RPSBLAST alignment of GI: 254780786 and SCOP domain: d1josa_

Alignment
>d1josa_ d.52.7.1 (A:) Ribosome-binding factor A, RbfA {Haemophilus influenzae [TaxId: 727]} Length = 100
 Score = 70.7 bits (173), Expect = 4e-14
 Identities = 32/100 (32%), Positives = 59/100 (59%), Gaps = 7/100 (7%)

Query: 11  RALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYISL---PLDVS 67
           R+ RV +E++  +  VIL  E +D  I    +++S+V +S DL  A ++++      +++
Sbjct: 1   RSDRVAQEIQKEIA-VILQREVKDPRIGM--VTVSDVEVSSDLSYAKIFVTFLFDHDEMA 57

Query: 68  PDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSL 107
            ++ +  L     +IR  +G+++R LR VPE+RF YD SL
Sbjct: 58  IEQGMKGLEKASPYIRSLLGKAMR-LRIVPEIRFIYDQSL 96

SCOP domain information

class: Alpha and beta proteins (a+b)
fold: Alpha-lytic protease prodomain-like
superfamily: Ribosome-binding factor A, RbfA
family: Ribosome-binding factor A, RbfA
domain: Ribosome-binding factor A, RbfA
species: Haemophilus influenzae [TaxId: 727]