>cd01865 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D. All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression. Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules. Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot

Probab=99.01 E-value=7.1e-10 Score=85.50 Aligned_cols=146 Identities=18% Similarity=0.213 Sum_probs=96.1 Q ss_pred EEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEECCCE------EEEECCCCEEEEEECCCHHHHHHHHHHHHHCCCCEEE Q ss_conf 8986236850446777886422210012310001214------9995178438888516615789998666420680599 Q gi|254780787|r 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGA------YQVAYQGKNITFLDTPGHAAFYEMRARGARVTDIAVL 459 (884) Q Consensus 386 v~v~ghvd~GKt~lld~~r~~~~~~~e~ggitq~iga------~~~~~~~~~~~~iDtPGh~~f~~~r~rg~~~~d~~il 459 (884) T Consensus 4 ivllGd~~VGKTsli~r~~~~~f~~~y----~~Tig~~~~~k~i~~~~~~i~l~iwDtaGqe~~~~l~~~y~~~a~~~il 79 (165) T cd01865 4 LLIIGNSSVGKTSFLFRYADDSFTSAF----VSTVGIDFKVKTVFRNDKRVKLQIWDTAGQERYRTITTAYYRGAMGFIL 79 (165) T ss_pred EEEECCCCCCHHHHHHHHHCCCCCCCC----CCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCCCHHHHHHCCCEEEE T ss_conf 999999996889999999249889976----8876378799999999999999999699983455441544113544899 Q ss_pred EEECCCCCCHHHHHH-HHHHHHC---CCCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCCCCC Q ss_conf 998366740235777-8989970---994156123312443320002210000132000123474036311002477411 Q gi|254780787|r 460 VLAADEEIMPQAIES-INHAKAA---DVSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNLNLDK 535 (884) Q Consensus 460 vv~~~~g~~~qt~e~-~~~~~~~---~~p~iva~nk~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 535 (884) T Consensus 80 vydit~~~Sf~~~~~w~~~i~~~~~~~~~iilvgNK~DL~~~r--~v~~~~~~--~~a~~~--~~~~~E~SAk~~~nV~e 153 (165) T cd01865 80 MYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDER--VVSSERGR--QLADQL--GFEFFEASAKENINVKQ 153 (165) T ss_pred EECCCCHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCC--CCCHHHHH--HHHHHC--CCEEEEECCCCCCCHHH T ss_conf 8517887999999999999998689872599960242355518--89999999--999986--99799976898908899 Q ss_pred CCCCHH Q ss_conf 221000 Q gi|254780787|r 536 LLDAIL 541 (884) Q Consensus 536 ~~~~~~ 541 (884) T Consensus 154 ~F~~l~ 159 (165) T cd01865 154 VFERLV 159 (165) T ss_pred HHHHHH T ss_conf 999999

HHsearch alignment for GI: 254780787 and conserved domain: cd01865