>cd04109 Rab28 Rab28 subfamily. First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA). In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos. Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus. The two human isoforms are presumbly the result of alternative splicing. Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs

Probab=98.91 E-value=1.2e-08 Score=77.07 Aligned_cols=146 Identities=21% Similarity=0.240 Sum_probs=95.1 Q ss_pred EEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEECCCE-E---EEECC---CCEEEEEECCCHHHHHHHHHHHHHCCCCEE Q ss_conf 8986236850446777886422210012310001214-9---99517---843888851661578999866642068059 Q gi|254780787|r 386 VTIMGHVDHGKTSLLDAIRKADVAKGEIGGITQHIGA-Y---QVAYQ---GKNITFLDTPGHAAFYEMRARGARVTDIAV 458 (884) Q Consensus 386 v~v~ghvd~GKt~lld~~r~~~~~~~e~ggitq~iga-~---~~~~~---~~~~~~iDtPGh~~f~~~r~rg~~~~d~~i 458 (884) T Consensus 3 vvllGd~~VGKTSli~rf~~~~F~~----~y~~TiG~d~~~k~i~i~~~~~v~l~iwDtaGqe~~~~~~~~y~~~a~~~i 78 (215) T cd04109 3 IVVLGDGAVGKTSLCRRFAKEGFGK----SYKQTIGLDFFSKRVTLPGNLNVTLQVWDIGGQSIGGKMLDKYIYGAHAVF 78 (215) T ss_pred EEEECCCCCCHHHHHHHHHHCCCCC----CCCCCCCEEEEEEEEEECCCCEEEEEEEECCCCCCHHHHHHHHHHHHCCEE T ss_conf 9999999970999999997498988----778865578899999987994699999969985002378999997515137 Q ss_pred EEEECCCCCCHHHHHHHH-----HHHHCC--CCEEEECCCCCCCCCCCCHHHHHHHCCCCCCCCCCCCCEEEEEEECCCC Q ss_conf 999836674023577789-----899709--9415612331244332000221000013200012347403631100247 Q gi|254780787|r 459 LVLAADEEIMPQAIESIN-----HAKAAD--VSIIVAINKIDKLGADPQKVRMSLLKHDVFVESMGGDILDVEISAKNNL 531 (884) Q Consensus 459 lvv~~~~g~~~qt~e~~~-----~~~~~~--~p~iva~nk~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 531 (884) T Consensus 79 lVYDitn~~SF~~l~~W~~~i~~~~~~~~~~~~iiLVGNK~DL~~~R--~Vs~e--e~~~~A~~~--g~~f~E~SAktg~ 152 (215) T cd04109 79 LVYDVTNSQSFENLEDWYSMVRKVLKSSETQPLVVLVGNKTDLEHNR--TVKDD--KHARFAQAN--GMESCLVSAKTGD 152 (215) T ss_pred EECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHC--CCCHH--HHHHHHHHC--CCEEEEEECCCCC T ss_conf 74147867899989999999999850457785299997545428647--76999--999999982--9989998389994 Q ss_pred CCCCCCCCHH Q ss_conf 7411221000 Q gi|254780787|r 532 NLDKLLDAIL 541 (884) Q Consensus 532 ~~~~~~~~~~ 541 (884) T Consensus 153 nV~e~F~~la 162 (215) T cd04109 153 RVNLLFQQLA 162 (215) T ss_pred CHHHHHHHHH T ss_conf 9899999999

HHsearch alignment for GI: 254780787 and conserved domain: cd04109