>cd01342 Translation_Factor_II_like Translation_Factor_II_like: Elongation factor Tu (EF-Tu) domain II-like proteins. Elongation factor Tu consists of three structural domains, this family represents the second domain. Domain II adopts a beta barrel structure and is involved in binding to charged tRNA. Domain II is found in other proteins such as elongation factor G and translation initiation factor IF-2. This group also includes the C2 subdomain of domain IV of IF-2 that has the same fold as domain II of (EF-Tu). Like IF-2 from certain prokaryotes such as Thermus thermophilus, mitochondrial IF-2 lacks domain II, which is thought to be involved in binding of E.coli IF-2 to 30S subunits.

Probab=98.62 E-value=7.6e-08 Score=71.64 Aligned_cols=81 Identities=37% Similarity=0.559 Sum_probs=73.2 Q ss_pred EEEEEEEEECCCCCCEEEEEEEEEEEECCCEEEEEECCEEEEEEEEHHHHHCCHHHHHHHCCCEEEEEEECCEEEEECCE Q ss_conf 89997887338987078999852178469807996699899822625766446006687279766999728411005898 Q gi|254780787|r 792 NAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYDNIQAGDM 871 (884) Q Consensus 792 ~a~v~~vF~~~k~~~i~G~~V~~G~i~~~~~~~v~r~~~~i~~g~i~sl~~~k~~v~ev~~g~ecgi~~~~~~~~~~gD~ 871 (884) T Consensus 2 ~~~v~~~~~~~~~g~v~~~rv~~G~l~~g~~v~~~~~~~~-~~~~v~~i~~~~~~~~~~~aG~~~~~~~~~~~~~~~gd~ 80 (83) T cd01342 2 RALVFKVFKDKGRGTVATGRVESGTLKKGDKVRVGPGGGG-VKGKVKSLKRFKGEVDEAVAGDIVGIVLKDKDDIKIGDT 80 (83) T ss_pred EEEEEEEEEECCCEEEEEEEECCCEEECCCEEEEECCCCC-EEEEEEEEEEECCCCCEECCCCEEEEEECCHHHCCCCCE T ss_conf 1299999991896899999993429989999999709963-899998999922377798489899999716353479989 Q ss_pred EE Q ss_conf 99 Q gi|254780787|r 872 IE 873 (884) Q Consensus 872 i~ 873 (884) T Consensus 81 ~~ 82 (83) T cd01342 81 LT 82 (83) T ss_pred EC T ss_conf 82

HHsearch alignment for GI: 254780787 and conserved domain: cd01342