RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780786|ref|YP_003065199.1| ribosome-binding factor A [Candidatus Liberibacter asiaticus str. psy62] (128 letters) >gnl|CDD|179054 PRK00521, rbfA, ribosome-binding factor A; Validated. Length = 120 Score = 93.6 bits (234), Expect = 1e-20 Identities = 41/112 (36%), Positives = 67/112 (59%), Gaps = 5/112 (4%) Query: 6 PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS-LPL 64 S+RALRV E+++ L IL E +D + ++++++V +S DL A VY++ L Sbjct: 2 MAESQRALRVAEQIQRELA-EILQREIKDPRLG--MVTVTDVEVSPDLAHAKVYVTVLGD 58 Query: 65 DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116 + + ++AL F+R +G+ LR LRYVPELRF YD SL+ +++ L Sbjct: 59 EEDKEEALAALKKAAGFLRSELGKRLR-LRYVPELRFVYDESLEYGNRIDEL 109 >gnl|CDD|129191 TIGR00082, rbfA, ribosome-binding factor A. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Essential for efficient processing of 16S rRNA. May interact with the 5'terminal helix region of 16S rRNA. Mutants lacking rbfA have a cold-sensitive phenotype. Length = 114 Score = 50.4 bits (121), Expect = 1e-07 Identities = 36/110 (32%), Positives = 58/110 (52%), Gaps = 5/110 (4%) Query: 8 NSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS 67 S R RV ++ + IL E +D + ++++++V +S DL+ A V++ D Sbjct: 2 ASYRKERVESDIIR-EINRILIREIKDPRVG--MLTVTKVEVSKDLQHAKVFVDCYGDEE 58 Query: 68 P-DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116 DRV+ ALN FIR +G+++R LR PEL F D SL ++ L Sbjct: 59 AIDRVVKALNKAKGFIRSLLGQAMR-LRKTPELHFVKDNSLDKGMRIENL 107 >gnl|CDD|172345 PRK13815, PRK13815, ribosome-binding factor A; Provisional. Length = 122 Score = 47.1 bits (112), Expect = 1e-06 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 2/68 (2%) Query: 42 ISISEVCMSVDLRVATVYISLPLDVSPDRVISA-LNCNIKFIRGRIGRSLRNLRYVPELR 100 ++I+ V ++ DL +AT+Y ++ D + A LN FIR +G+ LR +RY PEL Sbjct: 32 VTITGVKVTDDLHLATIYFTVIGDDEAKKSTEAGLNSARGFIRKELGKVLR-MRYAPELI 90 Query: 101 FRYDTSLQ 108 F+YD S + Sbjct: 91 FKYDESQE 98 >gnl|CDD|139879 PRK13817, PRK13817, ribosome-binding factor A; Provisional. Length = 119 Score = 44.4 bits (104), Expect = 9e-06 Identities = 35/109 (32%), Positives = 61/109 (55%), Gaps = 4/109 (3%) Query: 9 SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68 S+R RV + + L +L E +D +S+ IS++ V +S DL+ A V+ SL + + Sbjct: 2 SQRQQRVADLIHQQLA-ELLKKEVRDSRLSK--ISLTAVSISPDLKQAKVFYSLLENQNE 58 Query: 69 DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117 V ALN ++R + ++ LRYVP+L F YD S++ +++ L+ Sbjct: 59 KEVQKALNKATGYLRHLLAQATV-LRYVPKLEFVYDESIERAHRISLLI 106 >gnl|CDD|184344 PRK13816, PRK13816, ribosome-binding factor A; Provisional. Length = 131 Score = 35.2 bits (81), Expect = 0.004 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 13/105 (12%) Query: 9 SRRALRVGEEVRSALMWVILNNEFQD-RLISRDVISISEVCMSVDLRVATVYISL----- 62 ++R R+ + V+ L ++ E +D RL +++IS V +S DL A VY+++ Sbjct: 2 NQRLKRMADSVQRELS-ELIRQELKDPRLGG--LVTISSVKVSPDLGYADVYVTVMGREL 58 Query: 63 ---PLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYD 