>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division. Among the Ras superfamily, Ran is a unique small G protein. It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily. Ran may therefore interact with a wide range of proteins in various intracellular locations. Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors. Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins. The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is

Probab=99.14 E-value=8e-10 Score=85.15 Aligned_cols=141 Identities=18% Similarity=0.266 Sum_probs=94.2 Q ss_pred EEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEECCCE--E--EEECC--CCEEEEEECCCHHHHHHHHHHHHHCCCCEEE Q ss_conf 8986236850446777886422210012310001214--9--99517--8438888516615789998666420680599 Q gi|254780787|r 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGA--Y--QVAYQ--GKNITFLDTPGHAAFYEMRARGARVTDIAVL 459 (884) Q Consensus 386 v~v~ghvd~GKt~lld~~r~~~~~~~e~ggitq~iga--~--~~~~~--~~~~~~iDtPGh~~f~~~r~rg~~~~d~~il 459 (884) T Consensus 3 ivlvGd~~VGKTsli~r~~~~~f~~~----~~~Tig~~~~~~~~~~~~~~v~l~iwDtaGqe~~~~l~~~y~~~a~~~il 78 (166) T cd00877 3 LVLVGDGGTGKTTFVKRHLTGEFEKK----YVATLGVEVHPLDFHTNRGKIRFNVWDTAGQEKFGGLRDGYYIGGQCAII 78 (166) T ss_pred EEEECCCCCCHHHHHHHHHHCCCCCC----CCCCCCEEEEEEEEEECCEEEEEEEEECCCCHHHHHHHHHHHCCCCEEEE T ss_conf 99999999888999999983999998----68732556799999999979999999757871566687887400657998 Q ss_pred EEECCCCCCHHHHHHHHH----H--HHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCC Q ss_conf 998366740235777898----9--9709941561233124433200022100001320001234740363110024774 Q gi|254780787|r 460 VLAADEEIMPQAIESINH----A--KAADVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNL 533 (884) Q Consensus 460 vv~~~~g~~~qt~e~~~~----~--~~~~~p~iva~nk~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 533 (884) T Consensus 79 vyDvt~---~~Sf~~v~~w~~~i~~~~~~~piilVgNK~Dl~~~~---~~~~~~~---~~~~--~~~~~~EtSAk~~~nV 147 (166) T cd00877 79 MFDVTS---RVTYKNVPNWHRDLVRVCGNIPIVLCGNKVDIKDRK---VKAKQIT---FHRK--KNLQYYEISAKSNYNF 147 (166) T ss_pred ECCCCC---HHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCCC---CCHHHHH---HHHH--CCCEEEEECCCCCCCH T ss_conf 437898---889999999999999868999899999862175036---6799999---9997--8998999845899098 Q ss_pred CCCCCCHH Q ss_conf 11221000 Q gi|254780787|r 534 DKLLDAIL 541 (884) Q Consensus 534 ~~~~~~~~ 541 (884) T Consensus 148 ~e~F~~la 155 (166) T cd00877 148 EKPFLWLA 155 (166) T ss_pred HHHHHHHH T ss_conf 99999999

HHsearch alignment for GI: 254780787 and conserved domain: cd00877