RPSBLAST alignment for GI: 254780786 and conserved domain: TIGR00082

>gnl|CDD|129191 TIGR00082, rbfA, ribosome-binding factor A. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Essential for efficient processing of 16S rRNA. May interact with the 5'terminal helix region of 16S rRNA. Mutants lacking rbfA have a cold-sensitive phenotype. Length = 114
 Score = 50.4 bits (121), Expect = 1e-07
 Identities = 36/110 (32%), Positives = 58/110 (52%), Gaps = 5/110 (4%)

Query: 8   NSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS 67
            S R  RV  ++    +  IL  E +D  +   ++++++V +S DL+ A V++    D  
Sbjct: 2   ASYRKERVESDIIR-EINRILIREIKDPRVG--MLTVTKVEVSKDLQHAKVFVDCYGDEE 58

Query: 68  P-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
             DRV+ ALN    FIR  +G+++R LR  PEL F  D SL    ++  L
Sbjct: 59  AIDRVVKALNKAKGFIRSLLGQAMR-LRKTPELHFVKDNSLDKGMRIENL 107