104 +V+ + LN F+R + R ++ R P LRF YD Sbjct: 59 SDDQNEVAHRETLDVLNKASGFLRTELSRRIKT-RITPRLRFHYD 102 >gnl|CDD|184345 PRK13818, PRK13818, ribosome-binding factor A; Provisional. Length = 121 Score = 28.4 bits (63), Expect = 0.53 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 5/93 (5%) Query: 27 ILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLD--VSPDRVISALNCNIKFIRG 84 IL +D +S ++I+ V + DL ATVY SL + V L +R Sbjct: 19 ILRKNIRDPRLSD--VTITAVECTNDLSYATVYYSLLTEDEAKEKEVQEGLEKAKGMMRH 76 Query: 85 RIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117 +G++L + VPEL F+ D S+ K++ L+ Sbjct: 77 LLGQTL-TVYKVPELIFKRDNSVAYGSKIDRLI 108 >gnl|CDD|163109 TIGR03023, WcaJ_sugtrans, Undecaprenyl-phosphate glucose phosphotransferase. Colanic acid biosynthesis utilizes a glucose-undecaprenyl carrier, knockout of EpsB abolishes incorporation of UDP-glucose into the lipid phase and the C-terminal portion of GumD has been shown to be responsible for the glucosyl-1-transferase activity. Length = 451 Score = 27.9 bits (63), Expect = 0.80 Identities = 26/117 (22%), Positives = 37/117 (31%), Gaps = 28/117 (23%) Query: 8 NSRRALRVGEEVRSALMWVILNNE----------FQDRLISRDVISISEVCMSVD----- 52 N RR L VG + L F DR +R + V +D Sbjct: 127 NLRRVLIVGAGELGRRLAERLARNPELGYRVVGFFDDRPDARTGVRGVPVLGKLDDLEEL 186 Query: 53 ---LRVATVYISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTS 106 V VYI+LPL I + + ++R VP+L F + Sbjct: 187 IREGEVDEVYIALPLAAEDR---------ILELLDALEDLTVDVRLVPDL-FDFALL 233 >gnl|CDD|184036 PRK13407, bchI, magnesium chelatase subunit I; Provisional. Length = 334 Score = 26.4 bits (58), Expect = 2.3 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 7/55 (12%) Query: 57 TVYISLPLDVSPDRVISALNCNIKFIRGR-------IGRSLRNLRYVPELRFRYD 104 T + LPL V+ DRV+ AL+ RG + R+ R Y+ E+ D Sbjct: 88 TPVVDLPLGVTEDRVVGALDIERALTRGEKAFEPGLLARANRGYLYIDEVNLLED 142 >gnl|CDD|172578 PRK14088, dnaA, chromosomal replication initiation protein; Provisional. Length = 440 Score = 25.2 bits (55), Expect = 4.6 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 10/66 (15%) Query: 30 NEFQDRLISRDVISI--------SEVCMSVDLRVATV-YISLPLDVSPDRVISALNCNIK 80 +EFQDRL+SR + + E + ++ + + LP +V + V ++ N++ Sbjct: 242 SEFQDRLVSRFQMGLVAKLEPPDEETRKKIARKMLEIEHGELPEEVL-NFVAENVDDNLR 300 Query: 81 FIRGRI 86 +RG I Sbjct: 301 RLRGAI 306 >gnl|CDD|183046 PRK11234, nfrB, bacteriophage N4 adsorption protein B; Provisional. Length = 727 Score = 25.1 bits (55), Expect = 5.5 Identities = 32/124 (25%), Positives = 45/124 (36%), Gaps = 32/124 (25%) Query: 8 NSRRALRVG-----------EEVRSAL------MWVILNNEFQD-RLISRDVISISEVCM 49 N R LR+G E++ AL W L+ LI+ Sbjct: 505 NRVRGLRLGQSLLMQGLISAEQLAQALAEQNGVAWESLDPWQIPSSLIAE---------- 554 Query: 50 SVDLRVATVYISLPLDVSPDRVISALNCNIKFIR-GRIGRSL-RNLRYVPELRFRYDTSL 107 + VA Y LPL D +I A I + + R L R +RYV R + T L Sbjct: 555 -MPASVALHYAVLPLREEGDELIVASEDGISPVSLAALTRKLGRKVRYVIVPRGQVTTGL 613 Query: 108 QSYW 111 + +W Sbjct: 614 R-HW 616 >gnl|CDD|152576 pfam12141, DUF3589, Protein