>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages. EF-1A is very abundant in the cytosol, where it is involved in the GTP-dependent binding of aminoacyl-tRNAs to the A site of the ribosomes in the second step of translation from mRNAs to proteins. Both domain II of EF1A and domain IV of IF2/eIF5B have been implicated in recognition of the 3'-ends of tRNA. More than 61% of eukaryotic elongation factor 1A (eEF-1A) in cells is estimated to be associated with actin cytoskeleton. The binding of eEF1A to actin is a noncanonical function that may link two distinct cellular processes, cytoskeleton organization and gene expression.

Probab=98.15 E-value=5.1e-06 Score=59.15 Aligned_cols=80 Identities=19% Similarity=0.399 Sum_probs=71.1 Q ss_pred EEEEEEEEECCCCCCEEEEEEEEEEEECCCEEEEEECCEEEEEEEEHHHHHCCHHHHHHHCCCEEEEEEECC--EEEEEC Q ss_conf 899978873389870789998521784698079966998998226257664460066872797669997284--110058 Q gi|254780787|r 792 NAEVLEVFAVTKLGNVAGCKVSEGKVERGSGVRLIRNSTVIYEGKLKTLKRFKDEVSEVHAGQDCGMAFEKY--DNIQAG 869 (884) Q Consensus 792 ~a~v~~vF~~~k~~~i~G~~V~~G~i~~~~~~~v~r~~~~i~~g~i~sl~~~k~~v~ev~~g~ecgi~~~~~--~~~~~g 869 (884) T Consensus 6 RmpId~vf~i~G~GtVvtG~v~~G~i~~gd~v~i~P~~~~---~~VksI~~~~~~~~~a~aGd~v~l~L~gi~~~~i~rG 82 (91) T cd03693 6 RLPIQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPAGVT---GEVKSVEMHHEPLEEALPGDNVGFNVKNVSKKDIKRG 82 (91) T ss_pred EEEEEEEEECCCCEEEEEEEEEECEEECCCEEEECCCCCE---EEEEEEEECCCCCCEECCCCEEEEEECCCCHHHCCCC T ss_conf 8899889972995699999981177857999772786433---7999999988495888899899999879989992676 Q ss_pred CEEEE Q ss_conf 98999 Q gi|254780787|r 870 DMIEC 874 (884) Q Consensus 870 D~i~~ 874 (884) T Consensus 83 ~Vl~~ 87 (91) T cd03693 83 DVAGD 87 (91) T ss_pred CEEEC T ss_conf 89955

HHsearch alignment for GI: 254780787 and conserved domain: cd03693