BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780786|ref|YP_003065199.1| ribosome-binding factor A [Candidatus Liberibacter asiaticus str. psy62] (128 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780786|ref|YP_003065199.1| ribosome-binding factor A [Candidatus Liberibacter asiaticus str. psy62] Length = 128 Score = 256 bits (655), Expect = 6e-71, Method: Compositional matrix adjust. Identities = 128/128 (100%), Positives = 128/128 (100%) Query: 1 MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60 MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI Sbjct: 1 MKNKNPKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVISISEVCMSVDLRVATVYI 60 Query: 61 SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120 SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP Sbjct: 61 SLPLDVSPDRVISALNCNIKFIRGRIGRSLRNLRYVPELRFRYDTSLQSYWKLNALMCLP 120 Query: 121 KIPVALEK 128 KIPVALEK Sbjct: 121 KIPVALEK 128 >gi|255764472|ref|YP_003064841.2| 2-methylthioadenine synthetase (miaB-like) protein [Candidatus Liberibacter asiaticus str. psy62] Length = 469 Score = 23.9 bits (50), Expect = 1.1, Method: Compositional matrix adjust. Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 52 DLRVATVYISLPLDVSPDRVISALN 76 DL V Y+ LP+ DR++ ++N Sbjct: 283 DLDVLMPYLHLPVQSGSDRILKSMN 307 >gi|254781033|ref|YP_003065446.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 23.5 bits (49), Expect = 1.5, Method: Compositional matrix adjust. Identities = 11/24 (45%), Positives = 13/24 (54%) Query: 46 EVCMSVDLRVATVYISLPLDVSPD 69 E C DL A Y + LD+SPD Sbjct: 163 ESCRIGDLNSAQRYATKALDISPD 186 >gi|254780316|ref|YP_003064729.1| phenylalanyl-tRNA synthetase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Score = 23.1 bits (48), Expect = 1.8, Method: Compositional matrix adjust. Identities = 11/23 (47%), Positives = 15/23 (65%) Query: 65 DVSPDRVISALNCNIKFIRGRIG 87 D+SPD V+ A + I+ I G IG Sbjct: 296 DLSPDNVVIASDGRIQSIAGIIG 318 >gi|254780963|ref|YP_003065376.1| hypothetical protein CLIBASIA_04320 [Candidatus Liberibacter asiaticus str. psy62] Length = 215 Score = 22.3 bits (46), Expect = 2.9, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 15/25 (60%), Gaps = 4/25 (16%) Query: 25 WVILNNEFQDRLISRDVISISEVCM 49 W+IL ++F R S DV+ VCM Sbjct: 150 WLILQSDFAIRHASSDVV----VCM 170 >gi|254780751|ref|YP_003065164.1| ribonuclease E [Candidatus Liberibacter asiaticus str. psy62] Length = 723 Score = 22.3 bits (46), Expect = 2.9, Method: Compositional matrix adjust. Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 103 YDTSLQSYWKLNALMCLPK 121 YD +++ W+ AL+ +PK Sbjct: 590 YDKNIECVWQDEALLPIPK 608 >gi|254780662|ref|YP_003065075.1| NAD-glutamate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 1576 Score = 22.3 bits (46), Expect = 2.9, Method: Compositional matrix adjust. Identities = 11/34 (32%), Positives = 21/34 (61%) Query: 40 DVISISEVCMSVDLRVATVYISLPLDVSPDRVIS 73 D+I ISE C + L V ++ ++ + + DR++S Sbjct: 1457 DLIDISETCDTSLLVVLDMWSAISVGLGVDRLLS 1490 >gi|254780523|ref|YP_003064936.1| flagellar hook-associated protein FlgL [Candidatus Liberibacter asiaticus str. psy62] Length = 357 Score = 21.6 bits (44), Expect = 4.9, Method: Compositional matrix adjust. Identities = 11/38 (28%), Positives = 19/38 (50%) Query: 6 PKNSRRALRVGEEVRSALMWVILNNEFQDRLISRDVIS 43 ++S L++G V S L W N +RL S +++ Sbjct: 36 GQSSDYGLQLGARVTSILEWEQEKNHIAERLHSNSLVT 73 >gi|254780417|ref|YP_003064830.1| transcriptional regulator CarD family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 188 Score = 21.6 bits (44), Expect = 5.2, Method: Compositional matrix adjust. Identities = 9/25 (36%), Positives = 15/25 (60%) Query: 24 MWVILNNEFQDRLISRDVISISEVC 48 MW E+ ++ S D+I+I+EV Sbjct: 95 MWSRRAQEYDAKINSGDLIAIAEVV 119 >gi|254780480|ref|YP_003064893.1| 2'-deoxycytidine 5'-triphosphate deaminase [Candidatus Liberibacter asiaticus str. psy62] Length = 367 Score = 21.2 bits (43), Expect = 6.4, Method: Compositional matrix adjust. Identities = 10/33 (30%), Positives = 18/33 (54%) Query: 85 RIGRSLRNLRYVPELRFRYDTSLQSYWKLNALM 117 R+G L +R+V E +F L + +L+ L+ Sbjct: 151 RVGSRLSQIRFVKERKFCSQEELSALHELSPLV 183 >gi|254781103|ref|YP_003065516.1| penicillin-binding transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 598 Score = 20.8 bits (42), Expect = 8.5, Method: Composition-based stats. Identities = 9/36 (25%), Positives = 19/36 (52%) Query: 40 DVISISEVCMSVDLRVATVYISLPLDVSPDRVISAL 75 D+I + ++ D+ ++Y+ +SPD +I L Sbjct: 118 DIIDRNGEILATDIPTFSLYVEPHKVISPDEIIEKL 153 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.138 0.406 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,281 Number of Sequences: 1233 Number of extensions: 2721 Number of successful extensions: 15 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 2 Number of HSP's gapped (non-prelim): 13 length of query: 128 length of database: 328,796 effective HSP length: 65 effective length of query: 63 effective length of database: 248,651 effective search space: 15665013 effective search space used: 15665013 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 33 (17.3 bits)