RPSBLAST alignment for GI: 254780786 and conserved domain: PRK13816

>gnl|CDD|184344 PRK13816, PRK13816, ribosome-binding factor A; Provisional. Length = 131
 Score = 35.2 bits (81), Expect = 0.004
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 13/105 (12%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQD-RLISRDVISISEVCMSVDLRVATVYISL----- 62
           ++R  R+ + V+  L   ++  E +D RL    +++IS V +S DL  A VY+++     
Sbjct: 2   NQRLKRMADSVQRELS-ELIRQELKDPRLGG--LVTISSVKVSPDLGYADVYVTVMGREL 58

Query: 63  ---PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYD 104
                +V+    +  LN    F+R  + R ++  R  P LRF YD
Sbjct: 59  SDDQNEVAHRETLDVLNKASGFLRTELSRRIKT-RITPRLRFHYD 102