RPSBLAST alignment of GI: 254780786 and protein with PDBid: 1pa4

>1pa4_A Probable ribosome-binding factor A; structural genomics, distant homology, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Mycoplasma pneumoniae} SCOP: d.52.7.1 Length = 116
 Score = 72.9 bits (179), Expect = 2e-14
 Identities = 19/110 (17%), Positives = 45/110 (40%), Gaps = 4/110 (3%)

Query: 8   NSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVS 67
            S +  R+  ++   +    + +E  +  +      ++ V +S DL   TVY+       
Sbjct: 2   ASYKKERLENDIIRLINR-TVIHEIYNETVKT--GHVTHVKLSDDLLHVTVYLDCYNREQ 58

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
            DRV+ A N         +  +L  L    ++ F  D ++ +  ++ +++
Sbjct: 59  IDRVVGAFNQAKGVFSRVLAHNLY-LAKAVQIHFVKDKAIDNAMRIESII 107