RPSBLAST alignment of GI: 254780786 and protein with PDBid: 2e7g

>2e7g_A Putative ribosome-binding factor A; RBFA, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.52.7.1 Length = 129
 Score = 72.6 bits (178), Expect = 2e-14
 Identities = 19/112 (16%), Positives = 40/112 (35%), Gaps = 3/112 (2%)

Query: 7   KNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYIS-LPLD 65
           ++  R   +   +  AL  ++   E    L     + +S+V ++ D      Y       
Sbjct: 10  EDHARLRALNGLLYKALTDLLCTPEVSQELYDL-NVELSKVSLTPDFSACRAYWKTTLSA 68

Query: 66  VSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117
                + + L  +   +R  +      LR VP + F  D    +  +L+ L+
Sbjct: 69  EQNAHMEAVLQRSAAHMRHLLMSQQT-LRNVPPIVFVQDKGNAALAELDQLL 119