RPSBLAST alignment of GI: 254780786 and protein with PDBid: 2dyj

>2dyj_A Ribosome-binding factor A; 16S rRNA processing, 17S RNA, KH domain, structural genomics, NPPSFA; 1.84A {Thermus thermophilus HB8} SCOP: d.52.7.1 PDB: 2r1c_A Length = 95
 Score = 61.3 bits (149), Expect = 7e-11
 Identities = 18/98 (18%), Positives = 41/98 (41%), Gaps = 7/98 (7%)

Query: 9   SRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISLPLDVSP 68
           +     +  +++ AL   I     +D  +    +++  V +S D  V +VY+        
Sbjct: 2   AYGKAHLEAQLKRALAEEI--QALEDPRLFL--LTVEAVRLSKDGSVLSVYVEA--FREE 55

Query: 69  DRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTS 106
           +  + AL+   + +   + R +R +R +P L F    +
Sbjct: 56  EGALRALSRAERRLVAALARRVR-MRRLPRLEFLPWRA 92