>cd03692 mtIF2_IVc mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor EF-Tu. The C-terminal part of mtIF2 contains the entire fMet-tRNAfmet binding site of IF-2 and is resistant to proteolysis. This C-terminal portion consists of two domains, IF2 C1 and IF2 C2. IF2 C2 been shown to contain all molecular determinants necessary and sufficient for the recognition and binding of fMet-tRNAfMet. Like IF2 from certain prokaryotes such as Thermus thermophilus, mtIF2lacks domain II which is thought to be involved in binding of E.coli IF-2 to 30S subunits.

Probab=99.93 E-value=4.2e-26 Score=196.52 Aligned_cols=84 Identities=52% Similarity=1.030 Sum_probs=82.6 Q ss_pred EEEEEEEEEECCCCCCEEEEEEEEEEEECCCEEEEEECCEEEEEEEEHHHHHCCHHHHHHHCCCEEEEEEECCEEEEECC Q ss_conf 78999788733898707899985217846980799669989982262576644600668727976699972841100589 Q gi|254780787|r 791 GNAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKYDNIQAGD 870 (884) Q Consensus 791 g~a~v~~vF~~~k~~~i~G~~V~~G~i~~~~~~~v~r~~~~i~~g~i~sl~~~k~~v~ev~~g~ecgi~~~~~~~~~~gD 870 (884) T Consensus 1 G~a~V~~vF~~~k~~~IAGc~V~~G~i~~~~~vrv~R~~~~i~~G~I~sLk~~K~~V~eV~~G~ECGi~l~~~~d~~~GD 80 (84) T cd03692 1 GEAEVRAVFKISKVGNIAGCYVTDGKIKRNAKVRVLRNGEVIYEGKISSLKRFKDDVKEVKKGYECGITLENFNDIKVGD 80 (84) T ss_pred CEEEEEEEEECCCCEEEEEEEEEECEEECCCEEEEEECCEEEEEEEEHHHHHCCCCCCEECCCCEEEEEECCCCCCCCCC T ss_conf 97999999998996089899998099972995999989999998366656003435578768818679957847677798 Q ss_pred EEEE Q ss_conf 8999 Q gi|254780787|r 871 MIEC 874 (884) Q Consensus 871 ~i~~ 874 (884) T Consensus 81 ~iea 84 (84) T cd03692 81 IIEA 84 (84) T ss_pred EEEC T ss_conf 9809

HHsearch alignment for GI: 254780787 and conserved domain: cd03692