>cd01885 EF2 EF2 (for archaea and eukarya). Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes. The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome. The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins. Two major mechanisms are known to regulate protein elongation and both involve eEF2. First, eEF2 can be modulated by reversible phosphorylation. Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes. Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2. In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation. Seco

Probab=99.98 E-value=3.9e-32 Score=237.79 Aligned_cols=113 Identities=31% Similarity=0.415 Sum_probs=95.9 Q ss_pred EEEEEECCCCCHHHHHHHHHHH-HHH-HC--------------CCCCCEECCCEEEEE----------CCCCEEEEEECC Q ss_conf 3898623685044677788642-221-00--------------123100012149995----------178438888516 Q gi|254780787|r 385 VVTIMGHVDHGKTSLLDAIRKA-DVA-KG--------------EIGGITQHIGAYQVA----------YQGKNITFLDTP 438 (884) Q Consensus 385 vv~v~ghvd~GKt~lld~~r~~-~~~-~~--------------e~ggitq~iga~~~~----------~~~~~~~~iDtP 438 (884) T Consensus 2 Ni~iigHvdhGKTTL~D~Ll~~~g~i~~~~~g~~~~~D~~~~E~eRgiTIks~~isl~~~~~~~~~~~~~~~~inlIDTP 81 (222) T cd01885 2 NICIIAHVDHGKTTLSDSLLASAGIISEKLAGKARYMDSREDEQERGITMKSSAISLYFEYEEEDKADGNEYLINLIDSP 81 (222) T ss_pred EEEEECCCCCCHHHHHHHHHHHCCCCCHHCCCCEEECCCHHHHHHCCCEEEEEEEEEEEEECCCCCCCCCCEEEEEEECC T ss_conf 69998668877999999999985984121066346514243342054158622689998603443456886389997288 Q ss_pred CHHHHHHHHHHHHHCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCEEEECCCCCCCCC Q ss_conf 61578999866642068059999836674023577789899709941561233124433 Q gi|254780787|r 439 GHAAFYEMRARGARVTDIAVLVLAADEEIMPQAIESINHAKAADVSIIVAINKIDKLGA 497 (884) Q Consensus 439 Gh~~f~~~r~rg~~~~d~~ilvv~~~~g~~~qt~e~~~~~~~~~~p~iva~nk~d~~~~ 497 (884) T Consensus 82 GH~dF~~ev~~al~~~DgailVVDa~eGv~~qT~~vl~~a~~~~l~~il~iNKiDRli~ 140 (222) T cd01885 82 GHVDFSSEVTAALRLCDGALVVVDAVEGVCVQTETVLRQALKERVKPVLVINKIDRLIL 140 (222) T ss_pred CHHHHHHHHHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEEEECCCCCCH T ss_conf 56989999999998568179961045785778999999999859997999989036500

HHsearch alignment for GI: 254780787 and conserved domain: cd01885