RPSBLAST alignment for GI: 254780786 and conserved domain: PRK13817

>gnl|CDD|139879 PRK13817, PRK13817, ribosome-binding factor A; Provisional. Length = 119
 Score = 44.4 bits (104), Expect = 9e-06
 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 4/109 (3%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           S+R  RV + +   L   +L  E +D  +S+  IS++ V +S DL+ A V+ SL  + + 
Sbjct: 2   SQRQQRVADLIHQQLA-ELLKKEVRDSRLSK--ISLTAVSISPDLKQAKVFYSLLENQNE 58

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
             V  ALN    ++R  + ++   LRYVP+L F YD S++   +++ L+
Sbjct: 59  KEVQKALNKATGYLRHLLAQATV-LRYVPKLEFVYDESIERAHRISLLI 106