of unknown function (DUF3589). This family of proteins is found in eukaryotes. Proteins in this family are typically between 541 and 717 amino acids in length. The function of this family is not known,. Length = 488 Score = 25.0 bits (55), Expect = 6.4 Identities = 13/54 (24%), Positives = 23/54 (42%), Gaps = 5/54 (9%) Query: 58 VYISLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELR--FRYDTSLQS 109 + ++VS + LN ++K I + + L Y EL+ F+ D Q Sbjct: 6 LEFEDSVEVSKSK---NLNADLKKILDTLLKQLSTDPYYKELKPFFQPDLPEQL 56 >gnl|CDD|178166 PLN02551, PLN02551, aspartokinase. Length = 521 Score = 24.7 bits (54), Expect = 6.6 Identities = 11/23 (47%), Positives = 16/23 (69%) Query: 31 EFQDRLISRDVISISEVCMSVDL 53 F+D IS DV++ SEV +S+ L Sbjct: 389 TFEDLGISVDVVATSEVSISLTL 411 >gnl|CDD|150832 pfam10220, DUF2146, Uncharacterized conserved protein (DUF2146). This is a family of proteins conserved from plants to humans. In Dictyostelium it is annotated as Mss11p but this could not be confirmed. Mss11p is required for the activation of pseudo-hyphal and invasive growth by Ste12p in yeast. Length = 890 Score = 24.4 bits (53), Expect = 8.0 Identities = 15/64 (23%), Positives = 24/64 (37%), Gaps = 13/64 (20%) Query: 65 DVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELR-FRYDTSLQSYWKLNALMCLPKIP 123 D+S R+ AL SLR + + LR D + S K +C P++ Sbjct: 130 DLSYIRLFKALK------------SLREKKVLQFLRDMLKDCPVGSEMKSEGRLCPPRLL 177 Query: 124 VALE 127 + Sbjct: 178 FLFQ 181 >gnl|CDD|151003 pfam10423, AMNp_N, Bacterial AMP nucleoside phosphorylase N-terminus. This is the N-terminal domain of bacterial AMP nucleoside phosphorylase (AMNp). The N- and C-termini form distinct domains which intertwine with each other to form a stable monomer which associates with five other monomers to yield the active hexamer. The N-terminus consists of a long helix and a four-stranded sheet with a novel topology. The C-terminus binds the nucleoside whereas the N-terminus acts as the enzymatic regulatory domain. AMNp (EC:3.2.2.4) catalyses the hydrolysis of AMP to form adenine and ribose 5-phosphate. thereby regulating intracellular AMP levels. Length = 160 Score = 24.4 bits (54), Expect = 9.1 Identities = 8/35 (22%), Positives = 10/35 (28%), Gaps = 7/35 (20%) Query: 78 NIKFIRGRIGRSLRNLR-------YVPELRFRYDT 105 F+R L + PELR D Sbjct: 14 ATAFLRDAFQAYLDGGLPDARVRAFYPELRVTTDG 48 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.138 0.406 Gapped Lambda K H 0.267 0.0792 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,066,498 Number of extensions: 118075 Number of successful extensions: 325 Number of sequences better than 10.0: 1 Number of HSP's gapped: 316 Number of HSP's successfully gapped: 27 Length of query: 128 Length of database: 5,994,473 Length adjustment: 82 Effective length of query: 46 Effective length of database: 4,222,617 Effective search space: 194240382 Effective search space used: 194240382 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (23.3 bits)