RPSBLAST alignment of GI: 254780786 and MMDB domain: 2dyj_A_

>2dyj_A (A:) Ribosome-binding factor A; 16S rRNA processing, 17S RNA, KH domain, structural genomics, NPPSFA; 1.84A {Thermus thermophilus HB8}Length = 95
 Score = 80.1 bits (198), Expect = 1e-16
 Identities = 18/101 (17%), Positives = 43/101 (42%), Gaps = 7/101 (6%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           +     +  +++ AL   I     +D  +    +++  V +S D  V +VY+    +   
Sbjct: 2   AYGKAHLEAQLKRALAEEI--QALEDPRLFL--LTVEAVRLSKDGSVLSVYVEAFRE--E 55

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQS 109
           +  + AL+   + +   + R +R +R +P L F    +  +
Sbjct: 56  EGALRALSRAERRLVAALARRVR-MRRLPRLEFLPWRASPA 95