factor A [Burkholderia sp. CCGE1001]
          Length = 121

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 58/127 (45%), Gaps = 7/127 (5%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
           M  K      R +++ ++++  L  ++   E +D  I   +++I  V ++ D   A VY 
Sbjct: 1   MPKKRSSP-NRNVQIADQIQRDLSELLR--EVKDPRIG--IVTIQSVELTPDYAHAKVYF 55

Query: 61  SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120
           +      P + ++AL      +  ++ + L ++  VP L F YD +++   +++ L+   
Sbjct: 56  TTL-TGDPQQTLAALTHAAGHLHNQLFKRL-HIHTVPTLHFHYDKTIERAVEMSRLIDEA 113

Query: 121 KIPVALE 127
               A +
Sbjct: 114 NASRAKD 120


>gi|270295326|ref|ZP_06201527.1| ribosome-binding factor A [Bacteroides sp. D20]
 gi|317478322|ref|ZP_07937486.1| ribosome-binding factor A [Bacteroides sp. 4_1_36]
 gi|270274573|gb|EFA20434.1| ribosome-binding factor A [Bacteroides sp. D20]
 gi|316905481|gb|EFV27271.1| ribosome-binding factor A [Bacteroides sp. 4_1_36]
          Length = 110

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 59/113 (52%), Gaps = 4/113 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV 66
             + R  ++   ++  L  + L    Q + +   +IS+S V +S D+ VA  Y+S+    
Sbjct: 1   METTRQNKIARLLQKELSDIFL---LQTKSMPGILISVSAVRISPDMSVARAYLSIFPSE 57

Query: 67  SPDRVISALNCNIKFIRGRIGRSLRN-LRYVPELRFRYDTSLQSYWKLNALMC 118
             + ++  +N N+K IR  +G  +R+ LR +PEL+F  D SL    +++ L+ 
Sbjct: 58  KSEEIVKNINGNMKSIRFELGTRVRHQLRIIPELKFFVDDSLDYLERIDELLK 110


>gi|28378672|ref|NP_785564.1| ribosome-binding factor A [Lactobacillus plantarum WCFS1]
 gi|32171605|sp|Q88VK8|RBFA_LACPL RecName: Full=Ribosome-binding factor A
 gi|28271508|emb|CAD64413.1| ribosome-binding factor A [Lactobacillus plantarum WCFS1]
          Length = 117

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/115 (24%), Positives = 55/115 (47%), Gaps = 6/115 (5%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDV--SP 68
           R  R+ +E+   +  ++L    +D  ++   ++I+ V ++ DL+ AT+Y S+  D     
Sbjct: 6   RVGRLEQEIEREVNDILLKR-VRDPRVAG--VTITGVTVTGDLQQATIYYSILSDKASDG 62

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIP 123
           ++  + L      IR  +G  L   +  PEL F  D S+Q   +++ L+   K  
Sbjct: 63  EKTAAGLAKATGLIRSELGSRLSIYK-TPELTFERDNSVQYGSRIDELINNLKRQ 116


>gi|312865492|ref|ZP_07725719.1| ribosome-binding factor A [Streptococcus downei F0415]
 gi|311099010|gb|EFQ57227.1| ribosome-binding factor A [Streptococcus downei F0415]
          Length = 117

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 58/120 (48%), Gaps = 6/120 (5%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD- 65
            NS R  RVG E++  +  ++   + +D  +S   ++I++V M  DL +A VY ++  D 
Sbjct: 2   ANSFRTDRVGMEIKREVNEILQK-KVRDPRVSG--VTITDVQMLGDLSLAKVYYTIMSDL 58

Query: 66  -VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLPKIPV 124
                +  + L      I+  +G++L  +  +P+L F  D S+    K++ ++   +   
Sbjct: 59  ASDNQKAQTGLEKAKGTIKRELGKNL-QMYKIPDLTFIKDESIAYGNKIDQMLRDLESKK 117


>gi|34540680|ref|NP_905159.1| ribosome-binding factor A [Porphyromonas gingivalis W83]
 gi|188994888|ref|YP_001929140.1| putative ribosome-binding factor A [Porphyromonas gingivalis ATCC
           33277]
 gi|4586219|emb|CAB40971.1| RBFA, putative [Porphyromonas gingivalis]
 gi|34396994|gb|AAQ66058.1| ribosome-binding factor A [Porphyromonas gingivalis W83]
 gi|188594568|dbj|BAG33543.1| putative ribosome-binding factor A [Porphyromonas gingivalis ATCC
           33277]
          Length = 111

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/114 (21%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISIS