RPSBLAST alignment of GI: 254780786 and MMDB domain: 2e7g_A_

>2e7g_A (A:) Putative ribosome-binding factor A; RBFA, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}Length = 129
 Score = 95.6 bits (238), Expect = 2e-21
 Identities = 19/117 (16%), Positives = 40/117 (34%), Gaps = 3/117 (2%)

Query: 1   MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60
             +   ++  R   +   +  AL  ++   E    L     + +S+V ++ D      Y 
Sbjct: 4   GSSGRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDL-NVELSKVSLTPDFSACRAYW 62

Query: 61  S-LPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNAL 116
                      + + L  +   +R  +      LR VP + F  D    +  +L+ L
Sbjct: 63  KTTLSAEQNAHMEAVLQRSAAHMRHLLMSQQT-LRNVPPIVFVQDKGNAALAELDQL 118